MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000149 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617203758775411^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_20_K1_5.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=30
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	54-UNIMOD:21,46-UNIMOD:35,49-UNIMOD:35,55-UNIMOD:21,241-UNIMOD:21,62-UNIMOD:21	0.16	49.0	22	4	2
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	107-UNIMOD:21,108-UNIMOD:4,83-UNIMOD:21,102-UNIMOD:21	0.25	47.0	14	7	2
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	332-UNIMOD:21,335-UNIMOD:21	0.05	46.0	3	2	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	109-UNIMOD:21,107-UNIMOD:28,400-UNIMOD:21	0.07	45.0	6	2	1
PRT	sp|Q7Z4S6|KI21A_HUMAN	Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	853-UNIMOD:21	0.02	44.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	1542-UNIMOD:21,1220-UNIMOD:21	0.01	42.0	2	2	2
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	92-UNIMOD:21	0.03	41.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	488-UNIMOD:21,493-UNIMOD:35,494-UNIMOD:35,185-UNIMOD:21,490-UNIMOD:35	0.10	40.0	18	5	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.18	40.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	49-UNIMOD:21,131-UNIMOD:21,51-UNIMOD:21,113-UNIMOD:21,347-UNIMOD:21	0.17	40.0	7	6	5
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	29-UNIMOD:21	0.07	39.0	2	1	0
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	359-UNIMOD:21,406-UNIMOD:21,283-UNIMOD:21	0.08	39.0	6	5	4
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1053-UNIMOD:21,1054-UNIMOD:35,1044-UNIMOD:21	0.03	39.0	7	2	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	460-UNIMOD:21,462-UNIMOD:21,479-UNIMOD:21,452-UNIMOD:21,466-UNIMOD:35,412-UNIMOD:4,58-UNIMOD:21	0.11	39.0	12	7	5
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	324-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|P54252|ATX3_HUMAN	Ataxin-3 OS=Homo sapiens OX=9606 GN=ATXN3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	265-UNIMOD:21	0.06	39.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	46-UNIMOD:21,39-UNIMOD:21,336-UNIMOD:21,339-UNIMOD:4,37-UNIMOD:21,36-UNIMOD:21,3-UNIMOD:21,132-UNIMOD:21	0.22	38.0	10	7	6
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	448-UNIMOD:21,124-UNIMOD:21,189-UNIMOD:21,107-UNIMOD:21,86-UNIMOD:21	0.16	38.0	9	8	7
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	37-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	2-UNIMOD:1,2-UNIMOD:21,243-UNIMOD:21,255-UNIMOD:35	0.15	38.0	4	2	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	36-UNIMOD:21	0.07	37.0	5	2	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	119-UNIMOD:21	0.03	37.0	2	2	2
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	133-UNIMOD:21,413-UNIMOD:4,414-UNIMOD:21	0.05	37.0	3	2	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1385-UNIMOD:21,1389-UNIMOD:4,1387-UNIMOD:21,1760-UNIMOD:21,1390-UNIMOD:21	0.01	37.0	5	3	2
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	54-UNIMOD:21	0.03	37.0	3	1	0
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1184-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	2-UNIMOD:1,2-UNIMOD:21,95-UNIMOD:21	0.10	37.0	3	2	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	140-UNIMOD:21	0.06	36.0	3	2	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	45-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	174-UNIMOD:21,454-UNIMOD:21,459-UNIMOD:35,175-UNIMOD:21	0.06	36.0	3	2	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	86-UNIMOD:21,83-UNIMOD:21,91-UNIMOD:35,36-UNIMOD:4,42-UNIMOD:21,36-UNIMOD:385,149-UNIMOD:21	0.22	36.0	14	3	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	852-UNIMOD:21,605-UNIMOD:21,356-UNIMOD:21	0.04	36.0	5	3	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	58-UNIMOD:21,249-UNIMOD:21,255-UNIMOD:4	0.10	36.0	7	2	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	58-UNIMOD:21,258-UNIMOD:21,305-UNIMOD:21,60-UNIMOD:21	0.13	36.0	9	5	2
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	235-UNIMOD:35	0.17	36.0	8	3	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.09	36.0	12	1	0
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	1260-UNIMOD:28,1263-UNIMOD:21,453-UNIMOD:21,451-UNIMOD:28,867-UNIMOD:21,1246-UNIMOD:21,1265-UNIMOD:21	0.03	36.0	8	6	4
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,2-UNIMOD:21	0.13	36.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	185-UNIMOD:21,189-UNIMOD:35,194-UNIMOD:35,163-UNIMOD:21,155-UNIMOD:21	0.24	35.0	12	4	2
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	635-UNIMOD:4,636-UNIMOD:21,521-UNIMOD:21,827-UNIMOD:21,635-UNIMOD:385,899-UNIMOD:21	0.05	35.0	9	5	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	65-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	45-UNIMOD:21,69-UNIMOD:21,43-UNIMOD:35	0.21	35.0	5	2	1
PRT	sp|O14828|SCAM3_HUMAN	Secretory carrier-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=SCAMP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	85-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|Q16637|SMN_HUMAN	Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	25-UNIMOD:21	0.07	35.0	3	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	641-UNIMOD:21,652-UNIMOD:21	0.04	35.0	3	2	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	57-UNIMOD:21,58-UNIMOD:21,30-UNIMOD:21	0.22	35.0	6	3	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	237-UNIMOD:4,141-UNIMOD:21	0.18	35.0	4	3	2
PRT	sp|Q9Y241|HIG1A_HUMAN	HIG1 domain family member 1A, mitochondrial OS=Homo sapiens OX=9606 GN=HIGD1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,2-UNIMOD:21	0.20	35.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	452-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q96B23|CR025_HUMAN	Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	66-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	7-UNIMOD:21,2-UNIMOD:1	0.08	34.0	3	2	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	142-UNIMOD:4,143-UNIMOD:21,145-UNIMOD:4,151-UNIMOD:4,154-UNIMOD:4,24-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4	0.10	34.0	3	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	47-UNIMOD:21,59-UNIMOD:21,60-UNIMOD:21,65-UNIMOD:21	0.19	34.0	6	4	3
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	623-UNIMOD:21,625-UNIMOD:35,628-UNIMOD:35,317-UNIMOD:21,460-UNIMOD:21,624-UNIMOD:21	0.12	34.0	14	8	3
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	2-UNIMOD:1,14-UNIMOD:21,16-UNIMOD:35,17-UNIMOD:4,199-UNIMOD:21,194-UNIMOD:21	0.10	34.0	9	4	2
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	145-UNIMOD:21,298-UNIMOD:21,299-UNIMOD:35,40-UNIMOD:21,50-UNIMOD:35,281-UNIMOD:21	0.21	34.0	7	4	2
PRT	sp|P06865|HEXA_HUMAN	Beta-hexosaminidase subunit alpha OS=Homo sapiens OX=9606 GN=HEXA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	226-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	286-UNIMOD:21	0.07	33.0	4	2	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	496-UNIMOD:21,416-UNIMOD:21,420-UNIMOD:35,414-UNIMOD:35	0.06	33.0	4	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	182-UNIMOD:21,107-UNIMOD:21,183-UNIMOD:21,186-UNIMOD:21	0.04	33.0	8	6	4
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	215-UNIMOD:21,1053-UNIMOD:21	0.03	33.0	4	2	1
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,10-UNIMOD:21	0.02	33.0	2	2	2
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	114-UNIMOD:21	0.04	32.0	2	2	2
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	303-UNIMOD:21,437-UNIMOD:21,438-UNIMOD:35	0.08	32.0	2	2	2
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	105-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	377-UNIMOD:21,193-UNIMOD:21,240-UNIMOD:21	0.08	32.0	4	4	4
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	717-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	30-UNIMOD:21,38-UNIMOD:35	0.04	32.0	9	2	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	695-UNIMOD:21,696-UNIMOD:21,910-UNIMOD:21,445-UNIMOD:21,995-UNIMOD:21,692-UNIMOD:21,477-UNIMOD:21	0.07	32.0	6	6	6
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	6967-UNIMOD:21,4521-UNIMOD:21,7333-UNIMOD:21,7344-UNIMOD:4,3929-UNIMOD:21	0.01	32.0	5	4	3
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	668-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	2-UNIMOD:1,13-UNIMOD:21,218-UNIMOD:21,226-UNIMOD:4,2-UNIMOD:21,12-UNIMOD:35,11-UNIMOD:21,6-UNIMOD:35	0.13	32.0	14	3	2
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	462-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|P36776|LONM_HUMAN	Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	548-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	2152-UNIMOD:21,2160-UNIMOD:4,2336-UNIMOD:21	0.01	31.0	2	2	2
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	358-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	235-UNIMOD:21,236-UNIMOD:21,240-UNIMOD:21	0.05	31.0	3	1	0
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	105-UNIMOD:21,113-UNIMOD:4,106-UNIMOD:35,79-UNIMOD:21	0.03	31.0	4	2	1
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	31.0	null	627-UNIMOD:21,371-UNIMOD:21	0.02	31.0	3	3	3
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	11-UNIMOD:21,15-UNIMOD:21,140-UNIMOD:21	0.08	31.0	3	3	3
PRT	sp|P10109|ADX_HUMAN	Adrenodoxin, mitochondrial OS=Homo sapiens OX=9606 GN=FDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	177-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	50-UNIMOD:21	0.08	31.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	333-UNIMOD:21,331-UNIMOD:21,335-UNIMOD:21,334-UNIMOD:21	0.10	31.0	5	3	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1539-UNIMOD:21,1443-UNIMOD:21,1458-UNIMOD:21,1466-UNIMOD:35,1101-UNIMOD:21,968-UNIMOD:21,1102-UNIMOD:21,871-UNIMOD:21,872-UNIMOD:4,1043-UNIMOD:21,2690-UNIMOD:21,2115-UNIMOD:21,2116-UNIMOD:4,2123-UNIMOD:21,848-UNIMOD:21,854-UNIMOD:21,1003-UNIMOD:21	0.06	31.0	14	12	10
PRT	sp|P18859|ATP5J_HUMAN	ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	57-UNIMOD:21,56-UNIMOD:21	0.19	31.0	2	1	0
PRT	sp|O00458|IFRD1_HUMAN	Interferon-related developmental regulator 1 OS=Homo sapiens OX=9606 GN=IFRD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	14-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	37-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	96-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21	0.18	31.0	5	3	1
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	63-UNIMOD:21,65-UNIMOD:21,116-UNIMOD:21	0.17	31.0	5	2	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	349-UNIMOD:21,357-UNIMOD:4,337-UNIMOD:4,339-UNIMOD:4,72-UNIMOD:21,336-UNIMOD:21	0.18	31.0	10	6	3
PRT	sp|Q8IX94|CTGE4_HUMAN	cTAGE family member 4 OS=Homo sapiens OX=9606 GN=CTAGE4 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	140-UNIMOD:21,148-UNIMOD:4	0.02	31.0	2	2	2
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	112-UNIMOD:21	0.10	31.0	3	2	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	188-UNIMOD:21,195-UNIMOD:21,230-UNIMOD:385,230-UNIMOD:4,234-UNIMOD:21	0.05	31.0	4	2	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	671-UNIMOD:21,651-UNIMOD:21,675-UNIMOD:21	0.06	31.0	3	2	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	162-UNIMOD:21,163-UNIMOD:21,173-UNIMOD:4	0.08	31.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,3-UNIMOD:21,8-UNIMOD:21,139-UNIMOD:4,129-UNIMOD:21	0.27	31.0	10	4	3
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	270-UNIMOD:21,268-UNIMOD:28	0.13	30.0	7	4	3
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	473-UNIMOD:21,138-UNIMOD:21,280-UNIMOD:21,471-UNIMOD:21,482-UNIMOD:35	0.07	30.0	7	6	5
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	189-UNIMOD:21,182-UNIMOD:21	0.11	30.0	4	3	2
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	30.0	2	1	0
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1369-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q8WVM0|TFB1M_HUMAN	Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	331-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q9BVJ6|UT14A_HUMAN	U3 small nucleolar RNA-associated protein 14 homolog A OS=Homo sapiens OX=9606 GN=UTP14A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	434-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	75-UNIMOD:21,401-UNIMOD:21	0.07	30.0	4	3	2
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	473-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1740-UNIMOD:21,127-UNIMOD:21,128-UNIMOD:21,264-UNIMOD:21	0.02	30.0	3	3	3
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	76-UNIMOD:21,756-UNIMOD:21	0.03	30.0	3	2	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	60-UNIMOD:21	0.07	30.0	4	2	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	482-UNIMOD:21,933-UNIMOD:21,936-UNIMOD:35,635-UNIMOD:4,638-UNIMOD:21	0.04	30.0	8	4	2
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	60-UNIMOD:21,62-UNIMOD:35,2-UNIMOD:1,3-UNIMOD:21	0.05	30.0	5	2	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	78-UNIMOD:21,82-UNIMOD:21,80-UNIMOD:28,83-UNIMOD:21	0.07	30.0	10	2	0
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	46-UNIMOD:21,50-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	718-UNIMOD:21,719-UNIMOD:21	0.02	30.0	2	2	2
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	584-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	776-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q676U5|A16L1_HUMAN	Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	287-UNIMOD:21	0.03	30.0	3	1	0
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	539-UNIMOD:21,2216-UNIMOD:21	0.01	30.0	2	2	2
PRT	sp|O00560|SDCB1_HUMAN	Syntenin-1 OS=Homo sapiens OX=9606 GN=SDCBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,2-UNIMOD:21	0.05	30.0	4	2	0
PRT	sp|Q9BZK7|TBL1R_HUMAN	F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9Y6E0|STK24_HUMAN	Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	434-UNIMOD:21,46-UNIMOD:21	0.06	29.0	2	2	2
PRT	sp|P49419|AL7A1_HUMAN	Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	84-UNIMOD:21,82-UNIMOD:28,515-UNIMOD:28,520-UNIMOD:21,521-UNIMOD:21,522-UNIMOD:4	0.06	29.0	7	5	3
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	20-UNIMOD:21,21-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	46-UNIMOD:21	0.14	29.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21,313-UNIMOD:21	0.10	29.0	3	3	3
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	203-UNIMOD:21,221-UNIMOD:21,388-UNIMOD:21	0.15	29.0	4	3	2
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	730-UNIMOD:21,593-UNIMOD:21,595-UNIMOD:21	0.02	29.0	3	3	3
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	60-UNIMOD:21,162-UNIMOD:21	0.19	29.0	2	2	2
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	935-UNIMOD:21,1000-UNIMOD:28,1002-UNIMOD:21,1005-UNIMOD:21,1009-UNIMOD:21,1003-UNIMOD:21	0.04	29.0	5	2	1
PRT	sp|O95363|SYFM_HUMAN	Phenylalanine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=FARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	49-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	163-UNIMOD:21,541-UNIMOD:21,511-UNIMOD:21,538-UNIMOD:21,549-UNIMOD:35	0.08	29.0	7	5	4
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	29.0	null	157-UNIMOD:21,161-UNIMOD:4,77-UNIMOD:21,51-UNIMOD:21,52-UNIMOD:4,110-UNIMOD:21,115-UNIMOD:4,79-UNIMOD:21	0.47	29.0	12	6	3
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	648-UNIMOD:21,92-UNIMOD:21	0.02	29.0	2	2	2
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	364-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	646-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	73-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q96CW6|S7A6O_HUMAN	Probable RNA polymerase II nuclear localization protein SLC7A6OS OS=Homo sapiens OX=9606 GN=SLC7A6OS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	16-UNIMOD:21,27-UNIMOD:4	0.05	29.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	285-UNIMOD:21	0.07	29.0	2	2	2
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	566-UNIMOD:21,570-UNIMOD:21,752-UNIMOD:21,753-UNIMOD:4,588-UNIMOD:21,591-UNIMOD:21,595-UNIMOD:21,485-UNIMOD:21,757-UNIMOD:21	0.06	29.0	9	8	7
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	200-UNIMOD:21,211-UNIMOD:4,199-UNIMOD:21,204-UNIMOD:21	0.05	29.0	10	3	0
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	64-UNIMOD:21,66-UNIMOD:4,74-UNIMOD:4	0.09	29.0	3	2	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	0.09	29.0	2	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	139-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P06737|PYGL_HUMAN	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	430-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	145-UNIMOD:21	0.14	28.0	3	2	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	573-UNIMOD:21,571-UNIMOD:21,574-UNIMOD:21,575-UNIMOD:21,587-UNIMOD:21,455-UNIMOD:21	0.06	28.0	6	5	4
PRT	sp|Q9Y2K1|ZBTB1_HUMAN	Zinc finger and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	306-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	126-UNIMOD:21,168-UNIMOD:21,130-UNIMOD:35,175-UNIMOD:35,24-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,80-UNIMOD:21,82-UNIMOD:21	0.14	28.0	12	4	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	94-UNIMOD:21	0.05	28.0	7	3	0
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	171-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	455-UNIMOD:21,656-UNIMOD:21	0.03	28.0	3	3	3
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.20	28.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	242-UNIMOD:21,137-UNIMOD:21	0.11	28.0	3	2	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	130-UNIMOD:21,14-UNIMOD:21	0.11	28.0	8	5	2
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	99-UNIMOD:21,101-UNIMOD:4,396-UNIMOD:21,392-UNIMOD:35,350-UNIMOD:21	0.13	28.0	5	4	3
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	50-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P41229|KDM5C_HUMAN	Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	317-UNIMOD:21,327-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	545-UNIMOD:21,227-UNIMOD:21,549-UNIMOD:21	0.05	28.0	3	2	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	30-UNIMOD:21,58-UNIMOD:21,93-UNIMOD:21,57-UNIMOD:21	0.32	28.0	11	3	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	212-UNIMOD:21,89-UNIMOD:21,408-UNIMOD:21,148-UNIMOD:21,469-UNIMOD:21,294-UNIMOD:21	0.14	28.0	9	6	4
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	89-UNIMOD:21	0.14	28.0	2	1	0
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	875-UNIMOD:21,201-UNIMOD:21,377-UNIMOD:21	0.04	28.0	3	3	3
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	180-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	146-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	663-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	31-UNIMOD:21,63-UNIMOD:21,46-UNIMOD:21,28-UNIMOD:21	0.24	28.0	8	4	3
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	88-UNIMOD:21,49-UNIMOD:21,149-UNIMOD:21,87-UNIMOD:21,150-UNIMOD:21	0.32	28.0	8	5	3
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	2690-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	253-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	184-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21,9-UNIMOD:4,335-UNIMOD:4,234-UNIMOD:21	0.16	28.0	5	5	5
PRT	sp|P50213|IDH3A_HUMAN	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	351-UNIMOD:4,352-UNIMOD:21,359-UNIMOD:4,207-UNIMOD:21	0.08	28.0	2	2	2
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	34-UNIMOD:21	0.09	28.0	1	1	1
PRT	sp|Q9BZD3|GCOM2_HUMAN	Putative GRINL1B complex locus protein 2 OS=Homo sapiens OX=9606 GN=GCOM2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	179-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	36-UNIMOD:21	0.10	28.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	322-UNIMOD:28,325-UNIMOD:21,328-UNIMOD:4,51-UNIMOD:21,39-UNIMOD:21,72-UNIMOD:21,73-UNIMOD:21	0.11	28.0	6	4	3
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	1-UNIMOD:1,4-UNIMOD:21,5-UNIMOD:21,1-UNIMOD:35	0.05	28.0	5	2	1
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	200-UNIMOD:21,208-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	266-UNIMOD:21,268-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	175-UNIMOD:21,176-UNIMOD:35,2-UNIMOD:1,2-UNIMOD:21,174-UNIMOD:21,155-UNIMOD:21,153-UNIMOD:21,4-UNIMOD:21	0.11	27.0	12	5	3
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	112-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	369-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q13610|PWP1_HUMAN	Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	485-UNIMOD:21	0.02	27.0	4	1	0
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	522-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	282-UNIMOD:21,322-UNIMOD:21,106-UNIMOD:21	0.08	27.0	3	3	3
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	37-UNIMOD:21,33-UNIMOD:21	0.10	27.0	3	2	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	156-UNIMOD:21,158-UNIMOD:21	0.06	27.0	3	2	1
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	626-UNIMOD:21,346-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	204-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	147-UNIMOD:21,151-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	658-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	68-UNIMOD:21,70-UNIMOD:4	0.09	27.0	3	2	1
PRT	sp|P62072|TIM10_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	48-UNIMOD:21,50-UNIMOD:4	0.17	27.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	33-UNIMOD:21,37-UNIMOD:21,38-UNIMOD:21	0.10	27.0	3	2	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	464-UNIMOD:21,1313-UNIMOD:21,1029-UNIMOD:21,1032-UNIMOD:4	0.03	27.0	4	3	2
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	19-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	319-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O15013|ARHGA_HUMAN	Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1232-UNIMOD:21,1285-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	76-UNIMOD:21,184-UNIMOD:21,189-UNIMOD:35,220-UNIMOD:21,198-UNIMOD:21,219-UNIMOD:21,52-UNIMOD:21,215-UNIMOD:28,216-UNIMOD:21,325-UNIMOD:21,323-UNIMOD:28	0.13	27.0	13	7	3
PRT	sp|O43353|RIPK2_HUMAN	Receptor-interacting serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=RIPK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	531-UNIMOD:21	0.02	27.0	3	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	319-UNIMOD:21	0.13	27.0	6	4	3
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	15-UNIMOD:21	0.10	27.0	3	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	320-UNIMOD:21,323-UNIMOD:21,302-UNIMOD:21,303-UNIMOD:21	0.11	27.0	12	3	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	69-UNIMOD:21	0.05	27.0	2	2	2
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1068-UNIMOD:21,135-UNIMOD:21,886-UNIMOD:21,177-UNIMOD:21	0.03	27.0	4	4	4
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	99-UNIMOD:21,60-UNIMOD:28,61-UNIMOD:21,131-UNIMOD:35,146-UNIMOD:21,63-UNIMOD:21	0.20	27.0	5	3	1
PRT	sp|O95785-3|WIZ_HUMAN	Isoform 3 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	12-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	330-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	202-UNIMOD:21	0.07	27.0	3	1	0
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	127-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1167-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	412-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	79-UNIMOD:28,81-UNIMOD:21	0.08	27.0	8	3	0
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,3-UNIMOD:21,65-UNIMOD:21,69-UNIMOD:4,68-UNIMOD:21	0.33	27.0	3	3	3
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	276-UNIMOD:28,279-UNIMOD:21,216-UNIMOD:21	0.08	27.0	5	2	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,2-UNIMOD:21	0.14	27.0	2	1	0
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P49821|NDUV1_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	31-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9UK45|LSM7_HUMAN	U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens OX=9606 GN=LSM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	11-UNIMOD:21	0.11	26.0	1	1	1
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	59-UNIMOD:21,69-UNIMOD:4,163-UNIMOD:21,167-UNIMOD:4	0.13	26.0	2	2	2
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	366-UNIMOD:21,330-UNIMOD:21	0.11	26.0	2	2	2
PRT	sp|Q6NZI2|CAVN1_HUMAN	Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	300-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	432-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q96EN8|MOCOS_HUMAN	Molybdenum cofactor sulfurase OS=Homo sapiens OX=9606 GN=MOCOS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	528-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	5-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	456-UNIMOD:21,761-UNIMOD:21,1085-UNIMOD:21,1106-UNIMOD:21,458-UNIMOD:21,19-UNIMOD:21	0.04	26.0	9	8	7
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	209-UNIMOD:21,123-UNIMOD:21	0.10	26.0	2	2	2
PRT	sp|Q9NZ53|PDXL2_HUMAN	Podocalyxin-like protein 2 OS=Homo sapiens OX=9606 GN=PODXL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	207-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4	0.03	26.0	2	1	0
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	293-UNIMOD:21,294-UNIMOD:21,303-UNIMOD:4,312-UNIMOD:21,315-UNIMOD:4,428-UNIMOD:21	0.03	26.0	5	5	5
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	454-UNIMOD:21	0.04	26.0	3	2	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	354-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q9NUL7|DDX28_HUMAN	Probable ATP-dependent RNA helicase DDX28 OS=Homo sapiens OX=9606 GN=DDX28 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	124-UNIMOD:21,127-UNIMOD:21,524-UNIMOD:21	0.05	26.0	2	2	2
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	367-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|O15321|TM9S1_HUMAN	Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	76-UNIMOD:21,78-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	328-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q07866-4|KLC1_HUMAN	Isoform J of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	599-UNIMOD:21,600-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q5T1M5|FKB15_HUMAN	FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1162-UNIMOD:21,348-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	75-UNIMOD:21	0.02	26.0	2	2	2
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	340-UNIMOD:21,347-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	230-UNIMOD:21,286-UNIMOD:21	0.07	26.0	4	3	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	202-UNIMOD:21,205-UNIMOD:21,45-UNIMOD:21,49-UNIMOD:4,55-UNIMOD:21,37-UNIMOD:21	0.08	26.0	5	4	3
PRT	sp|P98194|AT2C1_HUMAN	Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens OX=9606 GN=ATP2C1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	637-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q5VT52|RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1237-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	683-UNIMOD:21,1018-UNIMOD:21,1027-UNIMOD:4	0.02	26.0	2	2	2
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	282-UNIMOD:21,1706-UNIMOD:21	0.02	26.0	3	2	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	141-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	156-UNIMOD:21,377-UNIMOD:21,158-UNIMOD:21,154-UNIMOD:21	0.08	26.0	5	3	2
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	799-UNIMOD:21,59-UNIMOD:21,53-UNIMOD:35,191-UNIMOD:21,192-UNIMOD:21,267-UNIMOD:21	0.11	26.0	9	5	3
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	1-UNIMOD:1,5-UNIMOD:21,1-UNIMOD:35	0.14	26.0	5	2	0
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	345-UNIMOD:21,342-UNIMOD:21,363-UNIMOD:35,351-UNIMOD:21	0.06	26.0	4	2	1
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	206-UNIMOD:21,209-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	152-UNIMOD:21,153-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	31-UNIMOD:21	0.18	25.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	386-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q15785|TOM34_HUMAN	Mitochondrial import receptor subunit TOM34 OS=Homo sapiens OX=9606 GN=TOMM34 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	93-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q07617|SPAG1_HUMAN	Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	423-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q86V85|GP180_HUMAN	Integral membrane protein GPR180 OS=Homo sapiens OX=9606 GN=GPR180 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	28-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	161-UNIMOD:21,163-UNIMOD:4	0.05	25.0	4	2	0
PRT	sp|P45974|UBP5_HUMAN	Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	783-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	426-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	46-UNIMOD:21,234-UNIMOD:4	0.03	25.0	2	2	2
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	340-UNIMOD:21,1188-UNIMOD:21,779-UNIMOD:21,1089-UNIMOD:21,1095-UNIMOD:21	0.05	25.0	5	4	3
PRT	sp|Q13136|LIPA1_HUMAN	Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	239-UNIMOD:21,242-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	48-UNIMOD:21	0.18	25.0	5	5	5
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	126-UNIMOD:21,124-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q13510|ASAH1_HUMAN	Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	301-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q9H6T3|RPAP3_HUMAN	RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	480-UNIMOD:21,87-UNIMOD:21	0.04	25.0	3	2	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	43-UNIMOD:21,730-UNIMOD:21,564-UNIMOD:21	0.06	25.0	3	3	3
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	332-UNIMOD:21,339-UNIMOD:4,342-UNIMOD:4,344-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	700-UNIMOD:21,708-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9BWH6|RPAP1_HUMAN	RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	150-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	652-UNIMOD:21,608-UNIMOD:21	0.04	25.0	3	2	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	931-UNIMOD:21,36-UNIMOD:21,43-UNIMOD:4	0.03	25.0	2	2	2
PRT	sp|Q9HC36|MRM3_HUMAN	rRNA methyltransferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MRM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	105-UNIMOD:21,106-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	301-UNIMOD:21,299-UNIMOD:35	0.04	25.0	3	1	0
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	6-UNIMOD:21,9-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q05682-3|CALD1_HUMAN	Isoform 3 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	12-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	790-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	110-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q9HAU0|PKHA5_HUMAN	Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	410-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1672-UNIMOD:21,1676-UNIMOD:4,918-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	137-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	432-UNIMOD:21,493-UNIMOD:21	0.06	25.0	4	2	1
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	10-UNIMOD:21	0.09	25.0	1	1	1
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	478-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	51-UNIMOD:21,96-UNIMOD:21	0.04	25.0	3	2	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	21-UNIMOD:21,36-UNIMOD:4,22-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	2103-UNIMOD:21,2115-UNIMOD:4,1442-UNIMOD:21,2107-UNIMOD:21,2113-UNIMOD:21,2291-UNIMOD:21	0.02	25.0	4	3	2
PRT	sp|P82673|RT35_HUMAN	28S ribosomal protein S35, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	295-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	64-UNIMOD:21,68-UNIMOD:21,62-UNIMOD:21,66-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21,3-UNIMOD:35	0.09	25.0	4	2	0
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	285-UNIMOD:385,285-UNIMOD:4,287-UNIMOD:21,288-UNIMOD:4,183-UNIMOD:21	0.11	25.0	3	2	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	190-UNIMOD:28,193-UNIMOD:21,200-UNIMOD:4	0.02	25.0	3	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	11-UNIMOD:35,13-UNIMOD:21	0.04	24.0	6	2	1
PRT	sp|O00231|PSD11_HUMAN	26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	366-UNIMOD:21,368-UNIMOD:35	0.02	24.0	3	1	0
PRT	sp|P11172|UMPS_HUMAN	Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	444-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	223-UNIMOD:21,291-UNIMOD:21,297-UNIMOD:4	0.06	24.0	3	2	1
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	32-UNIMOD:21,26-UNIMOD:28	0.15	24.0	4	2	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	429-UNIMOD:21,936-UNIMOD:21,712-UNIMOD:21,716-UNIMOD:4,872-UNIMOD:21	0.04	24.0	4	4	4
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	631-UNIMOD:21,511-UNIMOD:21,633-UNIMOD:21,40-UNIMOD:21	0.09	24.0	9	4	2
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	268-UNIMOD:21,265-UNIMOD:21	0.05	24.0	3	2	1
PRT	sp|P08174|DAF_HUMAN	Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	78-UNIMOD:21,81-UNIMOD:4,162-UNIMOD:21,163-UNIMOD:4,98-UNIMOD:4,106-UNIMOD:21,248-UNIMOD:21,253-UNIMOD:4	0.15	24.0	5	4	3
PRT	sp|Q8NEZ5|FBX22_HUMAN	F-box only protein 22 OS=Homo sapiens OX=9606 GN=FBXO22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	127-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	256-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	27-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	474-UNIMOD:21	0.05	24.0	4	2	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	199-UNIMOD:21,1259-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q96JP5|ZFP91_HUMAN	E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	177-UNIMOD:21,182-UNIMOD:4,83-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	759-UNIMOD:21,758-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q9BRA2|TXD17_HUMAN	Thioredoxin domain-containing protein 17 OS=Homo sapiens OX=9606 GN=TXNDC17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	41-UNIMOD:21,43-UNIMOD:4,46-UNIMOD:4	0.12	24.0	1	1	1
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	46-UNIMOD:21,43-UNIMOD:21,45-UNIMOD:21	0.18	24.0	3	3	3
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	52-UNIMOD:21,54-UNIMOD:21,51-UNIMOD:21,133-UNIMOD:4,139-UNIMOD:21	0.14	24.0	5	2	1
PRT	sp|Q9Y608|LRRF2_HUMAN	Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	18-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	477-UNIMOD:21,520-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21	0.06	24.0	4	3	2
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	881-UNIMOD:21,644-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	229-UNIMOD:21,2-UNIMOD:1,4-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	17-UNIMOD:21,29-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q15276|RABE1_HUMAN	Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	162-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	373-UNIMOD:21,446-UNIMOD:385,446-UNIMOD:4,447-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	118-UNIMOD:21,126-UNIMOD:35	0.09	24.0	4	1	0
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	96-UNIMOD:21,319-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|P49189|AL9A1_HUMAN	4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q96S82|UBL7_HUMAN	Ubiquitin-like protein 7 OS=Homo sapiens OX=9606 GN=UBL7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	773-UNIMOD:21	0.01	23.0	2	2	2
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	null	35-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	152-UNIMOD:21,399-UNIMOD:21	0.08	23.0	2	2	2
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	606-UNIMOD:21,83-UNIMOD:21,78-UNIMOD:21,82-UNIMOD:21	0.05	23.0	3	3	3
PRT	sp|Q9H0H5|RGAP1_HUMAN	Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	206-UNIMOD:21,251-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	237-UNIMOD:21,627-UNIMOD:21,242-UNIMOD:35	0.03	23.0	6	3	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	299-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	193-UNIMOD:21,333-UNIMOD:21	0.03	23.0	3	2	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	22-UNIMOD:35,23-UNIMOD:21,567-UNIMOD:4,573-UNIMOD:21	0.04	23.0	5	2	1
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	262-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	419-UNIMOD:21,41-UNIMOD:28,43-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	269-UNIMOD:21,268-UNIMOD:35,271-UNIMOD:21,270-UNIMOD:21	0.04	23.0	3	2	1
PRT	sp|Q14738|2A5D_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	573-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	200-UNIMOD:21,243-UNIMOD:21,253-UNIMOD:4	0.05	23.0	2	2	2
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	533-UNIMOD:21,535-UNIMOD:4,538-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	3744-UNIMOD:21,613-UNIMOD:4,614-UNIMOD:21	0.01	23.0	2	2	2
PRT	sp|Q8WVC0|LEO1_HUMAN	RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	608-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	750-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	426-UNIMOD:21,437-UNIMOD:21	0.05	23.0	2	2	2
PRT	sp|Q69YQ0|CYTSA_HUMAN	Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	385-UNIMOD:21,395-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	157-UNIMOD:21,395-UNIMOD:21	0.05	23.0	2	2	2
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1118-UNIMOD:21,479-UNIMOD:21	0.02	23.0	2	2	2
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	385-UNIMOD:21,389-UNIMOD:21,392-UNIMOD:21	0.03	23.0	3	1	0
PRT	sp|O43318|M3K7_HUMAN	Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	439-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:21,122-UNIMOD:21,129-UNIMOD:4,127-UNIMOD:21,54-UNIMOD:21	0.19	23.0	11	2	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	13-UNIMOD:21,7-UNIMOD:21,304-UNIMOD:21	0.07	23.0	6	3	1
PRT	sp|P49959|MRE11_HUMAN	Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	619-UNIMOD:21,618-UNIMOD:35	0.01	23.0	4	1	0
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P42684|ABL2_HUMAN	Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	633-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	86-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	765-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,746-UNIMOD:21	0.05	23.0	3	3	3
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	507-UNIMOD:21,513-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	119-UNIMOD:21,117-UNIMOD:21,118-UNIMOD:35	0.02	23.0	4	1	0
PRT	sp|Q9Y2I7|FYV1_HUMAN	1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	307-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O75746|CMC1_HUMAN	Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens OX=9606 GN=SLC25A12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	360-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	23.0	null	581-UNIMOD:21,582-UNIMOD:21,428-UNIMOD:21,608-UNIMOD:21	0.06	23.0	6	3	2
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	902-UNIMOD:21,900-UNIMOD:21,656-UNIMOD:21	0.03	23.0	4	2	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	452-UNIMOD:21,460-UNIMOD:21,479-UNIMOD:21	0.05	23.0	4	3	2
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	678-UNIMOD:21	0.01	23.0	2	2	2
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	607-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	23.0	null	15-UNIMOD:21,16-UNIMOD:4,19-UNIMOD:4,455-UNIMOD:21,464-UNIMOD:35,457-UNIMOD:21,460-UNIMOD:21	0.05	23.0	4	2	1
PRT	sp|Q10571|MN1_HUMAN	Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1168-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	246-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	104-UNIMOD:21	0.11	23.0	1	1	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	601-UNIMOD:21,1001-UNIMOD:21,1003-UNIMOD:21,999-UNIMOD:21,794-UNIMOD:21	0.05	23.0	5	3	2
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	174-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|O60291|MGRN1_HUMAN	E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	515-UNIMOD:21,528-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q9Y2H0|DLGP4_HUMAN	Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	975-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q5T5C0|STXB5_HUMAN	Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	692-UNIMOD:21,697-UNIMOD:4,688-UNIMOD:21	0.02	23.0	3	1	0
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	133-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	17-UNIMOD:21,15-UNIMOD:21	0.14	23.0	2	1	0
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	137-UNIMOD:28,146-UNIMOD:21	0.07	23.0	3	2	1
PRT	sp|O95453|PARN_HUMAN	Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	557-UNIMOD:21,559-UNIMOD:21	0.02	23.0	2	2	2
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1877-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	17-UNIMOD:21,49-UNIMOD:21,55-UNIMOD:35	0.33	23.0	3	2	1
PRT	sp|Q9NV96|CC50A_HUMAN	Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	141-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q9ULH0|KDIS_HUMAN	Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1501-UNIMOD:21,1684-UNIMOD:21,1682-UNIMOD:21	0.02	22.0	3	3	3
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	257-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	225-UNIMOD:21,189-UNIMOD:21	0.12	22.0	3	2	1
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	22.0	null	857-UNIMOD:21,1194-UNIMOD:21,1227-UNIMOD:21	0.04	22.0	3	3	3
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	404-UNIMOD:21	0.02	22.0	3	2	1
PRT	sp|Q9BUP3|HTAI2_HUMAN	Oxidoreductase HTATIP2 OS=Homo sapiens OX=9606 GN=HTATIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	56-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	211-UNIMOD:21	0.09	22.0	2	2	2
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	339-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	268-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	22.0	2	2	2
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	240-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	41-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	20-UNIMOD:21,27-UNIMOD:35,2-UNIMOD:1,14-UNIMOD:21	0.04	22.0	3	2	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	672-UNIMOD:21,676-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	39-UNIMOD:21,42-UNIMOD:4,44-UNIMOD:4,50-UNIMOD:4,40-UNIMOD:21	0.09	22.0	2	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	84-UNIMOD:21,85-UNIMOD:21,89-UNIMOD:35,87-UNIMOD:21	0.02	22.0	4	3	2
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	145-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	260-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P33240|CSTF2_HUMAN	Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	310-UNIMOD:21,306-UNIMOD:35	0.03	22.0	2	1	0
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1443-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q6RFH5|WDR74_HUMAN	WD repeat-containing protein 74 OS=Homo sapiens OX=9606 GN=WDR74 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	361-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	360-UNIMOD:385,360-UNIMOD:4,362-UNIMOD:21,366-UNIMOD:4	0.07	22.0	2	2	2
PRT	sp|Q9BWD1|THIC_HUMAN	Acetyl-CoA acetyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=ACAT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	226-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O75477|ERLN1_HUMAN	Erlin-1 OS=Homo sapiens OX=9606 GN=ERLIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	347-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O15294|OGT1_HUMAN	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	308-UNIMOD:21,315-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q96K49|TM87B_HUMAN	Transmembrane protein 87B OS=Homo sapiens OX=9606 GN=TMEM87B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	494-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1047-UNIMOD:21,1049-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8N4C8|MINK1_HUMAN	Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	701-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	211-UNIMOD:21,110-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1706-UNIMOD:21,729-UNIMOD:21	0.01	22.0	2	2	2
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|O43379|WDR62_HUMAN	WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	113-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	398-UNIMOD:21,447-UNIMOD:4,453-UNIMOD:21,488-UNIMOD:21	0.12	22.0	5	4	3
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	544-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	343-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	695-UNIMOD:21,881-UNIMOD:21,76-UNIMOD:21	0.04	22.0	3	3	3
PRT	sp|Q16134|ETFD_HUMAN	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=ETFDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	551-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9NPB8|GPCP1_HUMAN	Glycerophosphocholine phosphodiesterase GPCPD1 OS=Homo sapiens OX=9606 GN=GPCPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	424-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	707-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y450|HBS1L_HUMAN	HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	49-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|O15068|MCF2L_HUMAN	Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	412-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	601-UNIMOD:21,603-UNIMOD:21	0.04	22.0	2	2	2
PRT	sp|Q14008|CKAP5_HUMAN	Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1861-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q16513|PKN2_HUMAN	Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	583-UNIMOD:21,78-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|Q15121|PEA15_HUMAN	Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	116-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	139-UNIMOD:21,138-UNIMOD:21,149-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	798-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P52298|NCBP2_HUMAN	Nuclear cap-binding protein subunit 2 OS=Homo sapiens OX=9606 GN=NCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	13-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	114-UNIMOD:21,123-UNIMOD:4,117-UNIMOD:21,395-UNIMOD:21	0.06	22.0	4	2	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	111-UNIMOD:21,120-UNIMOD:4,392-UNIMOD:21	0.06	22.0	3	2	1
PRT	sp|Q6PJG9|LRFN4_HUMAN	Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	584-UNIMOD:4,585-UNIMOD:21,593-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	276-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9NP61|ARFG3_HUMAN	ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	367-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	420-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1113-UNIMOD:21,1114-UNIMOD:4,1117-UNIMOD:4,1129-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	138-UNIMOD:35	0.09	22.0	2	1	0
PRT	sp|Q3MII6|TBC25_HUMAN	TBC1 domain family member 25 OS=Homo sapiens OX=9606 GN=TBC1D25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	504-UNIMOD:28,506-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	162-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	902-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1508-UNIMOD:21,1378-UNIMOD:21	0.01	21.0	3	3	3
PRT	sp|Q93100|KPBB_HUMAN	Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	27-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	254-UNIMOD:4,255-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	316-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|P15923-2|TFE2_HUMAN	Isoform E47 of Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	530-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q9NPD8|UBE2T_HUMAN	Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	184-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	51-UNIMOD:21,36-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|P55735|SEC13_HUMAN	Protein SEC13 homolog OS=Homo sapiens OX=9606 GN=SEC13 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	184-UNIMOD:21,187-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	173-UNIMOD:21	0.07	21.0	2	1	0
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	44-UNIMOD:21,46-UNIMOD:21,48-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	281-UNIMOD:21,702-UNIMOD:21,282-UNIMOD:21	0.03	21.0	3	3	3
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	354-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q86W92-2|LIPB1_HUMAN	Isoform 2 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	532-UNIMOD:21	0.01	21.0	2	2	2
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	56-UNIMOD:21,57-UNIMOD:21	0.12	21.0	1	1	1
PRT	sp|P16615|AT2A2_HUMAN	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	493-UNIMOD:21,498-UNIMOD:4,494-UNIMOD:35,495-UNIMOD:21,507-UNIMOD:21,508-UNIMOD:35	0.02	21.0	3	2	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	10-UNIMOD:21,9-UNIMOD:21,7-UNIMOD:21	0.06	21.0	6	3	1
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	343-UNIMOD:21,207-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	277-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	157-UNIMOD:21	0.09	21.0	2	2	2
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	262-UNIMOD:21,118-UNIMOD:21,512-UNIMOD:21	0.04	21.0	3	3	3
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	658-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q14318|FKBP8_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	295-UNIMOD:4,296-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1127-UNIMOD:21,953-UNIMOD:21,961-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	43-UNIMOD:21,53-UNIMOD:4,71-UNIMOD:21,77-UNIMOD:4,697-UNIMOD:21	0.07	21.0	4	3	2
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	72-UNIMOD:21,77-UNIMOD:35	0.01	21.0	3	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	305-UNIMOD:21,105-UNIMOD:21,303-UNIMOD:35,104-UNIMOD:21,472-UNIMOD:21,444-UNIMOD:21,295-UNIMOD:21	0.16	21.0	24	7	3
PRT	sp|Q15417|CNN3_HUMAN	Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	259-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	77-UNIMOD:21,107-UNIMOD:21	0.11	21.0	3	2	1
PRT	sp|P05556|ITB1_HUMAN	Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	186-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q14696|MESD_HUMAN	LRP chaperone MESD OS=Homo sapiens OX=9606 GN=MESD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	165-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P11532|DMD_HUMAN	Dystrophin OS=Homo sapiens OX=9606 GN=DMD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	3623-UNIMOD:21,3627-UNIMOD:35	0.00	21.0	2	1	0
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	159-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	410-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q68CQ4|DIEXF_HUMAN	Digestive organ expansion factor homolog OS=Homo sapiens OX=9606 GN=DIEXF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	10-UNIMOD:21,8-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	172-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H788|SH24A_HUMAN	SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	315-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	138-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|Q8IWW6-3|RHG12_HUMAN	Isoform 3 of Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	305-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	654-UNIMOD:21,18-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|Q9BRT2|UQCC2_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	79-UNIMOD:21	0.11	21.0	2	1	0
PRT	sp|P63146|UBE2B_HUMAN	Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	142-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P82909|RT36_HUMAN	28S ribosomal protein S36, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	90-UNIMOD:21	0.13	21.0	1	1	1
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	706-UNIMOD:21,704-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	53-UNIMOD:21,54-UNIMOD:21,55-UNIMOD:35	0.02	21.0	2	1	0
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	674-UNIMOD:35,676-UNIMOD:21,678-UNIMOD:4	0.02	21.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	514-UNIMOD:21,169-UNIMOD:21,109-UNIMOD:21	0.05	21.0	4	3	2
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	1195-UNIMOD:21,1192-UNIMOD:28,1398-UNIMOD:21	0.02	21.0	4	3	2
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	322-UNIMOD:21,128-UNIMOD:21	0.15	21.0	3	3	3
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	102-UNIMOD:21	0.12	21.0	1	1	1
PRT	sp|P84103|SRSF3_HUMAN	Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4,1-UNIMOD:35	0.07	21.0	2	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	7-UNIMOD:21,17-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|P40189|IL6RB_HUMAN	Interleukin-6 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL6ST PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	836-UNIMOD:28,838-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9H2H9|S38A1_HUMAN	Sodium-coupled neutral amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	52-UNIMOD:21,54-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	726-UNIMOD:4,729-UNIMOD:21,727-UNIMOD:21,721-UNIMOD:28,726-UNIMOD:385	0.02	20.0	5	3	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8IWB9|TEX2_HUMAN	Testis-expressed protein 2 OS=Homo sapiens OX=9606 GN=TEX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	593-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	35-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|P00568|KAD1_HUMAN	Adenylate kinase isoenzyme 1 OS=Homo sapiens OX=9606 GN=AK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	58-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	451-UNIMOD:21,97-UNIMOD:21,101-UNIMOD:4,453-UNIMOD:21	0.04	20.0	4	2	0
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	51-UNIMOD:21	0.03	20.0	3	2	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	84-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q86TI2|DPP9_HUMAN	Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	45-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q16891|MIC60_HUMAN	MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	388-UNIMOD:21,103-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|O60825|F262_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	466-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	253-UNIMOD:21	0.04	20.0	2	1	0
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	319-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1668-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	127-UNIMOD:21,128-UNIMOD:21	0.14	20.0	2	2	2
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	474-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1132-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	181-UNIMOD:21,153-UNIMOD:21	0.11	20.0	2	2	2
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	322-UNIMOD:21,321-UNIMOD:35,323-UNIMOD:35	0.04	20.0	3	2	1
PRT	sp|Q86TB9|PATL1_HUMAN	Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	178-UNIMOD:21,177-UNIMOD:21	0.02	20.0	3	2	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	554-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	120-UNIMOD:21	0.10	20.0	2	1	0
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	27-UNIMOD:21,31-UNIMOD:21,45-UNIMOD:21	0.06	20.0	2	2	2
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1233-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	305-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|P49902|5NTC_HUMAN	Cytosolic purine 5'-nucleotidase OS=Homo sapiens OX=9606 GN=NT5C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	510-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	117-UNIMOD:21,118-UNIMOD:21,120-UNIMOD:21	0.05	20.0	3	1	0
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	161-UNIMOD:21,162-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1230-UNIMOD:21,1241-UNIMOD:35	0.00	20.0	2	1	0
PRT	sp|Q14011|CIRBP_HUMAN	Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	163-UNIMOD:21	0.11	20.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1071-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	30-UNIMOD:21	0.15	20.0	2	2	2
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	418-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9BYW2|SETD2_HUMAN	Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1068-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q8N0T1|RBIS_HUMAN	Ribosomal biogenesis factor OS=Homo sapiens OX=9606 GN=RBIS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	67-UNIMOD:21	0.10	20.0	2	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	250-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q96GS4|BORC6_HUMAN	BLOC-1-related complex subunit 6 OS=Homo sapiens OX=9606 GN=BORCS6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	199-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q5JTJ3|COA6_HUMAN	Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	85-UNIMOD:21,90-UNIMOD:4,88-UNIMOD:21	0.13	20.0	2	2	2
PRT	sp|Q8TB72|PUM2_HUMAN	Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	75-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	228-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9BTT0|AN32E_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Homo sapiens OX=9606 GN=ANP32E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q6UVK1|CSPG4_HUMAN	Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	321-UNIMOD:21,1609-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	348-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|P21281|VATB2_HUMAN	V-type proton ATPase subunit B, brain isoform OS=Homo sapiens OX=9606 GN=ATP6V1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	111-UNIMOD:21,112-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q14108|SCRB2_HUMAN	Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	124-UNIMOD:21	0.04	20.0	2	2	2
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	130-UNIMOD:4,132-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O15116|LSM1_HUMAN	U6 snRNA-associated Sm-like protein LSm1 OS=Homo sapiens OX=9606 GN=LSM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	123-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|Q96GQ7|DDX27_HUMAN	Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens OX=9606 GN=DDX27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	371-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P11441|UBL4A_HUMAN	Ubiquitin-like protein 4A OS=Homo sapiens OX=9606 GN=UBL4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:4,14-UNIMOD:21	0.11	20.0	1	1	1
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	207-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	864-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	397-UNIMOD:21,393-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|O15403|MOT7_HUMAN	Monocarboxylate transporter 7 OS=Homo sapiens OX=9606 GN=SLC16A6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	234-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q15654|TRIP6_HUMAN	Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	399-UNIMOD:4,400-UNIMOD:21,402-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	408-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1133-UNIMOD:21,1148-UNIMOD:21,1158-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|P48637|GSHB_HUMAN	Glutathione synthetase OS=Homo sapiens OX=9606 GN=GSS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,7-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|Q96EY5|MB12A_HUMAN	Multivesicular body subunit 12A OS=Homo sapiens OX=9606 GN=MVB12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	163-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q15532|SSXT_HUMAN	Protein SSXT OS=Homo sapiens OX=9606 GN=SS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,2-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	277-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	12-UNIMOD:21,13-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	500-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	195-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q8TEB1|DCA11_HUMAN	DDB1- and CUL4-associated factor 11 OS=Homo sapiens OX=9606 GN=DCAF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	147-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q99755|PI51A_HUMAN	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	476-UNIMOD:21,480-UNIMOD:4,475-UNIMOD:21	0.04	19.0	2	2	2
PRT	sp|P06753-3|TPM3_HUMAN	Isoform 3 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	235-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	41-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P16333|NCK1_HUMAN	Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	89-UNIMOD:21,85-UNIMOD:21	0.06	19.0	2	1	0
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	59-UNIMOD:21,60-UNIMOD:4,62-UNIMOD:4,94-UNIMOD:21,58-UNIMOD:21	0.04	19.0	3	2	1
PRT	sp|P45973|CBX5_HUMAN	Chromobox protein homolog 5 OS=Homo sapiens OX=9606 GN=CBX5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	92-UNIMOD:21	0.07	19.0	2	2	2
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	279-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q12770|SCAP_HUMAN	Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens OX=9606 GN=SCAP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	822-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|O95835|LATS1_HUMAN	Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	464-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	584-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|O95429|BAG4_HUMAN	BAG family molecular chaperone regulator 4 OS=Homo sapiens OX=9606 GN=BAG4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	7-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9H7D7|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	121-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	236-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q13740|CD166_HUMAN	CD166 antigen OS=Homo sapiens OX=9606 GN=ALCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	77-UNIMOD:21,74-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|Q9UN36|NDRG2_HUMAN	Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	332-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q92466|DDB2_HUMAN	DNA damage-binding protein 2 OS=Homo sapiens OX=9606 GN=DDB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	26-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	379-UNIMOD:21,444-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|Q9UJW0|DCTN4_HUMAN	Dynactin subunit 4 OS=Homo sapiens OX=9606 GN=DCTN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	88-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P53041|PPP5_HUMAN	Serine/threonine-protein phosphatase 5 OS=Homo sapiens OX=9606 GN=PPP5C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	403-UNIMOD:21,404-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	131-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	363-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9BZL6|KPCD2_HUMAN	Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	197-UNIMOD:21,199-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	83-UNIMOD:21,451-UNIMOD:21	0.05	19.0	2	2	2
PRT	sp|Q06481|APLP2_HUMAN	Amyloid-like protein 2 OS=Homo sapiens OX=9606 GN=APLP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	626-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q6ZS17|RIPR1_HUMAN	Rho family-interacting cell polarization regulator 1 OS=Homo sapiens OX=9606 GN=RIPOR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	347-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q13286|CLN3_HUMAN	Battenin OS=Homo sapiens OX=9606 GN=CLN3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	12-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	60-UNIMOD:21,176-UNIMOD:21,19-UNIMOD:21	0.27	19.0	4	4	4
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	441-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|O95571|ETHE1_HUMAN	Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens OX=9606 GN=ETHE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	19-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	107-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q6T4R5|NHS_HUMAN	Nance-Horan syndrome protein OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1530-UNIMOD:21,1535-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	55-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	242-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q8TEW0|PARD3_HUMAN	Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	852-UNIMOD:21,720-UNIMOD:21,220-UNIMOD:21,221-UNIMOD:21,965-UNIMOD:21	0.05	19.0	5	4	3
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	9-UNIMOD:21	0.08	19.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	650-UNIMOD:21,79-UNIMOD:21	0.07	19.0	2	2	2
PRT	sp|A6NIH7|U119B_HUMAN	Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	229-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	79-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q86YS7-2|C2CD5_HUMAN	Isoform 2 of C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	855-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q08378|GOGA3_HUMAN	Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	465-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	53-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q86X02|CDR2L_HUMAN	Cerebellar degeneration-related protein 2-like OS=Homo sapiens OX=9606 GN=CDR2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	316-UNIMOD:21,317-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q13425|SNTB2_HUMAN	Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	395-UNIMOD:21,258-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|P35573|GDE_HUMAN	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	878-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	98-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q9UMZ2|SYNRG_HUMAN	Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	752-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	729-UNIMOD:21	0.01	19.0	2	1	0
PRT	sp|Q06587|RING1_HUMAN	E3 ubiquitin-protein ligase RING1 OS=Homo sapiens OX=9606 GN=RING1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	96-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1541-UNIMOD:21,1278-UNIMOD:21	0.01	19.0	2	2	2
PRT	sp|Q14997|PSME4_HUMAN	Proteasome activator complex subunit 4 OS=Homo sapiens OX=9606 GN=PSME4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1746-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q969S3|ZN622_HUMAN	Zinc finger protein 622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	38-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q15172|2A5A_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	49-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q96PU5|NED4L_HUMAN	E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	449-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	57-UNIMOD:21	0.21	19.0	2	2	2
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	228-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	353-UNIMOD:21,358-UNIMOD:21,467-UNIMOD:21	0.06	19.0	6	2	1
PRT	sp|P14927|QCR7_HUMAN	Cytochrome b-c1 complex subunit 7 OS=Homo sapiens OX=9606 GN=UQCRB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	37-UNIMOD:21,33-UNIMOD:35	0.15	19.0	2	1	0
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	54-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	767-UNIMOD:21,768-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,2-UNIMOD:21	0.16	19.0	1	1	1
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,2-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q16629|SRSF7_HUMAN	Serine/arginine-rich splicing factor 7 OS=Homo sapiens OX=9606 GN=SRSF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	183-UNIMOD:21,187-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	135-UNIMOD:21	0.05	18.0	3	3	3
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	13-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1831-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P49642|PRI1_HUMAN	DNA primase small subunit OS=Homo sapiens OX=9606 GN=PRIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	387-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	518-UNIMOD:4,520-UNIMOD:21,518-UNIMOD:385,519-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	100-UNIMOD:21,197-UNIMOD:21	0.09	18.0	2	2	2
PRT	sp|Q63ZY3|KANK2_HUMAN	KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	540-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9Y3B7|RM11_HUMAN	39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	45-UNIMOD:21,50-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q9P2J5|SYLC_HUMAN	Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=LARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	335-UNIMOD:21,334-UNIMOD:35,7-UNIMOD:21	0.02	18.0	3	2	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	252-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	865-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	87-UNIMOD:21,96-UNIMOD:4,23-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	136-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1799-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	90-UNIMOD:21,92-UNIMOD:4,94-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	217-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	123-UNIMOD:21,124-UNIMOD:4,217-UNIMOD:21	0.10	18.0	2	2	2
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1327-UNIMOD:21,1456-UNIMOD:21	0.02	18.0	3	2	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	87-UNIMOD:4,96-UNIMOD:21,104-UNIMOD:21	0.10	18.0	2	2	2
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	31-UNIMOD:21	0.09	18.0	2	2	2
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	95-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	301-UNIMOD:21,299-UNIMOD:21	0.05	18.0	3	1	0
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	759-UNIMOD:21,767-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q96PC5|MIA2_HUMAN	Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1236-UNIMOD:4,1243-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q86UK7|ZN598_HUMAN	E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	851-UNIMOD:21,864-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	590-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	279-UNIMOD:21,281-UNIMOD:4,21-UNIMOD:21,269-UNIMOD:28,278-UNIMOD:21	0.10	18.0	6	3	0
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	24-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|Q14126|DSG2_HUMAN	Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	553-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	21-UNIMOD:21,24-UNIMOD:21,2-UNIMOD:1,12-UNIMOD:21	0.13	18.0	2	2	2
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	901-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P11274|BCR_HUMAN	Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	239-UNIMOD:21,240-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	576-UNIMOD:4,584-UNIMOD:21,1113-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1811-UNIMOD:21,1812-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9UMF0|ICAM5_HUMAN	Intercellular adhesion molecule 5 OS=Homo sapiens OX=9606 GN=ICAM5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	225-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1329-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	11-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q8N142|PURA1_HUMAN	Adenylosuccinate synthetase isozyme 1 OS=Homo sapiens OX=9606 GN=ADSS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	452-UNIMOD:21,453-UNIMOD:35,449-UNIMOD:21	0.02	18.0	4	1	0
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	416-UNIMOD:4,421-UNIMOD:21,427-UNIMOD:4,310-UNIMOD:21,307-UNIMOD:21	0.09	18.0	3	3	3
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	576-UNIMOD:21,440-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|Q8N6T3|ARFG1_HUMAN	ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	360-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9NSK0|KLC4_HUMAN	Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	609-UNIMOD:21,566-UNIMOD:21	0.04	18.0	3	2	1
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	182-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	579-UNIMOD:21,589-UNIMOD:4,752-UNIMOD:35,759-UNIMOD:21,586-UNIMOD:21,637-UNIMOD:21	0.05	18.0	5	4	3
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1941-UNIMOD:21,1945-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1378-UNIMOD:21,1835-UNIMOD:21,1839-UNIMOD:4,1850-UNIMOD:4	0.01	18.0	3	2	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	722-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1091-UNIMOD:21,1092-UNIMOD:4,1094-UNIMOD:35	0.01	18.0	2	1	0
PRT	sp|P43121|MUC18_HUMAN	Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	100-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P61964|WDR5_HUMAN	WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	184-UNIMOD:21,195-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q15149-4|PLEC_HUMAN	Isoform 4 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	19-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	417-UNIMOD:4,420-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	37-UNIMOD:21	0.14	18.0	1	1	1
PRT	sp|Q05655|KPCD_HUMAN	Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	304-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	43-UNIMOD:21,44-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	341-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	253-UNIMOD:21,254-UNIMOD:4,262-UNIMOD:21,264-UNIMOD:4,263-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	744-UNIMOD:4,745-UNIMOD:21,330-UNIMOD:21,336-UNIMOD:4,337-UNIMOD:4	0.02	18.0	2	2	2
PRT	sp|Q9C0I1|MTMRC_HUMAN	Myotubularin-related protein 12 OS=Homo sapiens OX=9606 GN=MTMR12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	562-UNIMOD:28,564-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	105-UNIMOD:35,106-UNIMOD:21	0.06	18.0	2	1	0
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	303-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9BRF8|CPPED_HUMAN	Serine/threonine-protein phosphatase CPPED1 OS=Homo sapiens OX=9606 GN=CPPED1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9H501|ESF1_HUMAN	ESF1 homolog OS=Homo sapiens OX=9606 GN=ESF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	823-UNIMOD:21,830-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	944-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P62318|SMD3_HUMAN	Small nuclear ribonucleoprotein Sm D3 OS=Homo sapiens OX=9606 GN=SNRPD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	45-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q5SYE7|NHSL1_HUMAN	NHS-like protein 1 OS=Homo sapiens OX=9606 GN=NHSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1495-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9P015|RM15_HUMAN	39S ribosomal protein L15, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	23-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	58-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	173-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	502-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	622-UNIMOD:21,85-UNIMOD:21	0.05	17.0	2	2	2
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	17.0	null	526-UNIMOD:21,524-UNIMOD:21	0.03	17.0	3	2	1
PRT	sp|Q96QV6|H2A1A_HUMAN	Histone H2A type 1-A OS=Homo sapiens OX=9606 GN=HIST1H2AA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	19-UNIMOD:21,20-UNIMOD:21	0.11	17.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	243-UNIMOD:21	0.10	17.0	2	2	2
PRT	sp|Q5T0N5|FBP1L_HUMAN	Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	488-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9NP84|TNR12_HUMAN	Tumor necrosis factor receptor superfamily member 12A OS=Homo sapiens OX=9606 GN=TNFRSF12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	41-UNIMOD:21	0.09	17.0	1	1	1
PRT	sp|Q9NPH3|IL1AP_HUMAN	Interleukin-1 receptor accessory protein OS=Homo sapiens OX=9606 GN=IL1RAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	556-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P43490|NAMPT_HUMAN	Nicotinamide phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAMPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	472-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	430-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	207-UNIMOD:21,212-UNIMOD:4	0.00	17.0	1	1	1
PRT	sp|Q5T653|RM02_HUMAN	39S ribosomal protein L2, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	300-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	40-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O95210|STBD1_HUMAN	Starch-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=STBD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	211-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q96K21|ANCHR_HUMAN	Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	213-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	898-UNIMOD:21,794-UNIMOD:21,799-UNIMOD:35,684-UNIMOD:21	0.02	17.0	3	3	3
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	509-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|O60271-2|JIP4_HUMAN	Isoform 2 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	245-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	113-UNIMOD:21,366-UNIMOD:21,373-UNIMOD:4	0.04	17.0	2	2	2
PRT	sp|Q53F19|NCBP3_HUMAN	Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	439-UNIMOD:21,444-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1507-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q6NYC1|JMJD6_HUMAN	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	380-UNIMOD:4,381-UNIMOD:21,394-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	659-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	487-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	236-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	21-UNIMOD:21,12-UNIMOD:21	0.13	17.0	3	2	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.16	17.0	1	1	1
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	45-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2834-UNIMOD:21,2361-UNIMOD:21,1554-UNIMOD:21	0.01	17.0	3	3	3
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	13-UNIMOD:4,15-UNIMOD:21,89-UNIMOD:21,115-UNIMOD:21	0.20	17.0	4	3	2
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	147-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1043-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	591-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	318-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q06323|PSME1_HUMAN	Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	38-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q96B01|R51A1_HUMAN	RAD51-associated protein 1 OS=Homo sapiens OX=9606 GN=RAD51AP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	317-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q96BN8|OTUL_HUMAN	Ubiquitin thioesterase otulin OS=Homo sapiens OX=9606 GN=OTULIN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	76-UNIMOD:21,81-UNIMOD:21,92-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	198-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9UMY4|SNX12_HUMAN	Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	73-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	18-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9BRT6|LLPH_HUMAN	Protein LLP homolog OS=Homo sapiens OX=9606 GN=LLPH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	31-UNIMOD:21	0.10	17.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	309-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q8TEU7|RPGF6_HUMAN	Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1440-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1370-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|Q9UI08|EVL_HUMAN	Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	331-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	111-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	168-UNIMOD:21,100-UNIMOD:21,107-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.16	17.0	1	1	1
PRT	sp|Q9C0B0|UNK_HUMAN	RING finger protein unkempt homolog OS=Homo sapiens OX=9606 GN=UNK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	378-UNIMOD:21,383-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	105-UNIMOD:4,109-UNIMOD:21,108-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|P31930|QCR1_HUMAN	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	217-UNIMOD:21,212-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|Q5J8M3|EMC4_HUMAN	ER membrane protein complex subunit 4 OS=Homo sapiens OX=9606 GN=EMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	32-UNIMOD:21,36-UNIMOD:21	0.12	17.0	2	2	2
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	260-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9UGP4|LIMD1_HUMAN	LIM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	233-UNIMOD:21,235-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	631-UNIMOD:21,645-UNIMOD:4,298-UNIMOD:21,387-UNIMOD:21,386-UNIMOD:21,390-UNIMOD:21	0.05	17.0	6	4	2
PRT	sp|P54750|PDE1A_HUMAN	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	480-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q8TEA8|DTD1_HUMAN	D-aminoacyl-tRNA deacylase 1 OS=Homo sapiens OX=9606 GN=DTD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	196-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	4-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P13473|LAMP2_HUMAN	Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null	153-UNIMOD:385,153-UNIMOD:4,155-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	290-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q53GL7|PAR10_HUMAN	Protein mono-ADP-ribosyltransferase PARP10 OS=Homo sapiens OX=9606 GN=PARP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	37-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q8NHM5|KDM2B_HUMAN	Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	1142-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	339-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	148-UNIMOD:21,152-UNIMOD:4,156-UNIMOD:4,211-UNIMOD:21,210-UNIMOD:21,241-UNIMOD:21,247-UNIMOD:4	0.18	16.0	6	5	4
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	57-UNIMOD:21,55-UNIMOD:28	0.03	16.0	4	2	1
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	31-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	49-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	15-UNIMOD:21,74-UNIMOD:21	0.11	16.0	2	2	2
PRT	sp|Q9UBH6|XPR1_HUMAN	Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens OX=9606 GN=XPR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	666-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q969X5|ERGI1_HUMAN	Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens OX=9606 GN=ERGIC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	206-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	129-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	408-UNIMOD:21,483-UNIMOD:21	0.05	16.0	2	2	2
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	321-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	539-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	123-UNIMOD:21	0.11	16.0	2	2	2
PRT	sp|P57678|GEMI4_HUMAN	Gem-associated protein 4 OS=Homo sapiens OX=9606 GN=GEMIN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1037-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9BYC8|RM32_HUMAN	39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	183-UNIMOD:21	0.05	16.0	4	2	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	332-UNIMOD:21,102-UNIMOD:21	0.04	16.0	2	2	2
PRT	sp|Q9BZ23|PANK2_HUMAN	Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	189-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	63-UNIMOD:21,39-UNIMOD:21	0.27	16.0	3	3	3
PRT	sp|Q9NZN8|CNOT2_HUMAN	CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	157-UNIMOD:21,242-UNIMOD:21	0.06	16.0	2	2	2
PRT	sp|O00217|NDUS8_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	140-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	62-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	617-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9H2J7|S6A15_HUMAN	Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	701-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q04864|REL_HUMAN	Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	267-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P0C7P4|UCRIL_HUMAN	Putative cytochrome b-c1 complex subunit Rieske-like protein 1 OS=Homo sapiens OX=9606 GN=UQCRFS1P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	60-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	118-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1186-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	415-UNIMOD:21,495-UNIMOD:4,504-UNIMOD:21,506-UNIMOD:4	0.08	16.0	2	2	2
PRT	sp|O00273|DFFA_HUMAN	DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	28-UNIMOD:21,38-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	166-UNIMOD:21,159-UNIMOD:35,164-UNIMOD:21	0.08	16.0	3	1	0
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	42-UNIMOD:4,44-UNIMOD:21,46-UNIMOD:21	0.06	16.0	3	2	1
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	435-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q6ZSZ5|ARHGI_HUMAN	Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1289-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P25325-2|THTM_HUMAN	Isoform 2 of 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	15-UNIMOD:21,27-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	104-UNIMOD:21	0.11	16.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	78-UNIMOD:21,217-UNIMOD:21,224-UNIMOD:21	0.08	16.0	4	3	2
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1583-UNIMOD:21,359-UNIMOD:21,362-UNIMOD:4,364-UNIMOD:4,1609-UNIMOD:21	0.02	16.0	3	3	3
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	984-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	256-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9BTE6|AASD1_HUMAN	Alanyl-tRNA editing protein Aarsd1 OS=Homo sapiens OX=9606 GN=AARSD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	174-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	458-UNIMOD:21,539-UNIMOD:21,540-UNIMOD:4	0.05	16.0	2	2	2
PRT	sp|P61081|UBC12_HUMAN	NEDD8-conjugating enzyme Ubc12 OS=Homo sapiens OX=9606 GN=UBE2M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	175-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|Q96AQ6|PBIP1_HUMAN	Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Homo sapiens OX=9606 GN=PBXIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	407-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P21731|TA2R_HUMAN	Thromboxane A2 receptor OS=Homo sapiens OX=9606 GN=TBXA2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	331-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9Y2R9|RT07_HUMAN	28S ribosomal protein S7, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	84-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1140-UNIMOD:21,3211-UNIMOD:21,3213-UNIMOD:4	0.01	16.0	2	2	2
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1942-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	44-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	445-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P25054|APC_HUMAN	Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	1387-UNIMOD:4,1389-UNIMOD:21,1387-UNIMOD:385,1388-UNIMOD:21,2572-UNIMOD:21,1072-UNIMOD:21	0.02	16.0	4	3	2
PRT	sp|Q7L2E3|DHX30_HUMAN	ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	226-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	152-UNIMOD:21,162-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|Q02218|ODO1_HUMAN	2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	871-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9H694|BICC1_HUMAN	Protein bicaudal C homolog 1 OS=Homo sapiens OX=9606 GN=BICC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	722-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q15390|MTFR1_HUMAN	Mitochondrial fission regulator 1 OS=Homo sapiens OX=9606 GN=MTFR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	119-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	270-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	504-UNIMOD:4,505-UNIMOD:21,507-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	400-UNIMOD:21,863-UNIMOD:21	0.03	16.0	3	3	3
PRT	sp|Q8N350|CBARP_HUMAN	Voltage-dependent calcium channel beta subunit-associated regulatory protein OS=Homo sapiens OX=9606 GN=CBARP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	344-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	167-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,19-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|Q9H8S9|MOB1A_HUMAN	MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	0.05	16.0	3	2	1
PRT	sp|Q8TBF4|ZCRB1_HUMAN	Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens OX=9606 GN=ZCRB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	207-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	175-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|O60783|RT14_HUMAN	28S ribosomal protein S14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	56-UNIMOD:21,61-UNIMOD:21	0.10	16.0	1	1	1
PRT	sp|Q96BK5|PINX1_HUMAN	PIN2/TERF1-interacting telomerase inhibitor 1 OS=Homo sapiens OX=9606 GN=PINX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	110-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9UBB5|MBD2_HUMAN	Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	250-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	558-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	432-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O00625|PIR_HUMAN	Pirin OS=Homo sapiens OX=9606 GN=PIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	27-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q13625|ASPP2_HUMAN	Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	739-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9UBT2|SAE2_HUMAN	SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	507-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	283-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	241-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	932-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O75127|PTCD1_HUMAN	Pentatricopeptide repeat-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	105-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	268-UNIMOD:21	0.03	15.0	2	1	0
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	337-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	316-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	401-UNIMOD:21,723-UNIMOD:21	0.03	15.0	2	2	2
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	429-UNIMOD:21,433-UNIMOD:4,437-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	761-UNIMOD:4,762-UNIMOD:21,766-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|P57772|SELB_HUMAN	Selenocysteine-specific elongation factor OS=Homo sapiens OX=9606 GN=EEFSEC PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	29-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O15066|KIF3B_HUMAN	Kinesin-like protein KIF3B OS=Homo sapiens OX=9606 GN=KIF3B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	723-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	268-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P15291|B4GT1_HUMAN	Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	327-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	416-UNIMOD:4,434-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	120-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	462-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q8N1F8|S11IP_HUMAN	Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	387-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q96T51|RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	74-UNIMOD:21,81-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	44-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P52943|CRIP2_HUMAN	Cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=CRIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	115-UNIMOD:21,126-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	928-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1337-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|P0DPI2|GAL3A_HUMAN	Glutamine amidotransferase-like class 1 domain-containing protein 3A, mitochondrial OS=Homo sapiens OX=9606 GN=GATD3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	144-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|O00767|ACOD_HUMAN	Acyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	198-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q69YN4|VIR_HUMAN	Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1432-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9NSV4|DIAP3_HUMAN	Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1173-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	26-UNIMOD:21	0.12	15.0	1	1	1
PRT	sp|Q9NVU0|RPC5_HUMAN	DNA-directed RNA polymerase III subunit RPC5 OS=Homo sapiens OX=9606 GN=POLR3E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	192-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O94875|SRBS2_HUMAN	Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	843-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q92888|ARHG1_HUMAN	Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	631-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	169-UNIMOD:21,49-UNIMOD:21	0.08	15.0	2	2	2
PRT	sp|Q9H3Q1|BORG4_HUMAN	Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	307-UNIMOD:21,313-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|O43164|PJA2_HUMAN	E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	200-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9BUR5|MIC26_HUMAN	MICOS complex subunit MIC26 OS=Homo sapiens OX=9606 GN=APOO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	34-UNIMOD:21,41-UNIMOD:21	0.13	15.0	2	1	0
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	710-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9C0A0|CNTP4_HUMAN	Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	520-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	53-UNIMOD:4,54-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1054-UNIMOD:35,1055-UNIMOD:21,1070-UNIMOD:4,1069-UNIMOD:35	0.02	15.0	7	2	0
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1	0.34	15.0	1	1	1
PRT	sp|P20340|RAB6A_HUMAN	Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,2-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	188-UNIMOD:385,188-UNIMOD:4,190-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	176-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O43709|BUD23_HUMAN	Probable 18S rRNA (guanine-N(7))-methyltransferase OS=Homo sapiens OX=9606 GN=BUD23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	248-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,5-UNIMOD:21,1-UNIMOD:1	0.05	15.0	2	2	2
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	161-UNIMOD:21	0.06	15.0	2	2	2
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	452-UNIMOD:21,465-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q96KQ4|ASPP1_HUMAN	Apoptosis-stimulating of p53 protein 1 OS=Homo sapiens OX=9606 GN=PPP1R13B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	311-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9NTX5|ECHD1_HUMAN	Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	54-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q9BRX5|PSF3_HUMAN	DNA replication complex GINS protein PSF3 OS=Homo sapiens OX=9606 GN=GINS3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	85-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	2247-UNIMOD:21,1959-UNIMOD:21	0.01	15.0	2	2	2
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	612-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	618-UNIMOD:21,623-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	30-UNIMOD:21	0.09	14.0	3	2	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1859-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P48960|CD97_HUMAN	CD97 antigen OS=Homo sapiens OX=9606 GN=CD97 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	831-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P34896|GLYC_HUMAN	Serine hydroxymethyltransferase, cytosolic OS=Homo sapiens OX=9606 GN=SHMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	410-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q16875|F263_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	461-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	86-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	515-UNIMOD:21	0.01	14.0	2	2	2
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	226-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P43897|EFTS_HUMAN	Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	57-UNIMOD:21,64-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	174-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9UJU6-3|DBNL_HUMAN	Isoform 3 of Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	255-UNIMOD:21,256-UNIMOD:4	0.05	14.0	1	1	1
PRT	sp|P12081|HARS1_HUMAN	Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	27-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	474-UNIMOD:21,150-UNIMOD:21,152-UNIMOD:4	0.04	14.0	2	2	2
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	89-UNIMOD:21	0.07	14.0	1	1	1
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1807-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	153-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P50548|ERF_HUMAN	ETS domain-containing transcription factor ERF OS=Homo sapiens OX=9606 GN=ERF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	185-UNIMOD:21,189-UNIMOD:4	0.05	14.0	1	1	1
PRT	sp|Q9H1H9|KI13A_HUMAN	Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1698-UNIMOD:21,1699-UNIMOD:4,1705-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|Q658Y4|F91A1_HUMAN	Protein FAM91A1 OS=Homo sapiens OX=9606 GN=FAM91A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	754-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	340-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q96PZ0|PUS7_HUMAN	Pseudouridylate synthase 7 homolog OS=Homo sapiens OX=9606 GN=PUS7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	14.0	null	256-UNIMOD:21,258-UNIMOD:4,33-UNIMOD:28,36-UNIMOD:21,38-UNIMOD:4	0.04	14.0	2	2	2
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1053-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9HBD1|RC3H2_HUMAN	Roquin-2 OS=Homo sapiens OX=9606 GN=RC3H2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1119-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	511-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q7KZI7-13|MARK2_HUMAN	Isoform 13 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	376-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	125-UNIMOD:21,131-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O14744|ANM5_HUMAN	Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	634-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P13473-2|LAMP2_HUMAN	Isoform LAMP-2B of Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	403-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q14703|MBTP1_HUMAN	Membrane-bound transcription factor site-1 protease OS=Homo sapiens OX=9606 GN=MBTPS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	954-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9Y6Q9|NCOA3_HUMAN	Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	857-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q8TDM6|DLG5_HUMAN	Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	972-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|A1L0T0|ILVBL_HUMAN	Acetolactate synthase-like protein OS=Homo sapiens OX=9606 GN=ILVBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	629-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P29692-2|EF1D_HUMAN	Isoform 2 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	3-UNIMOD:21,8-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	574-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	108-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	31-UNIMOD:21	0.12	14.0	1	1	1
PRT	sp|O75940|SPF30_HUMAN	Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	197-UNIMOD:21	0.05	14.0	2	1	0
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	185-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q9P265|DIP2B_HUMAN	Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	201-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9BRG2|SH23A_HUMAN	SH2 domain-containing protein 3A OS=Homo sapiens OX=9606 GN=SH2D3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	125-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	6-UNIMOD:21,11-UNIMOD:4,15-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|Q13111|CAF1A_HUMAN	Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	873-UNIMOD:21,876-UNIMOD:21,878-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q96G74|OTUD5_HUMAN	OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	431-UNIMOD:21,434-UNIMOD:4	0.04	14.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	174-UNIMOD:21	0.00	14.0	1	1	1
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	41-UNIMOD:21	0.09	14.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,3-UNIMOD:21	0.08	14.0	1	1	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	257-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q69YH5|CDCA2_HUMAN	Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	188-UNIMOD:4,199-UNIMOD:21,977-UNIMOD:21,979-UNIMOD:4	0.03	14.0	2	2	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	99-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	560-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	90-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O00244|ATOX1_HUMAN	Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	63-UNIMOD:21	0.13	14.0	1	1	1
PRT	sp|Q86X27|RGPS2_HUMAN	Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	315-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	490-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	244-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P26373-2|RL13_HUMAN	Isoform 2 of 60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	92-UNIMOD:21	0.10	14.0	1	1	1
PRT	sp|Q6ZS81|WDFY4_HUMAN	WD repeat- and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=WDFY4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	2181-UNIMOD:21,2184-UNIMOD:21,2186-UNIMOD:21	0.00	14.0	1	1	1
PRT	sp|Q9UPV0|CE164_HUMAN	Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	765-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O14777|NDC80_HUMAN	Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	5-UNIMOD:21,15-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P09496|CLCA_HUMAN	Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	234-UNIMOD:35,236-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	52-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|O75438|NDUB1_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1 OS=Homo sapiens OX=9606 GN=NDUFB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	42-UNIMOD:21	0.12	13.0	1	1	1
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1016-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q58FF3|ENPLL_HUMAN	Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	323-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P52788|SPSY_HUMAN	Spermine synthase OS=Homo sapiens OX=9606 GN=SMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	57-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	279-UNIMOD:21,179-UNIMOD:4,190-UNIMOD:21,195-UNIMOD:21	0.09	13.0	2	2	2
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.10	13.0	1	1	1
PRT	sp|Q9BWH2|FUND2_HUMAN	FUN14 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FUNDC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	151-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	187-UNIMOD:21,190-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1134-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9UN86|G3BP2_HUMAN	Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	40-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	2954-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.05	13.0	1	1	1
PRT	sp|O60220|TIM8A_HUMAN	Mitochondrial import inner membrane translocase subunit Tim8 A OS=Homo sapiens OX=9606 GN=TIMM8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	94-UNIMOD:21	0.12	13.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	432-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	709-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.13	13.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	93-UNIMOD:21	0.10	13.0	2	1	0
PRT	sp|P33527|MRP1_HUMAN	Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	916-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	70-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9Y262|EIF3L_HUMAN	Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	208-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P53814|SMTN_HUMAN	Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	301-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9GZY8-5|MFF_HUMAN	Isoform 5 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	146-UNIMOD:21	0.04	13.0	2	1	0
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	23-UNIMOD:21	0.03	13.0	2	1	0
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|Q12797|ASPH_HUMAN	Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	113-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q8NBM4|UBAC2_HUMAN	Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBAC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	296-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	160-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|O60610|DIAP1_HUMAN	Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1256-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q96GX5|GWL_HUMAN	Serine/threonine-protein kinase greatwall OS=Homo sapiens OX=9606 GN=MASTL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	551-UNIMOD:21,555-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	13.0	null	806-UNIMOD:4,810-UNIMOD:21,273-UNIMOD:21	0.05	13.0	2	2	2
PRT	sp|P15056|BRAF_HUMAN	Serine/threonine-protein kinase B-raf OS=Homo sapiens OX=9606 GN=BRAF PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	447-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q6L8Q7|PDE12_HUMAN	2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	108-UNIMOD:4,109-UNIMOD:21,119-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|Q99504|EYA3_HUMAN	Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	64-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q96BR5|COA7_HUMAN	Cytochrome c oxidase assembly factor 7 OS=Homo sapiens OX=9606 GN=COA7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	107-UNIMOD:21,111-UNIMOD:4,172-UNIMOD:4,175-UNIMOD:21	0.17	13.0	3	2	1
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	333-UNIMOD:28,335-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q8N6S5|AR6P6_HUMAN	ADP-ribosylation factor-like protein 6-interacting protein 6 OS=Homo sapiens OX=9606 GN=ARL6IP6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,2-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,6-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	43-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q13439-5|GOGA4_HUMAN	Isoform 5 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	39-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P49257|LMAN1_HUMAN	Protein ERGIC-53 OS=Homo sapiens OX=9606 GN=LMAN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	51-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	106-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q13951|PEBB_HUMAN	Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	22-UNIMOD:21,25-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|P41162|ETV3_HUMAN	ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	409-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	397-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	79-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9UIK4|DAPK2_HUMAN	Death-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=DAPK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	67-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O15231|ZN185_HUMAN	Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	465-UNIMOD:21,466-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|Q7Z7A1|CNTRL_HUMAN	Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1544-UNIMOD:21	0.00	13.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1162-UNIMOD:21	0.00	13.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	370-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	657-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	703-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q8ND76|CCNY_HUMAN	Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	324-UNIMOD:21,326-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q6ZV73|FGD6_HUMAN	FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	605-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q8IUI8|CRLF3_HUMAN	Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	null	332-UNIMOD:21,336-UNIMOD:4	0.05	12.0	1	1	1
PRT	sp|Q14194|DPYL1_HUMAN	Dihydropyrimidinase-related protein 1 OS=Homo sapiens OX=9606 GN=CRMP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	8-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P42892|ECE1_HUMAN	Endothelin-converting enzyme 1 OS=Homo sapiens OX=9606 GN=ECE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	403-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	null	449-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q6P6C2|ALKB5_HUMAN	RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	96-UNIMOD:21,100-UNIMOD:4	0.03	12.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	198-UNIMOD:21,199-UNIMOD:4	0.06	12.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	52-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P19532|TFE3_HUMAN	Transcription factor E3 OS=Homo sapiens OX=9606 GN=TFE3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	568-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	88-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9H814|PHAX_HUMAN	Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	298-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q8WUI4|HDAC7_HUMAN	Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	487-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q6IN84|MRM1_HUMAN	rRNA methyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=MRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	181-UNIMOD:21,182-UNIMOD:4	0.04	12.0	1	1	1
PRT	sp|Q15020|SART3_HUMAN	Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	924-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q9NZJ0|DTL_HUMAN	Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	557-UNIMOD:21,559-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|Q9H4I2|ZHX3_HUMAN	Zinc fingers and homeoboxes protein 3 OS=Homo sapiens OX=9606 GN=ZHX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	7-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:4	0.01	12.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	36-UNIMOD:21	0.09	12.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	47-UNIMOD:4	0.09	12.0	2	2	2
PRT	sp|Q96FF9|CDCA5_HUMAN	Sororin OS=Homo sapiens OX=9606 GN=CDCA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	83-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	144-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9H6H4|REEP4_HUMAN	Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	152-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	672-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	286-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P26374|RAE2_HUMAN	Rab proteins geranylgeranyltransferase component A 2 OS=Homo sapiens OX=9606 GN=CHML PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	320-UNIMOD:4,321-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q32P44|EMAL3_HUMAN	Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	889-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q14573|ITPR3_HUMAN	Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	2609-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9P0V3|SH3B4_HUMAN	SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	372-UNIMOD:4,373-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	243-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q9H3H1|MOD5_HUMAN	tRNA dimethylallyltransferase OS=Homo sapiens OX=9606 GN=TRIT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	431-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q6XZF7|DNMBP_HUMAN	Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	578-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P56937|DHB7_HUMAN	3-keto-steroid reductase OS=Homo sapiens OX=9606 GN=HSD17B7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	177-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	114-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	291-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q96FZ2|HMCES_HUMAN	Abasic site processing protein HMCES OS=Homo sapiens OX=9606 GN=HMCES PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	154-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q9NYL2|M3K20_HUMAN	Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	567-UNIMOD:21,571-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|O60566|BUB1B_HUMAN	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	509-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|P13674-2|P4HA1_HUMAN	Isoform 2 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	361-UNIMOD:21,364-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q4V321|GAG13_HUMAN	G antigen 13 OS=Homo sapiens OX=9606 GN=GAGE13 PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	8-UNIMOD:21	0.09	12.0	1	1	1
PRT	sp|Q9BWT1|CDCA7_HUMAN	Cell division cycle-associated protein 7 OS=Homo sapiens OX=9606 GN=CDCA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null		0.05	12.0	1	1	1
PRT	sp|Q71UI9|H2AV_HUMAN	Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	19-UNIMOD:21,21-UNIMOD:21	0.13	12.0	1	1	1
PRT	sp|Q9H4F8|SMOC1_HUMAN	SPARC-related modular calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=SMOC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	405-UNIMOD:21,408-UNIMOD:4	0.03	12.0	1	1	1
PRT	sp|Q5TBE3|CI153_HUMAN	Uncharacterized protein C9orf153 OS=Homo sapiens OX=9606 GN=C9orf153 PE=4 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	94-UNIMOD:21,96-UNIMOD:21	0.10	12.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	410-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	156-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	914-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|O00716-2|E2F3_HUMAN	Isoform 2 of Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	50-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q9H6P5|TASP1_HUMAN	Threonine aspartase 1 OS=Homo sapiens OX=9606 GN=TASP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	211-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q92626|PXDN_HUMAN	Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	232-UNIMOD:21,243-UNIMOD:4	0.01	12.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	HQGVMVGMGQKDSYVGDEAQSK	1	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3198.3	26.95255	4	2430.039294	2430.034511	R	R	42	64
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	2	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2979.4	21.44148	4	3188.318894	3188.312914	K	K	97	126
PSM	KGSLESPATDVFGSTEEGEK	3	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3541.2	35.57835	3	2146.933271	2146.930741	R	R	330	350
PSM	QASTDAGTAGALTPQHVR	4	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3089.5	24.2352	3	1859.851571	1859.852705	R	A	107	125
PSM	HQGVMVGMGQKDSYVGDEAQSK	5	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2956.5	20.86162	4	2462.025694	2462.024341	R	R	42	64
PSM	KLSSSDAPAQDTGSSAAAVETDASR	6	sp|Q7Z4S6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3149.6	25.76027	3	2501.089571	2501.091886	R	T	851	876
PSM	RASQGLLSSIENSESDSSEAK	7	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3613.4	37.39222	3	2274.004271	2274.001280	R	E	1540	1561
PSM	SVSTPSEAGSQDSGDGAVGSR	8	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2961.4	20.98828	3	2029.820471	2029.822587	K	T	92	113
PSM	HQGVMVGMGQKDSYVGDEAQSK	9	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3029.5	22.70727	4	2446.034494	2446.029426	R	R	42	64
PSM	AQALRDNSTMGYMMAK	10	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3378.3	31.46973	3	1866.785471	1866.782776	K	K	481	497
PSM	HQGVMVGMGQKDSYVGDEAQSK	11	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3189.4	26.7548	4	2430.039294	2430.034511	R	R	42	64
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	12	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3376.3	31.42433	4	3223.234894	3223.230486	K	-	122	148
PSM	SLSEQPVMDTATATEQAK	13	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3459.2	33.53555	3	1985.867171	1985.865303	R	Q	49	67
PSM	TRSNPEGAEDRAVGAQASVGSR	14	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2951.3	20.73555	4	2294.042094	2294.040065	R	S	27	49
PSM	AASIFGGAKPVDTAAR	15	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3374.2	31.36942	3	1610.783771	1610.781772	R	E	357	373
PSM	TMQGEGPQLLLSEAVSR	16	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4437.2	52.78018	3	1894.888871	1894.885979	K	A	1053	1070
PSM	YHTSQSGDEMTSLSEYVSR	17	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3696.3	39.48077	3	2255.907971	2255.904208	R	M	457	476
PSM	SSLQQENLVEQAGSSSLVNGR	18	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3760.2	41.09673	3	2282.059271	2282.053984	R	L	323	344
PSM	NISQDMTQTSGTNLTSEELRK	19	sp|P54252|ATX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3467.2	33.73042	3	2432.080871	2432.089049	R	R	263	284
PSM	RLQSIGTENTEENRR	20	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2938.6	20.49378	3	1881.876371	1881.869418	K	F	43	58
PSM	SQIFSTASDNQPTVTIK	21	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3650.3	38.31597	3	1915.896071	1915.892839	K	V	448	465
PSM	RKASGPPVSELITK	22	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3210.4	27.25342	3	1561.824071	1561.822909	K	A	34	48
PSM	SSIGTGYDLSASTFSPDGR	23	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4433.2	52.73707	3	2038.8569	2038.8516	M	V	2	21
PSM	KASGPPVSELITK	24	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3372.2	31.32138	2	1405.720247	1405.721798	R	A	34	47
PSM	SDSRAQAVSEDAGGNEGR	25	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2827.2	17.89453	3	1884.760571	1884.759927	R	A	117	135
PSM	SLTPAVPVESKPDKPSGK	26	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3132.4	25.31922	3	1915.964771	1915.965610	K	S	133	151
PSM	SCVEEPEPEPEAAEGDGDK	27	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3105.5	24.63885	3	2123.784971	2123.787841	K	K	107	126
PSM	KGSSSSVCSVASSSDISLGSTK	28	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3343.6	30.59688	3	2209.980671	2209.977373	R	T	1382	1404
PSM	TMQGEGPQLLLSEAVSR	29	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4238.2	50.37357	3	1910.883671	1910.880894	K	A	1053	1070
PSM	NVSSFPDDATSPLQENR	30	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3663.5	38.65305	3	1955.826971	1955.826216	R	N	52	69
PSM	SNSVGIQDAFNDGSDSTFQK	31	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3786.6	41.74402	3	2195.900771	2195.900837	R	R	1182	1202
PSM	SLQYGAEETPLAGSYGAADSFPK	32	sp|Q9HB90|RRAGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4694.2	55.17647	3	2480.0869	2480.0779	M	D	2	25
PSM	KQQSIAGSADSKPIDVSR	33	sp|Q12904|AIMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3006.6	22.11698	3	1965.948971	1965.952085	K	L	137	155
PSM	SKGPSAAGEQEPDKESGASVDEVAR	34	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2994.4	21.81235	4	2580.132894	2580.134085	K	Q	45	70
PSM	KASSDLDQASVSPSEEENSESSSESEK	35	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3044.6	23.08323	3	2922.173771	2922.177526	R	T	172	199
PSM	AITGASLADIMAK	36	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4010.2	46.87158	2	1340.641647	1340.641104	R	R	81	94
PSM	DGSLASNPYSGDLTK	37	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3492.2	34.34369	2	1603.677447	1603.676698	R	F	850	865
PSM	KQSLGELIGTLNAAK	38	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3951.2	45.64465	3	1621.846271	1621.844038	R	V	56	71
PSM	IRYESLTDPSKLDSGK	39	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3464.4	33.65007	3	1887.898271	1887.897924	K	E	54	70
PSM	TMQGEGPQLLLSEAVSR	40	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4227.2	50.17288	3	1910.883671	1910.880894	K	A	1053	1070
PSM	DNLTLWTSDMQGDGEEQNK	41	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3868.3	43.71715	3	2179.937171	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	42	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3926.4	45.05647	3	2192.880971	2192.873028	R	-	228	248
PSM	HQGVMVGMGQKDSYVGDEAQSK	43	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3228.3	27.6733	4	2431.021294	2430.034511	R	R	42	64
PSM	QRGSETDTDSEIHESASDKDSLSK	44	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3010.5	22.21677	4	2684.1055	2684.1081	R	G	1260	1284
PSM	SVAGGEIRGDTGGEDTAAPGR	45	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3240.4	27.97252	3	2093.9027	2093.9010	M	F	2	23
PSM	GASQAGMTGYGMPR	46	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3373.3	31.3487	2	1462.572447	1462.573436	R	Q	183	197
PSM	AASIFGGAKPVDTAAR	47	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3366.3	31.17405	3	1610.783771	1610.781772	R	E	357	373
PSM	KCSLPAEEDSVLEK	48	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	29.7238	3	1683.741371	1683.742669	K	L	634	648
PSM	HQGVMVGMGQKDSYVGDEAQSK	49	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3099.6	24.48805	4	2446.033694	2446.029426	R	R	42	64
PSM	AASAATAAPTATPAAQESGTIPK	50	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3256.5	28.38695	3	2162.023571	2162.025644	R	K	63	86
PSM	DVAEAKPELSLLGDGDH	51	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3683.2	39.13853	3	1764.855671	1764.853008	R	-	232	249
PSM	GFSEGLWEIENNPTVK	52	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4659.2	54.85028	3	1898.848571	1898.845160	K	A	81	97
PSM	SQIFSTASDNQPTVTIK	53	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3642.5	38.12105	3	1915.896071	1915.892839	K	V	448	465
PSM	MASNIFGPTEEPQNIPK	54	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3917.2	44.8177	3	1951.877471	1951.875080	R	R	43	60
PSM	NYGSYSTQASAAAATAELLK	55	sp|O14828|SCAM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4140.2	48.90588	3	2095.948571	2095.946331	K	K	82	102
PSM	RGTGQSDDSDIWDDTALIK	56	sp|Q16637|SMN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3931.4	45.1763	3	2171.944571	2171.937223	R	A	23	42
PSM	DNLTLWTSDQQDDDGGEGNN	57	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3899.4	44.42198	3	2192.880671	2192.873028	R	-	228	248
PSM	TPEELDDSDFETEDFDVR	58	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4038.3	47.32488	3	2237.858171	2237.852550	R	S	634	652
PSM	DNLTLWTSDTQGDEAEAGEGGEN	59	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3972.3	46.10112	3	2407.998371	2407.988786	R	-	223	246
PSM	DNLTLWTSDSAGEECDAAEGAEN	60	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4022.2	47.04247	3	2453.983571	2453.976507	R	-	223	246
PSM	SLQYGAEETPLAGSYGAADSFPK	61	sp|Q9HB90|RRAGC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4670.2	54.9737	3	2480.0869	2480.0779	M	D	2	25
PSM	STDTGVSLPSYEEDQGSK	62	sp|Q9Y241|HIG1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	39.8358	3	2020.8181	2020.8145	M	L	2	20
PSM	SAETRESTQLSPADLTEGKPTDPSK	63	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3298.2	29.44188	4	2724.250094	2724.249115	K	L	446	471
PSM	RDSSESQLASTESDKPTTGR	64	sp|Q96B23|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2892.3	19.35175	4	2230.972494	2230.970314	R	V	64	84
PSM	GYSFSLTTFSPSGK	65	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4275.2	50.90443	2	1557.679047	1557.675241	R	L	5	19
PSM	YKCSVCPDYDLCSVCEGK	66	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:4,4-UNIMOD:21,6-UNIMOD:4,12-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3470.2	33.80197	3	2318.876471	2318.871729	R	G	140	158
PSM	DNLTLWTSENQGDEGDAGEGEN	67	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3897.3	44.37062	3	2349.949871	2349.946922	R	-	225	247
PSM	GVVDSEDLPLNISR	68	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3765.2	41.20815	2	1512.778247	1512.778387	R	E	387	401
PSM	DDDIAALVVDNGSGMCK	69	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4542.2	53.75978	3	1916.7566	1916.7528	M	A	2	19
PSM	NGSLDSPGKQDTEEDEEEDEKDK	70	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2837.3	18.10578	4	2673.045294	2673.045055	K	G	134	157
PSM	DNLTLWTSDQQDDDGGEGNN	71	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3942.3	45.46177	3	2193.868871	2192.873028	R	-	228	248
PSM	KASGPPVSELITK	72	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3364.5	31.12907	2	1405.720247	1405.721798	R	A	34	47
PSM	KGSYNPVTHIYTAQDVK	73	sp|P06865|HEXA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3328.5	30.20718	3	1999.944971	1999.940458	R	E	224	241
PSM	GGNFGGRSSGPYGGGGQYFAK	74	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	30.66687	3	2099.889071	2099.885068	K	P	278	299
PSM	RTSSAQVEGGVHSLHSYEK	75	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3014.2	22.31002	4	2150.974894	2150.974611	K	R	493	512
PSM	SRINSSGESGDESDEFLQSR	76	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3291.4	29.26907	3	2278.935071	2278.933928	R	K	178	198
PSM	NPSTVEAFDLAQSNSEHSR	77	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3497.3	34.46715	4	2167.920494	2167.917156	R	H	213	232
PSM	AITGASLADIMAK	78	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3999.2	46.66112	2	1340.641647	1340.641104	R	R	81	94
PSM	AITGASLADIMAK	79	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4289.2	51.1002	2	1420.610047	1420.607435	R	R	81	94
PSM	DNLTLWTSDQQDDDGGEGNN	80	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3918.3	44.853	3	2192.880671	2192.873028	R	-	228	248
PSM	ADEAPRKGSFSALVGR	81	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3469.3	33.76805	3	1781.8429	1781.8456	M	T	2	18
PSM	SSIGTGYDLSASTFSPDGR	82	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4423.2	52.53013	3	2038.8539	2038.8516	M	V	2	21
PSM	KGSSSSVCSVASSSDISLGSTK	83	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3346.2	30.6602	4	2209.978494	2209.977373	R	T	1382	1404
PSM	KGSITEYTAAEEK	84	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3037.6	22.90805	2	1505.662847	1505.665071	R	E	112	125
PSM	RGSNTTSHLHQAVAK	85	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2779.2	16.9405	4	1685.798894	1685.799882	K	A	301	316
PSM	SLTPAVPVESKPDKPSGK	86	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3124.4	25.11443	3	1915.964771	1915.965610	K	S	133	151
PSM	KLSVPTSDEEDEVPAPKPR	87	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3293.3	29.31775	4	2173.031694	2173.030395	K	G	103	122
PSM	RTGSNISGASSDISLDEQYK	88	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3369.5	31.258	3	2206.981271	2206.974337	K	H	376	396
PSM	DERSDSRAQAVSEDAGGNEGR	89	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2843.5	18.25272	4	2284.930094	2284.930574	R	A	114	135
PSM	DNQHQGSYSEGAQMNGIQPEEIGR	90	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3486.6	34.2016	4	2724.128894	2724.123537	K	L	711	735
PSM	TLTIVDTGIGMTK	91	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4073.2	47.98218	2	1428.693447	1428.693534	R	A	28	41
PSM	TLTIVDTGIGMTK	92	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4059.3	47.78105	2	1428.693447	1428.693534	R	A	28	41
PSM	RSTQGVTLTDLQEAEK	93	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3592.3	36.84505	3	1934.840771	1934.838769	R	T	694	710
PSM	SLSQPTPPPMPILSQSEAK	94	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3997.2	46.62128	3	2087.004671	2087.001009	K	N	6967	6986
PSM	SLGNVIHPDVVVNGGQDQSK	95	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3614.6	37.4183	3	2142.011771	2142.010663	K	E	668	688
PSM	DNLTLWTSDQQDDDGGEGNN	96	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3908.2	44.63072	3	2192.880671	2192.873028	R	-	228	248
PSM	SGDEMIFDPTMSK	97	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4541.2	53.7349	2	1578.6029	1578.5978	M	K	2	15
PSM	NVNIYRDSAIPVESDTDDEGAPR	98	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3547.5	35.7372	4	2612.141694	2612.139170	K	I	455	478
PSM	FSVGGMTDVAEIK	99	sp|P36776|LONM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4036.2	47.28075	2	1432.631647	1432.630934	R	G	547	560
PSM	RAPSVANVGSHCDLSLK	100	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3243.6	28.0552	3	1889.878571	1889.881897	R	I	2149	2166
PSM	NAMGSLASQATK	101	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3244.4	28.07412	2	1257.542247	1257.542453	R	D	354	366
PSM	RLSSLRASTSK	102	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2988.3	21.66565	2	1364.618847	1364.621446	R	S	233	244
PSM	GASQAGMTGYGMPR	103	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3365.5	31.1549	2	1462.572447	1462.573436	R	Q	183	197
PSM	SQSMDIDGVSCEK	104	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3224.4	27.58528	2	1534.566647	1534.568076	R	S	103	116
PSM	RPSESDKEDELDK	105	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2787.2	17.11958	3	1626.678071	1626.677426	R	V	625	638
PSM	KGSEQESVKEFLAK	106	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3334.3	30.35505	3	1738.760471	1738.757999	K	A	9	23
PSM	VPETVADARQSIDVGK	107	sp|P10109|ADX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3218.4	27.45978	3	1763.846771	1763.845495	R	T	167	183
PSM	SQRYSGAYGASVSDEELK	108	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3259.6	28.46792	3	2025.866171	2025.868081	K	R	46	64
PSM	SRTHSTSSSLGSGESPFSR	109	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3095.3	24.37823	3	2045.877371	2045.880377	R	S	327	346
PSM	SRTSVQTEDDQLIAGQSAR	110	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3186.6	26.68388	3	2140.974071	2140.975005	R	A	652	671
PSM	SRSGSSQELDVKPSASPQER	111	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2953.5	20.78382	4	2224.009294	2224.012119	R	S	1537	1557
PSM	RQTSGGPVDASSEYQQELER	112	sp|P18859|ATP5J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3349.3	30.74125	4	2316.009294	2316.001948	K	E	54	74
PSM	NTPHRGSSAGGGGSGAAAATAATAGGQHR	113	sp|O00458|IFRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2814.2	17.62538	4	2612.154494	2612.158952	R	N	8	37
PSM	AITGASLADIMAK	114	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4274.2	50.86627	2	1420.610047	1420.607435	R	R	81	94
PSM	AITGASLADIMAK	115	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4260.2	50.66105	2	1420.610047	1420.607435	R	R	81	94
PSM	TMSEVGGSVEDLIAK	116	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4279.2	50.9755	3	1614.725171	1614.721205	R	G	35	50
PSM	DGKYSQVLANGLDNK	117	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	34.41373	3	1700.777771	1700.777081	K	L	92	107
PSM	INPDGSQSVVEVPYAR	118	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3625.3	37.69312	3	1809.832871	1809.829845	R	S	58	74
PSM	GFSEGLWEIENNPTVK	119	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4638.2	54.6479	3	1898.848571	1898.845160	K	A	81	97
PSM	DATNVGDEGGFAPNILENK	120	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3838.4	42.97215	3	1959.919271	1959.917400	K	E	203	222
PSM	LNRSNSELEDEILCLEK	121	sp|Q8IX94|CTGE4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4044.2	47.44427	3	2140.974071	2140.971166	K	D	135	152
PSM	RLSEDYGVLKTDEGIAYR	122	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	36.96568	4	2164.025694	2164.020165	R	G	110	128
PSM	RDSFDDRGPSLNPVLDYDHGSR	123	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3568.3	36.26842	4	2597.129294	2597.129609	R	S	186	208
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	124	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3815.2	42.44812	3	3014.201171	3014.188484	K	-	661	690
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	125	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3842.2	43.06772	4	3081.282894	3081.278791	K	E	160	186
PSM	ASGVAVSDGVIK	126	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3681.4	39.09548	2	1223.5770	1223.5794	M	V	2	14
PSM	SLGPSLATDKS	127	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3230.4	27.72743	2	1154.521847	1154.522035	R	-	270	281
PSM	SGEGEVSGLMR	128	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3358.4	30.9714	2	1200.484047	1200.484604	R	K	473	484
PSM	AQALRDNSTMGYMAAK	129	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3029.3	22.7006	3	1822.779671	1822.774321	K	K	616	632
PSM	GDRSEDFGVNEDLADSDAR	130	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3354.3	30.86903	3	2066.876771	2066.877720	K	A	186	205
PSM	PCSEETPAISPSK	131	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2993.3	21.79493	2	1481.6089	1481.6104	M	R	2	15
PSM	AQALRDNSTMGYMAAK	132	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3017.4	22.39383	3	1822.772171	1822.774321	K	K	616	632
PSM	RSSLSSHSHQSQIYR	133	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2823.3	17.80592	4	1851.834494	1851.837724	R	S	1367	1382
PSM	SKNEEKEEDDAENYR	134	sp|Q8WVM0|TFB1M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2836.5	18.0774	3	1934.750771	1934.753110	K	L	331	346
PSM	KRSELSQDAEPAGSQETK	135	sp|Q9BVJ6|UT14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2812.2	17.57598	3	2039.917871	2039.916093	R	D	432	450
PSM	ALRTDYNASVSVPDSSGPER	136	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3312.6	29.80522	3	2199.982271	2199.979756	K	I	67	87
PSM	SCVEEPEPEPEAAEGDGDKK	137	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3005.3	22.08168	3	2251.880771	2251.882804	K	G	107	127
PSM	AGEEDEGEEDSDSDYEISAK	138	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3153.6	25.86275	3	2253.794171	2253.795823	R	A	463	483
PSM	RQTSGGPVDASSEYQQELER	139	sp|P18859|ATP5J_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3348.6	30.72528	3	2316.006071	2316.001948	K	E	54	74
PSM	VSYRASQPDLVDTPTSSKPQPK	140	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3176.4	26.41765	4	2480.197694	2480.194835	K	R	1735	1757
PSM	AFSDPFVEAEK	141	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3848.2	43.22588	2	1318.551847	1318.548250	R	S	74	85
PSM	FASENDLPEWK	142	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3808.4	42.2906	2	1414.583447	1414.580613	R	E	58	69
PSM	FASENDLPEWK	143	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3799.5	42.07307	2	1414.583447	1414.580613	R	E	58	69
PSM	DNLTLWTSDMQGDGEEQNK	144	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3882.3	44.06055	3	2179.937171	2179.932792	R	E	226	245
PSM	SLGEIPIVESEIKK	145	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3891.3	44.22258	3	1620.840371	1620.837556	R	E	482	496
PSM	DASLMVTNDGATILK	146	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3888.3	44.14962	3	1627.756571	1627.752840	R	N	58	73
PSM	ALSRQLSSGVSEIR	147	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3463.2	33.61878	3	1661.753171	1661.753917	R	H	76	90
PSM	SQSLPNSLDYTQTSDPGR	148	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3495.4	34.4204	3	2044.877771	2044.873894	R	H	44	62
PSM	RSYSSPDITQAIQEEEK	149	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3560.6	36.07236	3	2059.910771	2059.909945	K	R	715	732
PSM	THSVNGITEEADPTIYSGK	150	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3416.6	32.44993	3	2097.925571	2097.925596	K	V	582	601
PSM	KLSLGQYDNDAGGQLPFSK	151	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3850.3	43.2744	3	2116.986971	2116.983051	R	C	774	793
PSM	SVSSFPVPQDNVDTHPGSGK	152	sp|Q676U5|A16L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3418.6	32.50148	3	2133.934871	2133.936829	R	E	287	307
PSM	KGSLESPATDVFGSTEEGEK	153	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3533.4	35.384	3	2146.933271	2146.930741	R	R	330	350
PSM	RGTGQSDDSDIWDDTALIK	154	sp|Q16637|SMN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3923.3	44.9798	3	2171.944571	2171.937223	R	A	23	42
PSM	DNLTLWTSDQQDDDGGEGNN	155	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3934.2	45.24883	3	2192.880971	2192.873028	R	-	228	248
PSM	RSSSAEESGQDVLENTFSQK	156	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3589.4	36.79507	3	2277.978071	2277.975065	K	H	536	556
PSM	SGDEMIFDPTMSK	157	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4517.2	53.53138	2	1578.6029	1578.5978	M	K	2	15
PSM	SLYPSLEDLKVDK	158	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4332.2	51.56116	2	1627.7777	1627.7741	M	V	2	15
PSM	SISSDEVNFLVYR	159	sp|Q9BZK7|TBL1R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5703.2	62.4064	2	1649.7367	1649.7333	M	Y	2	15
PSM	LQRYSLSGGGTSSH	160	sp|Q9Y6E0|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3022.2	22.51605	3	1528.668371	1528.667136	R	-	430	444
PSM	GGNFGGRSSGPYGGGGQYFAK	161	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3341.2	30.5318	4	2099.887294	2099.885068	K	P	278	299
PSM	IIYGGSVTGATCK	162	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3244.5	28.07745	2	1405.630447	1405.631268	R	E	244	257
PSM	KASGPPVSELITK	163	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3381.4	31.54693	2	1405.720247	1405.721798	R	A	34	47
PSM	QASVADYEETVK	164	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3227.6	27.65832	2	1418.596247	1418.596657	R	K	82	94
PSM	GASQAGMTGYGMPR	165	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3149.5	25.75693	2	1478.564847	1478.568351	R	Q	183	197
PSM	SGSMDPSGAHPSVR	166	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.2782.2	17.01457	3	1479.579971	1479.581358	R	Q	18	32
PSM	KQSGYGGQTKPIFR	167	sp|P83881|RL36A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3040.4	22.9758	3	1645.793771	1645.797756	R	K	44	58
PSM	DSGRGDSVSDSGSDALR	168	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2919.2	19.99478	3	1759.698371	1759.701015	R	S	70	87
PSM	HSGSDRSSFSHYSGLK	169	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2993.2	21.78493	3	1830.764771	1830.768641	R	H	196	212
PSM	AQALRDNSTMGYMMAK	170	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3171.3	26.28588	3	1882.779971	1882.777691	K	K	481	497
PSM	QRSASQSSLDKLDQELK	171	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3363.3	31.09683	3	2011.960571	2011.957564	K	E	726	743
PSM	SLAGSSGPGASSGTSGDHGELVVR	172	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3231.5	27.75645	3	2264.009471	2264.007034	K	I	60	84
PSM	RNTTQNTGYSSGTQNANYPVR	173	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3016.6	22.37485	3	2408.049671	2408.050630	R	A	933	954
PSM	APGSVVELLGK	174	sp|O95363|SYFM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3852.2	43.32215	2	1148.584647	1148.584241	R	S	46	57
PSM	DAGTIAGLNVLR	175	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4081.2	48.08877	2	1278.632247	1278.633317	K	I	160	172
PSM	KITIADCGQLE	176	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3452.2	33.3534	2	1326.588847	1326.589069	K	-	155	166
PSM	KTSLDVSNSAEPGFLAPGAR	177	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3611.3	37.3338	3	2095.995371	2095.993950	R	S	646	666
PSM	STGSFVGELMYK	178	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4049.2	47.55042	2	1397.595047	1397.593820	R	N	361	373
PSM	NLSSPFIFHEK	179	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3775.4	41.46169	2	1397.638847	1397.638068	R	T	644	655
PSM	IYGLGSLALYEK	180	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4425.3	52.57147	2	1405.690247	1405.689435	R	A	68	80
PSM	SAEPAEALVLACK	181	sp|Q96CW6|S7A6O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3759.3	41.06598	2	1437.655647	1437.657483	R	R	16	29
PSM	SLGEIPIVESEIK	182	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4278.2	50.96022	2	1492.746847	1492.742593	R	K	482	495
PSM	ALTVPELTQQVFDAK	183	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4656.2	54.81368	3	1738.855271	1738.854268	R	N	283	298
PSM	AKRSLTSSLENIFSR	184	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3879.2	43.98472	3	1867.861871	1867.859444	K	G	563	578
PSM	KTSDFNTFLAQEGCTK	185	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3586.4	36.72338	3	1925.824271	1925.823045	R	G	198	214
PSM	FSVCVLGDQQHCDEAK	186	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3533.3	35.38066	3	1971.789071	1971.785614	K	A	63	79
PSM	KQTIDNSQGAYQEAFDISKK	187	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3416.4	32.44327	4	2350.085694	2350.084221	R	E	139	159
PSM	KQQSIAGSADSKPIDVSR	188	sp|Q12904|AIMP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3010.2	22.20677	4	1965.948094	1965.952085	K	L	137	155
PSM	SVELEEALPVTTAEGMAK	189	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5271.2	59.55592	3	1995.9179	1995.9107	M	K	2	20
PSM	SVELEEALPVTTAEGMAK	190	sp|Q92522|H1X_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=1.1.4560.2	53.9065	3	2011.9142	2011.9056	M	K	2	20
PSM	SLGDDISSETSGDFRK	191	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3431.3	32.81972	3	1792.752671	1792.751654	K	A	139	155
PSM	SMGLPTSDEQK	192	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3172.4	26.3147	2	1271.509047	1271.510484	K	K	298	309
PSM	RMSLIEEEGSK	193	sp|P06737|PYGL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3171.6	26.29588	2	1357.595247	1357.594882	R	R	428	439
PSM	GILAADESTGSIAK	194	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3374.4	31.37608	2	1411.659047	1411.659591	K	R	29	43
PSM	KNSVVEASEAAYK	195	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3042.6	23.032	2	1474.668247	1474.670490	K	E	143	156
PSM	SGSSSPDSEITELK	196	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3395.6	31.9083	2	1515.632847	1515.634164	R	F	571	585
PSM	KSSTVESEIASEEK	197	sp|Q9Y2K1|ZBTB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3139.3	25.49388	3	1602.701471	1602.702578	R	S	303	317
PSM	ERESLQQMAEVTR	198	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3264.2	28.58228	3	1655.738771	1655.733836	K	E	123	136
PSM	SPSKPLPEVTDEYK	199	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3329.3	30.22618	3	1668.765971	1668.764785	R	N	92	106
PSM	GTSFDAAATSGGSASSEK	200	sp|P13804|ETFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3016.3	22.36485	3	1709.676671	1709.678155	R	A	170	188
PSM	TASFSESRADEVAPAK	201	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3086.6	24.161	3	1744.766171	1744.766910	R	K	453	469
PSM	HQGVMVGMGQKDSYVGDEAQSK	202	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3207.2	27.17122	4	2430.039294	2430.034511	R	R	42	64
PSM	DLEAEHVEVEDTTLNR	203	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3404.4	32.13382	3	1868.873771	1868.875201	R	C	15	31
PSM	AQALRDNSTMGYMMAK	204	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.3005.2	22.07835	3	1898.773271	1898.772606	K	K	481	497
PSM	SGSSQELDVKPSASPQER	205	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3038.5	22.92928	3	1980.877271	1980.878980	R	S	1539	1557
PSM	RVSHQGYSTEAEFEEPR	206	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3121.4	25.03685	3	2100.887771	2100.890213	R	V	240	257
PSM	SPSKPLPEVTDEYKNDVK	207	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3327.2	30.17165	4	2125.002094	2124.998032	R	N	92	110
PSM	KQSFDDNDSEELEDKDSK	208	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2964.6	21.06502	4	2207.877294	2207.874348	K	S	105	123
PSM	LARASGNYATVISHNPETKK	209	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3100.4	24.50693	4	2236.101694	2236.100146	K	T	126	146
PSM	HQGVMVGMGQKDSYVGDEAQSK	210	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3090.6	24.264	3	2446.027871	2446.029426	R	R	42	64
PSM	RVSVCAETYNPDEEEEDTDPR	211	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3270.6	28.74483	3	2590.019171	2590.016672	R	V	97	118
PSM	KFSAHYDAVEAELK	212	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3430.2	32.79168	3	1686.766271	1686.765453	K	S	48	62
PSM	NHSNAQFIESYVCR	213	sp|P41229|KDM5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3583.2	36.64482	3	1803.738371	1803.739984	R	M	315	329
PSM	DRSSTTSTWELLDQR	214	sp|Q9HA77|SYCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3791.3	41.86553	3	1873.821671	1873.820736	K	T	542	557
PSM	DSPSVWAAVPGK	215	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3643.4	38.14377	2	1292.579847	1292.580219	K	T	27	39
PSM	DAGQISGLNVLR	216	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3875.3	43.87682	2	1321.639647	1321.639131	K	V	207	219
PSM	GDNITLLQSVSN	217	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3927.2	45.06828	2	1339.602847	1339.602076	K	-	81	93
PSM	AITGASLADIMAK	218	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3583.5	36.65482	2	1356.636247	1356.636019	R	R	81	94
PSM	AITGASLADIMAK	219	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3593.4	36.87247	2	1356.636247	1356.636019	R	R	81	94
PSM	FASENDLPEWK	220	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3818.3	42.52027	2	1414.586447	1414.580613	R	E	58	69
PSM	SFQGDDSDLLLK	221	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3792.5	41.89455	2	1416.618847	1416.617392	K	T	875	887
PSM	SLYESFVSSSDR	222	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3711.6	39.86167	2	1455.593047	1455.591906	K	L	131	143
PSM	AGSISTLDSLDFAR	223	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4143.2	48.9809	2	1531.694847	1531.691954	R	Y	178	192
PSM	KTSFVNFTDICK	224	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3670.3	38.8155	3	1538.682071	1538.684032	K	L	216	228
PSM	TPSSDVLVFDYTK	225	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4024.3	47.09302	2	1550.693647	1550.690557	K	H	144	157
PSM	SPSFASEWDEIEK	226	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4060.3	47.80588	2	1603.645647	1603.644335	K	I	661	674
PSM	SKESVPEFPLSPPK	227	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3632.2	37.87105	3	1620.779171	1620.780041	R	K	28	42
PSM	RNSSEASSGDFLDLK	228	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3536.3	35.45753	3	1704.735971	1704.735610	R	G	85	100
PSM	VSSKNSLESYAFNMK	229	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3573.3	36.39112	3	1783.788671	1783.785203	K	A	536	551
PSM	DRSSFYVNGLTLGGQK	230	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3763.3	41.15908	3	1820.847971	1820.845829	K	C	55	71
PSM	AMSLVSSDSEGEQNELR	231	sp|Q14643|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3527.3	35.23067	3	1930.800371	1930.797952	R	N	2688	2705
PSM	GSDHSASLEPGELAELVR	232	sp|Q9NR45|SIAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3979.2	46.2346	3	1945.879871	1945.878251	K	S	247	265
PSM	NVSSFPDDATSPLQENR	233	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3672.5	38.87217	3	1955.826371	1955.826216	R	N	52	69
PSM	AEDGSVIDYELIDQDAR	234	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3950.2	45.61049	3	1987.845971	1987.841197	R	D	180	197
PSM	INSSGESGDESDEFLQSR	235	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3431.4	32.82305	3	2035.801571	2035.800789	R	K	180	198
PSM	DLGGNAKCSDFTEEICR	236	sp|P50213|IDH3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4,9-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3525.5	35.1881	3	2050.813871	2050.812557	K	R	344	361
PSM	SIQEIQELDKDDESLRK	237	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3463.5	33.62878	3	2124.997571	2124.994009	K	Y	34	51
PSM	VSSQAEDTSSSFDNLFIDR	238	sp|Q9BZD3|GCOM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4391.2	52.1126	3	2196.927071	2196.921238	R	L	177	196
PSM	KLSGDQITLPTTVDYSSVPK	239	sp|O00559|RCAS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3834.4	42.87458	3	2228.103971	2228.097746	R	Q	34	54
PSM	YHTSQSGDEMTSLSEYVSR	240	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3671.5	38.84703	3	2255.910071	2255.904208	R	M	457	476
PSM	RDSFDDRGPSLNPVLDYDHGSR	241	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	36.06237	4	2597.129294	2597.129609	R	S	186	208
PSM	DDDIAALVVDNGSGMCK	242	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5012.3	57.7903	2	1900.7634	1900.7579	M	A	2	19
PSM	QVQSLTCEVDALK	243	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4626.2	54.53675	2	1552.6871	1552.6839	R	G	322	335
PSM	SQDTEVDMKEVELNELEPEK	244	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4039.2	47.35645	3	2483.0719	2483.0657	M	Q	2	22
PSM	MEPSSLELPADTVQR	245	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.4235.2	50.29903	3	1793.7905	1793.7902	-	I	1	16
PSM	ISFSNIISDMK	246	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3977.2	46.19538	2	1349.595647	1349.593820	K	V	199	210
PSM	RLSTSPDVIQGHQPR	247	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3078.2	23.94092	4	1769.858094	1769.857397	R	D	264	279
PSM	AHSSMVGVNLPQK	248	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3064.2	23.5782	3	1462.664171	1462.663965	R	A	172	185
PSM	RNSLTGEEGQLAR	249	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3065.4	23.61068	3	1509.689171	1509.693685	R	V	110	123
PSM	AQRLSQETEALGR	250	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3163.2	26.0763	3	1537.725971	1537.724985	K	S	365	378
PSM	NSSISGPFGSR	251	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3302.3	29.5436	2	1187.497047	1187.497217	R	S	483	494
PSM	KASSPSPLTIGTPESQR	252	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3301.2	29.51538	3	1834.882271	1834.882608	R	K	520	537
PSM	SGSYSYLEER	253	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3308.2	29.69162	2	1269.490247	1269.491463	R	K	908	918
PSM	QDSAAVGFDYK	254	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3358.5	30.97473	2	1279.514247	1279.512199	R	E	280	291
PSM	KESYSVYVYK	255	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3257.4	28.40952	2	1344.598447	1344.600285	R	V	35	45
PSM	SLSSSLDDTEVK	256	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3349.4	30.74458	2	1359.589647	1359.580672	K	K	156	168
PSM	KHTLSYVDVGTGK	257	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3102.2	24.5517	3	1483.706771	1483.707210	R	V	624	637
PSM	SLSSSLDDTEVKK	258	sp|O95292|VAPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3149.3	25.75027	3	1487.674571	1487.675635	K	V	156	169
PSM	ERHPGSFDVVHVK	259	sp|P62701|RS4X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3123.2	25.08185	3	1585.740371	1585.740242	R	D	199	212
PSM	HSSLAGCQIINYR	260	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3383.2	31.58928	3	1597.706171	1597.707227	R	T	145	158
PSM	HRPSEADEEELAR	261	sp|O14617|AP3D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2887.5	19.23567	3	1617.679871	1617.678429	K	R	655	668
PSM	RNQSFCPTVNLDK	262	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3294.4	29.34682	3	1657.732271	1657.728357	K	L	65	78
PSM	SRKESYSVYVYK	263	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	27.69522	3	1667.703071	1667.699756	R	V	33	45
PSM	SRKESYSVYVYK	264	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3238.2	27.9163	3	1667.703071	1667.699756	R	V	33	45
PSM	EAELSKGESVCLDR	265	sp|P62072|TIM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3154.3	25.8772	3	1671.718271	1671.717517	K	C	40	54
PSM	SRKESYSIYVYK	266	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3339.3	30.48325	3	1681.719371	1681.715406	R	V	33	45
PSM	SISNEGLTLNNSHVSK	267	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3249.4	28.2028	3	1778.817371	1778.820008	R	H	462	478
PSM	LGAGGGSPEKSPSAQELK	268	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3015.5	22.34568	3	1791.837971	1791.840409	R	E	13	31
PSM	GRSSFYPDGGDQETAK	269	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3008.5	22.16515	3	1793.725571	1793.725773	R	T	317	333
PSM	THSTSSSLGSGESPFSR	270	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3213.4	27.32973	3	1802.745971	1802.747237	R	S	329	346
PSM	SRDSLAPGPEPQDEDQK	271	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2953.6	20.78715	3	1947.821171	1947.821130	K	D	1229	1246
PSM	RSLSEQPVMDTATATEQAK	272	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3262.6	28.54502	3	2141.961371	2141.966414	K	Q	48	67
PSM	KSCVEEPEPEPEAAEGDGDK	273	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.2986.5	21.62592	3	2251.880171	2251.882804	K	K	106	126
PSM	RTSSTCSNESLSVGGTSVTPR	274	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3185.6	26.65793	3	2261.992871	2261.994755	K	R	748	769
PSM	VLSIGDGIAR	275	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3649.2	38.28785	2	1079.536047	1079.537626	R	V	74	84
PSM	SPSLNLLQNK	276	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	37.108	2	1192.585647	1192.585304	R	S	529	539
PSM	SADTLWGIQK	277	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3716.3	39.98092	2	1197.541647	1197.543105	K	E	319	329
PSM	SADTLWGIQK	278	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3724.4	40.18872	2	1197.541647	1197.543105	K	E	319	329
PSM	SINQPVAFVR	279	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3587.3	36.74725	2	1209.591847	1209.590724	R	R	15	25
PSM	SADTLWDIQK	280	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3798.4	42.04403	2	1255.549647	1255.548584	K	D	320	330
PSM	LGSIAIQGAIEK	281	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3697.4	39.49962	2	1278.658247	1278.658469	K	A	67	79
PSM	SLEDQVEMLR	282	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3764.3	41.18347	2	1298.556647	1298.557769	K	T	168	178
PSM	MSLPDVDLDLK	283	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4426.2	52.60228	2	1324.599247	1324.598571	K	G	1067	1078
PSM	AITGASLADIMAK	284	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4031.2	47.19345	2	1340.642847	1340.641104	R	R	81	94
PSM	GFSVVADTPELQR	285	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3867.2	43.69857	3	1497.687971	1497.686475	K	I	97	110
PSM	SLPVPGALEQVASR	286	sp|O95785-3|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4042.2	47.39362	3	1502.748371	1502.749409	K	L	12	26
PSM	GQRASLEAAIADAEQR	287	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3543.2	35.62777	3	1764.815471	1764.815591	K	G	326	342
PSM	TLSNAEDYLDDEDSD	288	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3985.3	46.36946	2	1780.625047	1780.620031	R	-	200	215
PSM	KGSLLIDSSTIDPAVSK	289	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3695.4	39.44842	3	1809.915671	1809.912512	K	E	125	142
PSM	TMQGEGPQLLLSEAVSR	290	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4458.2	52.98413	3	1894.888871	1894.885979	K	A	1053	1070
PSM	DATNVGDEGGFAPNILENK	291	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3829.2	42.7478	3	1959.919271	1959.917400	K	E	203	222
PSM	ANSGGVDLDSSGEFASIEK	292	sp|Q92766|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3785.4	41.71162	3	1961.828471	1961.825547	R	M	1165	1184
PSM	KHSQFIGYPITLYLEK	293	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4079.4	48.03827	3	2016.014171	2016.012166	K	E	183	199
PSM	MASNIFGTPEENQASWAK	294	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4056.2	47.70637	3	2059.872371	2059.871057	K	S	47	65
PSM	TPEELDDSDFETEDFDVR	295	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4050.3	47.57537	3	2237.858171	2237.852550	R	S	634	652
PSM	SGSSSPDSEITELKFPSINHD	296	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4048.2	47.52547	3	2326.005371	2326.000217	R	-	571	592
PSM	QLSSTSPLAPYPTSQMVSSDR	297	sp|Q6UUV7|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3821.2	42.57407	3	2331.052271	2331.045393	R	S	408	429
PSM	QRSLGPSLATDKS	298	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3308.5	29.70162	2	1421.6517	1421.6546	R	-	268	281
PSM	SGDEMIFDPTMSK	299	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4562.2	53.93752	2	1578.6029	1578.5978	M	K	2	15
PSM	QLSILVHPDKNQDDADR	300	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4098.2	48.34315	3	2025.9179	2025.9152	R	A	79	96
PSM	ASQSQGIQQLLQAEK	301	sp|O75348|VATG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4513.2	53.48837	3	1749.8317	1749.8293	M	R	2	17
PSM	QAGSLASLSDAPPLK	302	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.4137.2	48.85007	2	1516.7187	1516.7169	K	S	276	291
PSM	QASTDAGTAGALTPQHVR	303	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3296.4	29.3984	3	1842.8278	1842.8256	R	A	107	125
PSM	SSIGTGYDLSASTFSPDGR	304	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4412.3	52.31553	3	2038.8539	2038.8516	M	V	2	21
PSM	SDAAVDTSSEITTK	305	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3314.5	29.85083	2	1545.6445	1545.6442	M	D	2	16
PSM	SRSYNDELQFLEK	306	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4033.2	47.24358	3	1749.7637	1749.7606	M	I	2	15
PSM	KTSFGSLKDEDR	307	sp|P49821|NDUV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2998.3	21.90838	3	1461.648371	1461.650089	K	I	29	41
PSM	LARASGNYATVISHNPETK	308	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3186.2	26.67055	4	2108.004494	2108.005183	K	K	126	145
PSM	NSSISGPFGSR	309	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3294.5	29.35015	2	1187.497047	1187.497217	R	S	483	494
PSM	KKESILDLSK	310	sp|Q9UK45|LSM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3121.3	25.03352	2	1239.645447	1239.647570	K	Y	8	18
PSM	KITIADCGQLE	311	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3303.3	29.5687	2	1246.621047	1246.622738	K	-	155	166
PSM	RLSEDYGVLK	312	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3307.4	29.67302	2	1258.596447	1258.595869	R	T	110	120
PSM	RKFSMEPGDEDLDCDNDHVSK	313	sp|Q14135|VGLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3176.5	26.42098	4	2573.023294	2573.019983	K	M	56	77
PSM	DNNQFASASLDR	314	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3199.3	26.97668	2	1336.598447	1336.600757	K	T	154	166
PSM	SRSHTSEGAHLDITPNSGAAGNSAGPK	315	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3027.6	22.6586	4	2698.212894	2698.209650	R	S	362	389
PSM	RALANSLACQGK	316	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2937.6	20.46803	2	1367.638247	1367.638085	K	Y	331	343
PSM	SFTPDHVVYAR	317	sp|Q6NZI2|CAVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3342.4	30.56432	2	1370.603447	1370.602017	K	S	300	311
PSM	DMRQTVAVGVIK	318	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3351.2	30.78993	3	1395.693971	1395.694537	R	A	428	440
PSM	SLSPQEDALTGSR	319	sp|Q96EN8|MOCOS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3303.4	29.57203	2	1439.628447	1439.629354	R	V	528	541
PSM	GASQAGMTGYGMPR	320	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3096.5	24.40933	2	1478.566047	1478.568351	R	Q	183	197
PSM	VRYSLDPENPTK	321	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3246.2	28.11878	3	1497.6865	1497.6859	M	S	2	14
PSM	KQSSSEISLAVER	322	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3241.2	27.99103	3	1512.709571	1512.718503	R	A	454	467
PSM	NRESYEVSLTQK	323	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3118.2	24.95412	3	1532.685371	1532.687203	K	T	206	218
PSM	DFSLTSSSQTPGATK	324	sp|Q9NZ53|PDXL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3384.6	31.6272	2	1605.691447	1605.692348	R	S	205	220
PSM	VRQASVADYEETVK	325	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3166.2	26.1536	3	1673.767871	1673.766182	R	K	80	94
PSM	GGSVLVTCSTSCDQPK	326	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3169.4	26.23758	3	1774.731671	1774.726702	R	L	41	57
PSM	GGSVLVTCSTSCDQPK	327	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3161.5	26.03557	3	1774.731671	1774.726702	R	L	41	57
PSM	RSSSVVSAEMSGCSSK	328	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3079.3	23.97015	3	1817.670671	1817.672632	R	S	291	307
PSM	LGPKSSVLIAQQTDTSDPEK	329	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3334.5	30.36172	3	2193.061571	2193.056610	R	V	449	469
PSM	LGPKSSVLIAQQTDTSDPEK	330	sp|P46060|RAGP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3342.5	30.56765	3	2193.061571	2193.056610	R	V	449	469
PSM	TRSWDSSSPVDRPEPEAASPTTR	331	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3180.5	26.52458	4	2608.154894	2608.155489	R	T	352	375
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	332	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2971.6	21.24578	4	3188.318894	3188.312914	K	K	97	126
PSM	DASLMVTNDGATILK	333	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3707.4	39.75243	3	1643.748071	1643.747755	R	N	58	73
PSM	KLSSKGSFADLGLEPR	334	sp|Q9NUL7|DDX28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3597.5	36.97569	3	1863.853871	1863.853296	R	V	121	137
PSM	VKNSLLSLSDT	335	sp|Q7L2H7|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3634.4	37.9295	2	1255.605847	1255.606099	K	-	364	375
PSM	DSPSVWAAVPGK	336	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3634.5	37.93283	2	1292.579847	1292.580219	K	T	27	39
PSM	SLEDQVEMLR	337	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3755.4	40.96872	2	1298.556647	1298.557769	K	T	168	178
PSM	SLSLGEVLDGDR	338	sp|O15321|TM9S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4253.2	50.56113	2	1339.602447	1339.602076	K	M	76	88
PSM	NSVSQISVLSGGK	339	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3487.6	34.22728	2	1354.647447	1354.649361	K	A	327	340
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	340	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3656.3	38.46897	4	2861.128094	2861.124466	R	L	22	47
PSM	SLYESFVSSSDR	341	sp|P18615|NELFE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3703.5	39.65351	2	1455.593047	1455.591906	K	L	131	143
PSM	RASSLNVLNVGGK	342	sp|Q07866-4|KLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3585.5	36.70288	2	1473.673247	1473.674210	K	A	597	610
PSM	SSLSGDEEDELFK	343	sp|Q5T1M5|FKB15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3691.5	39.34883	2	1534.609247	1534.607615	R	G	1161	1174
PSM	GYSFSLTTFSPSGK	344	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4261.4	50.68585	2	1557.679047	1557.675241	R	L	5	19
PSM	DYSAPVNFISAGLK	345	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4727.2	55.47282	3	1560.728471	1560.722526	R	K	73	87
PSM	SIQFVDWCPTGFK	346	sp|P68363|TBA1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.4760.2	55.74877	2	1663.714647	1663.710581	R	V	340	353
PSM	SNSELEDEILCLEK	347	sp|Q8IX94|CTGE4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.4571.3	54.0482	3	1757.747171	1757.743063	R	D	138	152
PSM	NSVTPDMMEEMYKK	348	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	36.84172	3	1781.710571	1781.707546	K	A	229	243
PSM	GADFLVTEVENGGSLGSK	349	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4051.3	47.5903	3	1858.836071	1858.834990	K	K	189	207
PSM	IRYESLTDPSKLDSGK	350	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3455.5	33.43932	3	1887.898271	1887.897924	K	E	54	70
PSM	NGSVVAMTGDGVNDAVALK	351	sp|P98194|AT2C1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3767.4	41.26173	3	1896.867071	1896.865244	K	A	635	654
PSM	TMQGEGPQLLLSEAVSR	352	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4207.2	49.96968	3	1910.883671	1910.880894	K	A	1053	1070
PSM	DAPTHLPSVDLSNPFTK	353	sp|Q5VT52|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4167.2	49.28525	3	1917.888371	1917.887359	R	E	1230	1247
PSM	HSNSNSVDDTIVALNMR	354	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3635.5	37.95887	3	1951.848371	1951.845905	K	A	678	695
PSM	NASTFEDVTQVSSAYQK	355	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3733.6	40.40865	3	1953.838571	1953.835718	K	T	320	337
PSM	TKFGSTADALVSDDETTR	356	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3488.5	34.24977	3	1992.868871	1992.867746	K	L	277	295
PSM	SLSQPTPPPMPILSQSEAK	357	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4008.5	46.83725	3	2087.004671	2087.001009	K	N	6967	6986
PSM	SSILLDVKPWDDETDMAK	358	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4165.2	49.22486	3	2141.962871	2141.959204	K	L	140	158
PSM	DNLTLWTSDMQGDGEEQNK	359	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3860.5	43.51733	3	2179.937171	2179.932792	R	E	226	245
PSM	SDSSSKKDVIELTDDSFDK	360	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3550.5	35.81238	3	2194.954571	2194.951870	R	N	154	173
PSM	NQSQGYNQWQQGQFWGQK	361	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3864.4	43.62245	3	2290.959671	2290.954545	K	P	797	815
PSM	DNLTLWTADNAGEEGGEAPQEPQS	362	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4006.3	46.7907	3	2528.101571	2528.093920	R	-	225	249
PSM	RKDSSEESDSSEESDIDSEASSALFMAK	363	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3791.4	41.8722	4	3116.270094	3116.265295	R	K	338	366
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	364	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3693.4	39.40355	4	3205.408494	3205.398315	R	S	38	70
PSM	SGDEMIFDPTMSK	365	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4602.2	54.3512	2	1578.6013	1578.5978	M	K	2	15
PSM	SGDEMIFDPTMSK	366	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.4128.2	48.7186	2	1594.5949	1594.5927	M	K	2	15
PSM	QVQSLTCEVDALK	367	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4648.2	54.74623	2	1552.6871	1552.6839	R	G	322	335
PSM	RGSLEMSSDGEPLSR	368	sp|Q6ZN18|AEBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2997.4	21.88618	3	1715.716271	1715.718580	R	M	204	219
PSM	RRNSCNVGGGGGGFK	369	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2797.2	17.26602	3	1601.689271	1601.688223	K	H	149	164
PSM	DHASIQMNVAEVDK	370	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3360.3	31.01933	3	1635.698771	1635.696387	K	V	28	42
PSM	KGSFSALVGR	371	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3297.3	29.4209	2	1100.536247	1100.537960	R	T	8	18
PSM	SFAGNLNTYK	372	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3370.2	31.27368	2	1193.510647	1193.511805	R	R	386	396
PSM	RASAYEALEK	373	sp|Q15785|TOM34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3024.5	22.57793	2	1216.547047	1216.548919	R	Y	91	101
PSM	RLSEDYGVLK	374	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3316.2	29.89	2	1258.596447	1258.595869	R	T	110	120
PSM	RASAAAAAGGGATGHPGGGQGAENPAGLK	375	sp|Q07617|SPAG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2962.4	21.00653	4	2538.174894	2538.172476	R	S	421	450
PSM	EALQDVEDENQ	376	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3129.6	25.24975	2	1288.540847	1288.541905	K	-	245	256
PSM	TLRGSFSSTAAQDAQGQR	377	sp|Q86V85|GP180_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3106.4	24.66125	3	1959.878771	1959.879983	K	I	24	42
PSM	VIGSGCNLDSAR	378	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3116.3	24.90792	2	1327.557247	1327.559166	R	F	158	170
PSM	SGSSPGLRDGSGTPSRHSLSGSSPGMK	379	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,18-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.2919.3	20.00478	4	2761.149694	2761.152803	R	D	1441	1468
PSM	SCVEEPEPEPEAAEGDGDK	380	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3097.5	24.4341	3	2123.784971	2123.787841	K	K	107	126
PSM	RQQSEISAAVER	381	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3013.2	22.28407	3	1452.672371	1452.672222	R	A	450	462
PSM	GASQAGMTGYGMPR	382	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3141.6	25.55557	2	1478.564847	1478.568351	R	Q	183	197
PSM	NRVIGSGCNLDSAR	383	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2965.2	21.07755	3	1517.736971	1517.736873	K	F	156	170
PSM	SAADSISESVPVGPK	384	sp|P45974|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3407.4	32.211	2	1522.690247	1522.691620	R	V	779	794
PSM	VPSPLEGSEGDGDTD	385	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3382.3	31.56813	2	1553.577447	1553.577043	K	-	413	428
PSM	NGSEADIDEGLYSR	386	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3408.5	32.2398	2	1604.636647	1604.635561	K	Q	44	58
PSM	RNQSFCPTVNLDK	387	sp|P46776|RL27A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3302.2	29.54027	3	1657.732271	1657.728357	K	L	65	78
PSM	RASSDLSIASSEEDK	388	sp|Q9H2G2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3078.6	23.95425	2	1673.712447	1673.714540	K	L	338	353
PSM	ERSDSGGSSSEPFDR	389	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2927.6	20.2095	3	1691.638571	1691.642438	R	H	757	772
PSM	RSSDGSLSHEEDLAK	390	sp|Q13136|LIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2955.3	20.82902	3	1709.726471	1709.725773	K	V	237	252
PSM	NLDIERPTYTNLNR	391	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3380.3	31.51905	3	1717.875371	1717.874747	R	L	216	230
PSM	RVSISEGDDKIEYR	392	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3183.5	26.60262	3	1745.796671	1745.798544	K	A	122	136
PSM	DRKESLDVYELDAK	393	sp|Q13510|ASAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3391.3	31.79512	3	1759.800671	1759.802961	R	Q	297	311
PSM	KQSFDDNDSEELEDK	394	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3054.5	23.3337	3	1877.721071	1877.720413	K	D	105	120
PSM	KNSSQDDLFPTSDTPR	395	sp|Q9H6T3|RPAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3355.4	30.89678	3	1886.809271	1886.804752	K	A	478	494
PSM	RTSSTLDSEGTFNSYRK	396	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3118.4	24.96078	3	2027.890871	2027.894964	R	E	41	58
PSM	RATAESASECLPCDCNGR	397	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3011.4	22.23938	3	2132.804171	2132.807489	R	S	330	348
PSM	RTNPPGGKGSGIFDESTPVQTR	398	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3240.2	27.96585	4	2380.120894	2380.117253	K	Q	60	82
PSM	KPTDGASSSNCVTDISHLVR	399	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3498.3	34.49272	4	2222.998494	2222.999112	R	K	698	718
PSM	SADTLWDIQK	400	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3571.3	36.34177	2	1175.582447	1175.582253	K	D	320	330
PSM	SIFAQEIAAR	401	sp|Q9BWH6|RPAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3625.2	37.68979	2	1184.558047	1184.559089	R	R	150	160
PSM	SIYYITGESK	402	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3447.3	33.2327	2	1239.541247	1239.542436	K	E	258	268
PSM	SADTLWDIQK	403	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3737.4	40.5058	2	1255.548647	1255.548584	K	D	320	330
PSM	SYSSPDITQAIQEEEK	404	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3779.4	41.56542	3	1903.810571	1903.808834	R	R	716	732
PSM	NDSWGSFDLR	405	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3943.2	45.4871	2	1275.494447	1275.492132	R	A	650	660
PSM	SYLYPSTLVR	406	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3776.2	41.49235	2	1277.605647	1277.605705	K	T	931	941
PSM	RLSSVMTIVK	407	sp|Q9HC36|MRM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	44.7184	2	1292.599447	1292.596477	R	S	103	113
PSM	DMGSVALDAGTAK	408	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3433.3	32.86997	2	1314.551247	1314.552683	K	D	298	311
PSM	KISGGSVVEMQGDEMTR	409	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3465.3	33.67167	3	1982.784371	1982.787995	K	I	4	21
PSM	SLAALSQIAYQR	410	sp|Q05682-3|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3915.3	44.77787	2	1399.688047	1399.686081	R	N	12	24
PSM	SINKLDSPDPFK	411	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3487.3	34.21729	3	1439.666771	1439.669762	R	L	790	802
PSM	SLVDLTAVDVPTR	412	sp|O75489|NDUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4058.3	47.75611	2	1464.724647	1464.722526	K	Q	110	123
PSM	QAGSLASLSDAPPLK	413	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3682.4	39.12029	2	1533.743247	1533.743990	K	S	276	291
PSM	MLAESDESGDEESVSQTDKTELQNTLR	414	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3609.2	37.28887	4	3091.326094	3091.317665	K	T	186	213
PSM	TNSMQQLEQWIK	415	sp|Q9HAU0|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4280.2	51.01055	3	1584.707171	1584.700745	R	I	408	420
PSM	SLGEIPIVESEIKK	416	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3880.2	43.99992	3	1620.840371	1620.837556	R	E	482	496
PSM	KQSLGELIGTLNAAK	417	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3941.2	45.42305	3	1621.846271	1621.844038	R	V	56	71
PSM	RNSEGSELSCTEGSLTSSLDSR	418	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3594.4	36.8968	3	2451.023471	2451.022092	R	R	1667	1689
PSM	NLGSINTELQDVQR	419	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3788.3	41.78543	3	1665.775571	1665.772330	R	I	134	148
PSM	DYSAPVNFISAGLKK	420	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4089.2	48.2133	3	1688.821271	1688.817489	R	G	73	88
PSM	AMSEVTSLHEDDWR	421	sp|Q86X29|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3644.2	38.16288	3	1754.699771	1754.697116	R	S	430	444
PSM	SLSTSGESLYHVLGLDK	422	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4669.2	54.94912	3	1884.890171	1884.887025	R	N	8	25
PSM	SIYGEKFEDENFILK	423	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3980.3	46.2629	3	1910.876771	1910.870312	K	H	77	92
PSM	VQSTADIFGDEEGDLFK	424	sp|Q641Q2|WAC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4644.2	54.70257	3	1949.831771	1949.829570	K	E	476	493
PSM	SLGYAYVNFQQPADAER	425	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3905.2	44.55885	3	2007.877571	2007.872772	R	A	51	68
PSM	TSDANETEDHLESLICK	426	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3784.4	41.68577	3	2040.838571	2040.834732	K	V	21	38
PSM	TSRAPSVATVGSICDLNLK	427	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3723.4	40.17015	3	2067.999671	2068.002406	R	I	2102	2121
PSM	DNLTLWTSDQQDEEAGEGN	428	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3920.2	44.90363	3	2120.882471	2120.877051	R	-	228	247
PSM	SVSSFPVPQDNVDTHPGSGK	429	sp|Q676U5|A16L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3426.4	32.70137	3	2133.934871	2133.936829	R	E	287	307
PSM	NPSTVEAFDLAQSNSEHSR	430	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3491.4	34.32281	3	2167.919771	2167.917156	R	H	213	232
PSM	SVVSLKNEEENENSISQYK	431	sp|P82673|RT35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3422.6	32.60478	3	2276.022371	2276.020953	K	E	295	314
PSM	DNLTLWTSDTQGDEAEAGEGGEN	432	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3982.3	46.3197	3	2407.998371	2407.988786	R	-	223	246
PSM	QQSEISAAVER	433	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3671.4	38.8437	2	1279.5435	1279.5440	R	A	451	462
PSM	QRSLGPSLATDKS	434	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3069.2	23.70735	3	1439.679671	1438.681724	R	-	268	281
PSM	ASGVAVSDGVIK	435	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3655.4	38.44392	2	1223.5770	1223.5794	M	V	2	14
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	436	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3553.5	35.88977	4	3431.366094	3431.356309	R	E	62	93
PSM	QAGSLASLSDAPPLK	437	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.4120.2	48.62978	2	1516.7187	1516.7169	K	S	276	291
PSM	CASCPYLGMPAFKPGEK	438	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.4194.2	49.75617	3	1974.8101	1974.8074	R	V	285	302
PSM	ADHSFSDGVPSDSVEAAK	439	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3415.5	32.4207	3	1939.7840	1939.7832	M	N	2	20
PSM	ADHSFSDGVPSDSVEAAK	440	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3423.4	32.62393	3	1939.7840	1939.7832	M	N	2	20
PSM	QAGSVGGLQWCGEPK	441	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3919.4	44.87162	2	1635.6781	1635.6747	R	R	190	205
PSM	SCINLPTVLPGSPSK	442	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4637.2	54.62312	3	1690.8034	1690.7996	M	T	2	17
PSM	MESALDQLK	443	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3262.3	28.53502	2	1129.469847	1129.472642	R	Q	11	20
PSM	MESALDQLK	444	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3254.3	28.32858	2	1129.469847	1129.472642	R	Q	11	20
PSM	KLSQMILDK	445	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3380.4	31.52238	2	1154.576847	1154.577048	R	K	364	373
PSM	RGSDIIIVGR	446	sp|P11172|UMPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3285.4	29.1139	2	1164.601847	1164.601623	K	G	442	452
PSM	SQGMALSLGDK	447	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3148.2	25.7219	2	1201.502447	1201.505005	K	I	933	944
PSM	SQGMALSLGDK	448	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3156.3	25.92582	2	1201.503847	1201.505005	K	I	933	944
PSM	SASWGSADQLK	449	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3314.4	29.8475	2	1228.512247	1228.512533	R	E	221	232
PSM	KDSLSVNEFK	450	sp|Q99584|S10AD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3270.3	28.73483	2	1245.564247	1245.564234	R	E	30	40
PSM	AQALRDNSTMGYMMAK	451	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=1.1.3014.5	22.32002	3	1898.772671	1898.772606	K	K	481	497
PSM	RFSEGVLQSPSQDQEK	452	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3262.4	28.53835	3	1913.852471	1913.852037	R	L	427	443
PSM	GGSGSGPTIEEVD	453	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3346.3	30.66353	2	1283.492447	1283.491857	K	-	629	642
PSM	NSLTGEEGQLAR	454	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3200.3	27.0009	2	1353.591247	1353.592574	R	V	111	123
PSM	VTDSSVSVQLRE	455	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3277.5	28.91265	2	1398.640047	1398.639190	R	-	264	276
PSM	GILAADESTGSIAK	456	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3366.5	31.18072	2	1411.659047	1411.659591	K	R	29	43
PSM	IPGEKDSVICLK	457	sp|P08174|DAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3345.2	30.6345	3	1437.696071	1437.693869	K	G	72	84
PSM	LYRPGSVAYVSR	458	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3260.2	28.48042	3	1446.699371	1446.702065	K	S	651	663
PSM	GASQAGMTGYGMPR	459	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=1.1.2894.2	19.40805	2	1494.560847	1494.563266	R	Q	183	197
PSM	KRTSMETALALEK	460	sp|Q8NEZ5|FBX22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3171.2	26.28255	3	1556.769971	1556.763345	R	L	125	138
PSM	LQSIGTENTEENR	461	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3004.6	22.06678	2	1569.663447	1569.667196	R	R	44	57
PSM	GASWIDTADGSANHR	462	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3333.2	30.32597	3	1636.665371	1636.663113	R	A	254	269
PSM	ERESLQQMAEVTR	463	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2943.2	20.59767	2	1671.729047	1671.728751	K	E	123	136
PSM	TDYNASVSVPDSSGPER	464	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3257.2	28.40285	3	1859.755271	1859.757467	R	I	70	87
PSM	QASTDAGTAGALTPQHVR	465	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3085.2	24.12167	4	1859.850094	1859.852705	R	A	107	125
PSM	GEAAAERPGEAAVASSPSK	466	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2866.2	18.75682	3	1863.831971	1863.836387	K	A	12	31
PSM	AQALRDNSTMGYMMAK	467	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.3380.6	31.52905	3	1898.773571	1898.772606	K	K	481	497
PSM	TASETRSEGSEYEEIPK	468	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3154.6	25.8872	3	1991.837471	1991.836112	R	R	1083	1100
PSM	SPPREGSQGELTPANSQSR	469	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2895.3	19.43313	3	2076.923771	2076.922576	K	M	468	487
PSM	SGSTSSLSYSTWTSSHSDK	470	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3375.3	31.39683	3	2083.838771	2083.837174	R	T	197	216
PSM	INSSGESGDESDEFLQSRK	471	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3231.4	27.75312	3	2163.900071	2163.895752	R	G	180	199
PSM	LARASGNYATVISHNPETKK	472	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3101.5	24.536	3	2236.098971	2236.100146	K	T	126	146
PSM	HQGVMVGMGQKDSYVGDEAQSK	473	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3038.3	22.92262	4	2446.034494	2446.029426	R	R	42	64
PSM	SGVGNIFIK	474	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3723.2	40.15682	2	1013.492847	1013.494698	K	N	96	105
PSM	TGSLQLICK	475	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3429.2	32.7673	2	1098.512447	1098.514448	K	S	175	184
PSM	MESALDQLK	476	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3468.2	33.74422	2	1113.476847	1113.477727	R	Q	11	20
PSM	RLSSASTGKPPLSVEDDFEK	477	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3444.2	33.15145	4	2242.050494	2242.051859	R	L	756	776
PSM	SWCPDCVQAEPVVR	478	sp|Q9BRA2|TXD17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3642.3	38.11438	3	1781.728571	1781.726642	K	E	41	55
PSM	SYDYEAWAK	479	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3632.4	37.87772	2	1211.453647	1211.453621	K	L	87	96
PSM	NDSWGSFDLR	480	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3935.3	45.28397	2	1275.494447	1275.492132	R	A	650	660
PSM	AFSDPFVEAEK	481	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3839.4	42.99683	2	1318.551847	1318.548250	R	S	74	85
PSM	SLSLGEVLDGDR	482	sp|O15321|TM9S1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4237.3	50.34878	2	1339.602447	1339.602076	K	M	76	88
PSM	SESVEGFLSPSR	483	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3712.6	39.88737	2	1373.585647	1373.586426	R	C	1311	1323
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	484	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3664.4	38.67863	4	2861.128094	2861.124466	R	L	22	47
PSM	STGGAPTFNVTVTK	485	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3513.6	34.89098	2	1458.675047	1458.675576	K	T	92	106
PSM	TTPSVVAFTADGER	486	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3551.4	35.83462	2	1529.677047	1529.676304	R	L	86	100
PSM	TLTTVQGIADDYDK	487	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3743.4	40.6606	3	1618.712471	1618.712749	K	K	43	57
PSM	SFVCFGDDGEPQLK	488	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3916.5	44.80278	2	1677.678247	1677.674590	R	E	1029	1043
PSM	NRPTSISWDGLDSGK	489	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3564.3	36.16562	3	1711.753571	1711.756680	K	L	48	63
PSM	NRPTSISWDGLDSGK	490	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3572.4	36.36962	2	1711.758447	1711.756680	K	L	48	63
PSM	SASQSSLDKLDQELK	491	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3538.6	35.51788	2	1727.796647	1727.797876	R	E	728	743
PSM	DASDDLDDLNFFNQK	492	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4484.2	53.23613	3	1755.760271	1755.758774	K	K	65	80
PSM	DRFSAEDEALSNIAR	493	sp|Q9Y608|LRRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3755.2	40.96205	3	1772.773271	1772.773058	K	E	15	30
PSM	SDSFENPVLQQHFR	494	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3669.2	38.78738	3	1782.771071	1782.772664	R	N	475	489
PSM	DRSSFYVNGLTLGGQK	495	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3754.6	40.95028	2	1820.848447	1820.845829	K	C	55	71
PSM	TMQGEGPQLLLSEAVSR	496	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4425.2	52.5648	3	1894.888871	1894.885979	K	A	1053	1070
PSM	SESLDPDSSMDTTLILK	497	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4136.2	48.81487	3	1930.851671	1930.848256	R	D	879	896
PSM	ENRESLVVNYEDLAAR	498	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3705.2	39.69445	3	1956.895571	1956.894236	K	E	225	241
PSM	KATWYTLTVPGDSPCAR	499	sp|Q7Z6M1|RABEK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3756.5	40.99705	3	2001.902171	2001.901964	R	V	15	32
PSM	RLSEGQEEENLENEMK	500	sp|Q15276|RABE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3441.4	33.0802	3	2013.834671	2013.835066	R	K	160	176
PSM	GSSGVGLTAAVTTDQETGER	501	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3469.6	33.77805	3	2014.882871	2014.884459	R	R	372	392
PSM	SQSLPNSLDYTQTSDPGR	502	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3503.5	34.6285	3	2044.877771	2044.873894	R	H	44	62
PSM	KQTIDNSQGAYQEAFDISK	503	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	35.9672	3	2221.994471	2221.989258	R	K	139	158
PSM	NQSQGYNQWQQGQFWGQK	504	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3856.5	43.41905	3	2290.959671	2290.954545	K	P	797	815
PSM	DNLTLWTSENQGDEGDAGEGEN	505	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3906.2	44.58277	3	2349.949871	2349.946922	R	-	225	247
PSM	SYDVPPPPMEPDHPFYSNISK	506	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3863.3	43.59042	3	2496.076271	2496.070880	R	D	118	139
PSM	DDDIAALVVDNGSGMCK	507	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4570.3	54.02353	2	1820.7977	1820.7915	M	A	2	19
PSM	VNQIGSVTESLQACK	508	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3549.2	35.77713	3	1712.776871	1712.780452	K	L	344	359
PSM	CSVLAAANPVYGR	509	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.4252.2	50.53596	2	1439.6277	1439.6263	R	Y	446	459
PSM	SLSNKLTLDK	510	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	35.20612	2	1239.6104	1239.6107	M	L	2	12
PSM	GDRSEDFGVNEDLADSDAR	511	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3437.5	32.9797	3	2146.844771	2146.844051	K	A	186	205
PSM	QLSSGVSEIR	512	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3712.4	39.8807	2	1137.5045	1137.5062	R	H	80	90
PSM	SGVGNVFIK	513	sp|Q13310|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3535.3	35.43188	2	1000.480847	999.479048	K	N	96	105
PSM	AERGYSFSLTTFSPSGK	514	sp|P25787|PSA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4279.3	50.9855	3	1955.8702	1955.8661	M	L	2	19
PSM	STGTFVVSQPLNYR	515	sp|P49189|AL9A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4259.3	50.63625	2	1689.7793	1689.7758	M	G	2	16
PSM	SLSDWHLAVK	516	sp|Q96S82|UBL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4103.2	48.41095	2	1276.5865	1276.5848	M	L	2	12
PSM	RVSHQGYSTEAEFEEPR	517	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3125.2	25.1337	4	2100.884894	2100.890213	R	V	240	257
PSM	ALRTDYNASVSVPDSSGPER	518	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3314.2	29.84083	4	2199.981694	2199.979756	K	I	67	87
PSM	SLDQDPVVR	519	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3141.4	25.5489	2	1107.493847	1107.496155	K	A	773	782
PSM	TKPYIQVDIGGGQTK	520	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3405.2	32.15308	3	1683.822071	1683.823303	K	T	124	139
PSM	RMSVTEGGIKYPETTEGGRPK	521	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3151.4	25.80433	4	2372.1176941913204	2372.1195607479494	K	L	33	54
PSM	GHTDSVQDISFDHSGK	522	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3109.3	24.73517	3	1808.741471	1808.736672	K	L	148	164
PSM	DYRQSSGASSSSFSSSR	523	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2913.5	19.85335	3	1874.742371	1874.743214	R	A	601	618
PSM	LKSEDGVEGDLGETQSR	524	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3126.3	25.16293	3	1898.822771	1898.825881	R	T	133	150
PSM	DNSTMGYMAAK	525	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3179.5	26.4985	2	1267.457647	1267.461425	R	K	621	632
PSM	TRSIGSAVDQGNESIVAK	526	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3253.3	28.30272	3	1910.908871	1910.909886	K	T	201	219
PSM	KSIDTGMGLER	527	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3136.5	25.42327	2	1285.572647	1285.573753	K	L	236	247
PSM	ELISNSSDALDK	528	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3179.6	26.50183	2	1290.624247	1290.630326	R	I	47	59
PSM	GRLSKEEIER	529	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2869.2	18.83303	2	1295.618647	1295.623480	K	M	508	518
PSM	RVSISEGDDKIEYR	530	sp|P22087|FBRL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3185.2	26.6446	4	1745.797694	1745.798544	K	A	122	136
PSM	SSSEDAESLAPR	531	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3091.5	24.28643	2	1327.523847	1327.529305	R	S	298	310
PSM	SVSLTGAPESVQK	532	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3236.3	27.87118	2	1381.649047	1381.649027	R	A	191	204
PSM	DMRQTVAVGVIK	533	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3351.4	30.7966	2	1395.695247	1395.694537	R	A	428	440
PSM	NMSVIAHVDHGK	534	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2910.4	19.77302	3	1402.606271	1402.606451	R	S	21	33
PSM	RLSEGQEEENLENEMKK	535	sp|Q15276|RABE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3346.5	30.6702	3	2141.930471	2141.930029	R	A	160	177
PSM	ISVREPMQTGIK	536	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3122.4	25.06278	3	1453.698671	1453.700017	R	A	183	195
PSM	SRSSSPVTELASR	537	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3159.2	25.97978	2	1455.669247	1455.671887	R	S	1099	1112
PSM	RKSELEFETLK	538	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3239.4	27.9476	3	1458.708671	1458.711961	K	T	260	271
PSM	RKGTEVQVDDIK	539	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2922.6	20.08053	3	1466.713271	1466.713024	K	R	416	428
PSM	AMSTTSISSPQPGK	540	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3101.4	24.53267	2	1470.640647	1470.642561	R	L	267	281
PSM	GASQAGMTGYGMPR	541	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3088.6	24.21258	2	1478.566047	1478.568351	R	Q	183	197
PSM	AHSSMVGVNLPQK	542	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3340.5	30.51588	2	1526.637247	1526.635381	R	A	172	185
PSM	VPSPLEGSEGDGDTD	543	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3391.5	31.80178	2	1553.577447	1553.577043	K	-	413	428
PSM	KRSSTLSQLPGDK	544	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3022.3	22.51938	3	1575.703871	1575.705904	K	S	591	604
PSM	ALSRQLSSGVSEIR	545	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3388.2	31.71425	3	1581.785771	1581.787586	R	H	76	90
PSM	RKSELPQDVYTIK	546	sp|Q14738|2A5D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3227.2	27.64498	3	1655.830871	1655.828388	R	A	571	584
PSM	RLSSSSATLLNSPDR	547	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3266.4	28.64087	3	1682.798471	1682.798879	K	A	198	213
PSM	SRKESYSIYVYK	548	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3331.2	30.27438	3	1681.719371	1681.715406	R	V	33	45
PSM	RGSLCSGCQKPITGR	549	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2868.3	18.80768	3	1755.787271	1755.790974	R	C	531	546
PSM	SASLSSAATTGLTTQQR	550	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	30.58355	3	1758.814871	1758.814923	R	T	3740	3757
PSM	DRKESLDVYELDAK	551	sp|Q13510|ASAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3395.2	31.89497	4	1759.801694	1759.802961	R	Q	297	311
PSM	QQNRPSVITCASAGAR	552	sp|Q14135|VGLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3031.4	22.75568	3	1794.818471	1794.819631	R	N	158	174
PSM	AQALRDNSTMGYMAAK	553	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3202.4	27.05342	3	1806.781271	1806.779406	K	K	616	632
PSM	SVLGEADQKGSLVAPDR	554	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3320.5	30.0019	3	1820.867771	1820.866958	R	L	617	634
PSM	ENPRNFSDNQLQEGK	555	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3052.4	23.27972	3	1854.787271	1854.789771	K	N	157	172
PSM	ARIYSSDSDEGSEEDK	556	sp|Q8WVC0|LEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2883.3	19.13445	3	1866.726671	1866.715662	R	A	603	619
PSM	VRLSNKVEAIDVEEAK	557	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3325.3	30.12375	3	1878.944171	1878.945209	K	R	747	763
PSM	KLESTESRSSFSQHAR	558	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2817.2	17.69972	4	1928.878094	1928.874169	R	T	420	436
PSM	KGSSGNASEVSVACLTER	559	sp|Q69YQ0|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3361.2	31.04195	3	1930.845971	1930.845571	R	I	382	400
PSM	KSSTVATLQGTPDHGDPR	560	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2962.5	21.00987	3	1945.887671	1945.889485	R	T	154	172
PSM	SRSRDSGDENEPIQER	561	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2800.2	17.35098	3	1953.816971	1953.817776	R	F	1116	1132
PSM	SSGGSEHSTEGSVSLGDGQLNR	562	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3172.5	26.31803	3	2239.932071	2239.934263	R	Y	381	403
PSM	RRSIQDLTVTGTEPGQVSSR	563	sp|O43318|M3K7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3224.3	27.57862	3	2266.110071	2266.106688	R	S	437	457
PSM	IVRGDQPAASGDSDDDEPPPLPR	564	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3280.6	28.99108	3	2483.098571	2483.096577	K	L	45	68
PSM	HGSLGFLPR	565	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3471.2	33.81258	2	1062.500247	1062.501180	R	K	11	20
PSM	HGSLGFLPR	566	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3480.2	34.03303	2	1062.500247	1062.501180	R	K	11	20
PSM	SVSSFPVPQDNVDTHPGSGK	567	sp|Q676U5|A16L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3423.2	32.61727	4	2133.938094	2133.936829	R	E	287	307
PSM	MESALDQLK	568	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3477.3	33.96055	2	1113.476847	1113.477727	R	Q	11	20
PSM	NMSIIDAFK	569	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4184.2	49.62662	2	1117.489447	1117.487898	R	S	617	626
PSM	ALLLLCGEDD	570	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4113.2	48.53038	2	1117.530647	1117.532526	K	-	311	321
PSM	SPSSLLEDAK	571	sp|P42684|ABL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3473.2	33.87382	2	1125.496647	1125.495486	K	E	631	641
PSM	YSVDIPLDK	572	sp|P61353|RL27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3752.4	40.89923	2	1128.509447	1128.510408	R	T	85	94
PSM	KYEMFAQTLQQSR	573	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3479.3	34.01053	3	1708.764971	1708.764407	R	G	754	767
PSM	NSPEDLGLSLTGDSCK	574	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3740.2	40.57983	3	1771.735871	1771.733561	K	L	499	515
PSM	SPSLNLLQNK	575	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3610.3	37.31445	2	1192.585247	1192.585304	R	S	529	539
PSM	SMSAPVIFDR	576	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3787.3	41.76303	2	1201.522047	1201.520261	K	S	117	127
PSM	SADTLWDIQK	577	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3729.4	40.29855	2	1255.548647	1255.548584	K	D	320	330
PSM	SASITNLSLDR	578	sp|Q9Y2I7|FYV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3506.4	34.70313	2	1255.579847	1255.580947	R	S	305	316
PSM	GSGSVVGELMYK	579	sp|O75746|CMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3727.4	40.2474	2	1305.565847	1305.567605	R	N	359	371
PSM	RASSLNFLNK	580	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3606.4	37.2049	2	1308.563247	1308.562868	K	S	579	589
PSM	SLEDQVEMLR	581	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3580.3	36.5745	2	1314.553047	1314.552684	K	T	168	178
PSM	SADTLWDIQK	582	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.4012.3	46.91188	2	1335.516847	1335.514915	K	D	320	330
PSM	SADTLWDIQK	583	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.4002.2	46.70844	2	1335.516847	1335.514915	K	D	320	330
PSM	TAFQEALDAAGDK	584	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3545.2	35.67727	2	1335.627847	1335.630660	K	L	9	22
PSM	RDSFDDRGPSLNPVLDYDHGSR	585	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3633.5	37.90693	4	2677.100094	2677.095940	R	S	186	208
PSM	GDNITLLQSVSN	586	sp|P62304|RUXE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3919.3	44.86828	2	1339.602847	1339.602076	K	-	81	93
PSM	SFSTALYGESDL	587	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4729.2	55.52242	2	1368.552247	1368.548644	K	-	900	912
PSM	SESVEGFLSPSR	588	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3704.3	39.68207	2	1373.585647	1373.586426	R	C	1311	1323
PSM	QGTEIDGRSISLYYTGEK	589	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3668.2	38.7627	3	2095.947671	2095.946331	K	G	450	468
PSM	RNSLGGDVLFVGK	590	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3629.2	37.79368	3	1440.713171	1440.712630	R	H	676	689
PSM	STGGAPTFNVTVTK	591	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3505.6	34.68382	2	1458.675047	1458.675576	K	T	92	106
PSM	EAKNSDVLQSPLDSAARDEL	592	sp|Q8NBJ5|GT251_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3823.4	42.60477	3	2237.027171	2237.021287	R	-	603	623
PSM	RQSCYLCDLPR	593	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.3434.3	32.89568	3	1546.641971	1546.642184	R	M	13	24
PSM	ALSSDSILSPAPDAR	594	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3653.4	38.40062	2	1578.729247	1578.729068	R	A	392	407
PSM	DASLMVTNDGATILK	595	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3877.3	43.93422	3	1627.756571	1627.752840	R	N	58	73
PSM	QQFSISEDQPLGLK	596	sp|Q10571|MN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3865.3	43.64783	3	1668.776171	1668.776018	R	G	1165	1179
PSM	RSSWRVVSSIEQK	597	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	32.53967	3	1720.769171	1720.769901	R	T	56	69
PSM	SESVPPVTDWAWYK	598	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4506.2	53.41707	3	1743.756071	1743.754554	K	I	244	258
PSM	TLTTVQGIADDYDKK	599	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3558.4	36.0146	3	1746.805571	1746.807712	K	K	43	58
PSM	VVVAENFDEIVNNENK	600	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3738.5	40.53492	3	1831.895471	1831.895208	K	D	380	396
PSM	VQSTADIFGDEEGDLFK	601	sp|Q641Q2|WAC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4665.2	54.90565	3	1949.831771	1949.829570	K	E	476	493
PSM	MSLDPADLTHDTTGLTAK	602	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3966.2	45.96348	3	1965.878171	1965.875474	K	E	103	121
PSM	CASCPYLGMPAFKPGEK	603	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3715.5	39.96181	3	1991.838371	1991.834478	R	V	285	302
PSM	KHSQFIGYPITLYLEK	604	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4091.2	48.24393	3	2016.014171	2016.012166	K	E	183	199
PSM	SQSTTFNPDDMSEPEFK	605	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3775.3	41.45835	3	2038.788671	2038.786719	R	R	599	616
PSM	AIGSASEGAQSSLQEVYHK	606	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3441.5	33.08353	3	2040.917171	2040.915365	R	S	169	188
PSM	AASIENVLQDSSPEHCGR	607	sp|O60291|MGRN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3530.4	35.30817	3	2048.863871	2048.862284	R	G	513	531
PSM	TIGGGDDSFNTFFSETGAGK	608	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4269.2	50.7736	3	2086.856771	2086.852096	K	H	41	61
PSM	QNSATESADSIEIYVPEAQTR	609	sp|Q9Y2H0|DLGP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3930.3	45.1476	3	2388.057671	2388.048230	R	L	971	992
PSM	SRQPSGAGLCDISEGTVVPEDR	610	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3527.6	35.24067	3	2409.062171	2409.063169	K	C	688	710
PSM	HASSSDDFSDFSDDSDFSPSEK	611	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3651.4	38.3442	3	2487.886271	2487.886369	R	G	129	151
PSM	SRQPSGAGLCDISEGTVVPEDR	612	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3675.3	38.94523	3	2489.032871	2489.029500	K	C	688	710
PSM	DNLTLWTADNAGEEGGEAPQEPQS	613	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3995.3	46.5714	3	2528.101571	2528.093920	R	-	225	249
PSM	SASPDDDLGSSNWEAADLGNEERK	614	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3647.3	38.24202	4	2642.084094	2642.076964	R	Q	15	39
PSM	QRSLGPSLATDKS	615	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3299.4	29.4729	2	1421.6517	1421.6546	R	-	268	281
PSM	QLSILVHPDKNQDDADR	616	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4083.2	48.12843	3	2025.9179	2025.9152	R	A	79	96
PSM	QASQGMVGQLAAR	617	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3732.4	40.3826	2	1378.6063	1378.6059	R	R	41	54
PSM	SLYPSLEDLK	618	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4881.2	56.87083	2	1285.5863	1285.5838	M	V	2	12
PSM	QEGRKDSLSVNEFK	619	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=1.1.3300.2	29.49077	3	1698.7576	1698.7609	R	E	26	40
PSM	QNGQLVRNDSLVTPSPQQAR	620	sp|Q9GZY8-2|MFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,10-UNIMOD:21	ms_run[1]:scan=1.1.3472.5	33.84983	3	2270.0785	2270.0799	R	V	137	157
PSM	NNSFTAPSTVGK	621	sp|O95453|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.5	25.11777	2	1301.561247	1301.565297	R	R	555	567
PSM	KASPPSGLWSPAYASH	622	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3566.2	36.22695	3	1734.780671	1734.776687	R	-	1872	1888
PSM	QAGSVGGLQWCGEPK	623	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3927.3	45.07495	2	1635.6781	1635.6747	R	R	190	205
PSM	PGPTPSGTNVGSSGRSPSK	624	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2834.3	18.03102	3	1848.8342	1848.8362	M	A	2	21
PSM	SRDDSQLNGDSSALLNPSK	625	sp|Q9NV96|CC50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3343.3	30.58688	3	2083.923671	2082.921907	K	E	137	156
PSM	KQSLGELIGTLNAAK	626	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3841.2	43.0529	3	1622.831771	1621.844038	R	V	56	71
PSM	AASIFGGAK	627	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3243.2	28.04187	2	900.409447	900.410634	R	P	357	366
PSM	RSPSKPLPEVTDEYK	628	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3170.2	26.25695	4	1824.870094	1824.865896	R	N	91	106
PSM	SSERSSLFQTDLK	629	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	30.47992	3	1576.716671	1576.713418	K	L	1496	1509
PSM	QRGSETGSETHESDLAPSDK	630	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2838.2	18.12072	4	2209.912894	2209.912465	R	E	1103	1123
PSM	GGRGDVGSADIQDLEK	631	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3283.2	29.0554	3	1695.747071	1695.746509	K	W	250	266
PSM	YIDQEELNK	632	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3014.4	22.31668	2	1150.547047	1150.550619	K	T	198	207
PSM	QLSSGVSEIR	633	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3211.3	27.27585	2	1154.532847	1154.533268	R	H	80	90
PSM	RGGSGSHNWGTVKDELTESPK	634	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3275.5	28.86322	4	2321.042494	2321.043754	K	Y	216	237
PSM	RNSNSPPSPSSMNQR	635	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2620.2	15.75757	3	1753.719971	1753.720311	R	R	453	468
PSM	GGGGNFGPGPGSNFRGGSDGYGSGR	636	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3271.2	28.75557	4	2349.954094	2349.951250	R	G	214	239
PSM	TTSAGTGGMWR	637	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3223.3	27.55468	2	1203.475047	1203.474373	R	F	47	58
PSM	GYSFTTTAER	638	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3267.5	28.67002	2	1211.483647	1211.485984	R	E	197	207
PSM	VEIIANDQGNR	639	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3018.5	22.42277	2	1227.620047	1227.620764	R	I	50	61
PSM	KVSASVAEVQEQYTER	640	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3342.2	30.55765	3	1902.872771	1902.872438	R	L	853	869
PSM	ASIHEAWTDGK	641	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3144.5	25.63012	2	1293.535447	1293.539082	K	E	403	414
PSM	KGSSSSVCSVASSSDISLGSTKTER	642	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3255.4	28.35777	4	2596.162094	2596.168756	R	R	1382	1407
PSM	KLTFDEEAYK	643	sp|Q9BUP3|HTAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3330.4	30.25532	2	1322.577847	1322.579550	R	N	54	64
PSM	SSSEDAESLAPR	644	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3083.5	24.07992	2	1327.523847	1327.529305	R	S	298	310
PSM	NSNPALNDNLEK	645	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3030.4	22.72973	2	1327.633447	1327.636808	K	G	120	132
PSM	KKTLEEEFAR	646	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3029.2	22.69727	3	1329.637271	1329.632983	R	K	1186	1196
PSM	RAESMLQQADK	647	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3041.4	23.00048	2	1355.587447	1355.590466	K	L	336	347
PSM	NMSVIAHVDHGK	648	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3151.6	25.811	2	1386.610247	1386.611536	R	S	21	33
PSM	SPSASITDEDSNV	649	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3310.5	29.75293	2	1400.531847	1400.534450	R	-	999	1012
PSM	SPSASITDEDSNV	650	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3231.3	27.74978	2	1400.533447	1400.534450	R	-	999	1012
PSM	SIADSEESEAYK	651	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3025.6	22.6069	2	1407.541647	1407.544287	R	S	268	280
PSM	DSVFLSCSEDNR	652	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3311.4	29.77405	2	1427.602047	1427.598708	K	I	180	192
PSM	AHSSMVGVNLPQK	653	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3214.5	27.35855	2	1446.670047	1446.669050	R	A	172	185
PSM	GRLSVASTPISQR	654	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3179.2	26.4885	3	1450.729571	1450.729343	R	R	237	250
PSM	SSGPYGGGGQYFAK	655	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3324.5	30.1046	2	1454.587047	1454.586761	R	P	285	299
PSM	RTNSTFNQVVLK	656	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3289.2	29.21057	3	1485.737171	1485.734094	R	R	38	50
PSM	SRWNQDTMEQK	657	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2963.3	21.02867	3	1501.602371	1501.602093	R	T	20	31
PSM	SSQSSSQQFSGIGR	658	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3150.6	25.7855	2	1534.640647	1534.641315	R	S	671	685
PSM	NGRVEIIANDQGNR	659	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2974.3	21.31208	3	1554.786671	1554.786266	K	I	47	61
PSM	NPSTVCLCPEQPTCSNADSR	660	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3330.5	30.25865	3	2371.926071	2371.923247	R	A	37	57
PSM	QIRSSTTSMTSVPK	661	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3037.3	22.89805	3	1601.746571	1601.748423	R	P	81	95
PSM	SGRSLGTADVHFER	662	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3168.3	26.2085	3	1610.722271	1610.720234	R	K	142	156
PSM	GRLESAQATFQAHR	663	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3121.2	25.03018	3	1650.759671	1650.762768	R	D	256	270
PSM	IVRGDQPAASGDSDDDEPPPLPR	664	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3274.4	28.83517	3	2483.098571	2483.096577	K	L	45	68
PSM	RKQSSSEISLAVER	665	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3110.2	24.75727	3	1668.818771	1668.819614	R	A	453	467
PSM	AAMQRGSLPANVPTPR	666	sp|P33240|CSTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3273.2	28.8041	3	1744.843271	1744.844389	R	G	304	320
PSM	KFSDAIQSKEEEIR	667	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3244.3	28.07078	3	1758.819671	1758.818946	R	L	2214	2228
PSM	SKSVKEDSNLTLQEK	668	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2956.4	20.85828	3	1784.854271	1784.855725	K	K	1441	1456
PSM	RKLSGLEQPQGALQTR	669	sp|Q6RFH5|WDR74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3162.4	26.0573	3	1860.956171	1860.957111	K	R	358	374
PSM	KNSSQDDLFPTSDTPR	670	sp|Q9H6T3|RPAP3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3347.5	30.69615	3	1886.809271	1886.804752	K	A	478	494
PSM	DKGDEEEEGEEKLEEK	671	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2920.3	20.01958	3	1891.815371	1891.817077	K	Q	536	552
PSM	TDEFPRHGSNIEAMSK	672	sp|Q9BWD1|THIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3151.5	25.80767	3	1897.804571	1897.802978	K	L	218	234
PSM	AQALRDNSTMGYMMAK	673	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,10-UNIMOD:35,13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.2873.5	18.93177	3	1914.764771	1914.767521	K	K	481	497
PSM	EALEPSGENVIQNKESTG	674	sp|O75477|ERLN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3299.2	29.46623	3	1980.867071	1980.867746	K	-	331	349
PSM	EKGSVAEAEDCYNTALR	675	sp|O15294|OGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3263.3	28.56013	3	1991.831171	1991.829587	K	L	305	322
PSM	DDDGSSARGSFSGQAQPLR	676	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3114.3	24.85855	3	2029.850171	2029.849076	K	T	721	740
PSM	GKKQSFDDNDSEELEDK	677	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2952.6	20.76117	3	2062.837571	2062.836840	K	D	103	120
PSM	SVSNGTAKPATSENFDEDLK	678	sp|Q96K49|TM87B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3264.5	28.59228	3	2188.956671	2188.952539	K	W	494	514
PSM	DTYSDRSGSSSPDSEITELK	679	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3408.4	32.23647	3	2252.932871	2252.932197	R	F	565	585
PSM	KWSTRGSESHELNEGGDEK	680	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2938.5	20.49045	4	2304.906494	2304.904951	K	K	1041	1060
PSM	NPSTVCLCPEQPTCSNADSR	681	sp|Q9H7E9|CH033_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3338.5	30.46432	3	2371.926071	2371.923247	R	A	37	57
PSM	NQIHVKSPPREGSQGELTPANSQSR	682	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3003.5	22.03843	4	2796.328894	2796.330434	R	M	462	487
PSM	SNSAWQIYLQR	683	sp|Q8N4C8|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3938.2	45.36012	3	1444.650371	1444.650030	R	R	699	710
PSM	NVSIGIVGK	684	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3478.2	33.98197	2	965.494647	965.494698	K	D	209	218
PSM	SGVGNIFIK	685	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3715.3	39.95515	2	1013.492847	1013.494698	K	N	96	105
PSM	DSPSVWAAVPGK	686	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3549.3	35.78047	2	1212.611447	1212.613888	K	T	27	39
PSM	YGGRDYSLDEFEANK	687	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3488.4	34.24643	3	1842.747971	1842.746174	R	I	1700	1715
PSM	DGNGYISAAELR	688	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3437.4	32.97637	2	1264.604247	1264.604780	K	H	96	108
PSM	SLSALAFSPDGK	689	sp|O43379|WDR62_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3853.3	43.33945	2	1271.582447	1271.579884	K	Y	113	125
PSM	NSLGGDVLFVGK	690	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3897.2	44.36728	2	1284.611647	1284.611519	R	H	677	689
PSM	LAKLSDGVAVLK	691	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3525.4	35.18476	2	1292.709847	1292.710505	R	V	394	406
PSM	SSSGLLEWESK	692	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3741.4	40.60898	2	1301.553247	1301.554064	R	S	542	553
PSM	SLEDQVEMLR	693	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3562.3	36.11398	2	1314.552647	1314.552684	K	T	168	178
PSM	SPSISNMAALSR	694	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3552.5	35.86383	2	1312.581847	1312.584652	R	A	341	353
PSM	QSSFALLGDLTK	695	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4459.2	53.00912	2	1358.649647	1358.648298	R	A	693	705
PSM	NLSIYDGPEQR	696	sp|Q16134|ETFD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3415.6	32.42403	2	1370.586847	1370.586761	R	F	549	560
PSM	DRKESVVQEENSFSENQPFPSLK	697	sp|Q9NPB8|GPCP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3701.2	39.59363	4	2773.265694	2773.259620	K	M	420	443
PSM	AVGSISSTAFDIR	698	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3830.2	42.77312	2	1402.651247	1402.649361	K	F	704	717
PSM	DKPSVEPVEEYDYEDLK	699	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3631.5	37.85512	3	2133.901871	2133.903129	R	E	46	63
PSM	ALSLDGEQLIGNK	700	sp|O15068|MCF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3871.3	43.79332	2	1436.693647	1436.691226	R	H	410	423
PSM	TLTIVDTGIGMTK	701	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3790.5	41.84661	2	1444.687647	1444.688449	R	A	28	41
PSM	TGSYGALAEITASK	702	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3743.6	40.66727	2	1447.659447	1447.659591	K	E	443	457
PSM	TDGSISGDRQPVTVADYISR	703	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3649.4	38.29452	3	2216.016371	2216.011056	R	A	598	618
PSM	KYSDADIEPFLK	704	sp|Q14008|CKAP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3712.3	39.87737	3	1504.684571	1504.685078	K	N	1859	1871
PSM	DTYSDRSGSSSPDSEITELKFPSINHD	705	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3996.2	46.58635	4	3063.310894	3063.298250	R	-	565	592
PSM	ASSLGEIDESSELR	706	sp|Q16513|PKN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3494.6	34.40252	2	1571.671647	1571.671613	R	V	581	595
PSM	SEFGSVDGPLPHPR	707	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3511.4	34.83249	3	1573.690871	1573.692623	R	W	1702	1716
PSM	SKESVPEFPLSPPK	708	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3641.2	38.0853	3	1620.779171	1620.780041	R	K	28	42
PSM	DIIRQPSEEEIIK	709	sp|Q15121|PEA15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	35.3015	3	1648.804871	1648.807318	K	L	110	123
PSM	FASENDLPEWKER	710	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3556.3	35.96053	3	1699.725671	1699.724317	R	G	58	71
PSM	DGKYSQVLANGLDNK	711	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3487.4	34.22062	3	1700.777771	1700.777081	K	L	92	107
PSM	NRPTSISWDGLDSGK	712	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3515.3	34.93282	3	1711.756571	1711.756680	K	L	48	63
PSM	LYGPSSVSFADDFVR	713	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4393.2	52.14308	3	1738.762871	1738.760368	R	S	134	149
PSM	SSSTSDILEPFTVER	714	sp|Q6GYQ0|RGPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4200.2	49.87727	3	1746.772871	1746.771327	R	A	795	810
PSM	ALRSDSYVELSQYR	715	sp|P52298|NCBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3458.3	33.50157	3	1765.802771	1765.803630	K	D	8	22
PSM	HVPDSGATATAYLCGVK	716	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3489.4	34.27203	3	1825.803971	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	717	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3784.2	41.6791	3	1830.826271	1830.822317	R	A	107	124
PSM	SCSLDLGDAGCYGYAR	718	sp|Q6PJG9|LRFN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3706.3	39.72327	3	1843.691771	1843.690651	R	R	583	599
PSM	CIPALDSLTPANEDQK	719	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3773.2	41.40725	3	1850.815271	1850.812146	R	I	447	463
PSM	QSSMSEDSDSGDDFFIGK	720	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3823.2	42.59143	3	2030.750171	2030.745248	K	V	272	290
PSM	SSSFSSWDDSSDSYWKK	721	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3687.5	39.24775	3	2077.795871	2077.794247	R	E	365	382
PSM	DNLTLWTSDQQDEEAGEGN	722	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3928.4	45.10023	3	2120.882471	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	723	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3890.6	44.20715	3	2192.880671	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	724	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3962.2	45.88175	3	2192.880971	2192.873028	R	-	228	248
PSM	EINAREESLVEELSPASEK	725	sp|Q9BXK5|B2L13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3816.3	42.47212	3	2209.027271	2209.015139	K	K	413	432
PSM	DNLTLWTSENQGDEGDAGEGEN	726	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3889.4	44.18167	3	2349.949871	2349.946922	R	-	225	247
PSM	TCSECQELFWGDPDVECR	727	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,2-UNIMOD:4,5-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.4166.5	49.26013	3	2366.869571	2366.864335	R	A	1113	1131
PSM	DNLTLWTSDTQGDEAEAGEGGEN	728	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3963.3	45.90673	3	2407.998371	2407.988786	R	-	223	246
PSM	DSGSDEDFLMEDDDDSDYGSSK	729	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3700.6	39.58193	3	2427.867971	2427.865619	K	K	129	151
PSM	DDDIAALVVDNGSGMCK	730	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5036.2	57.99138	2	1900.7634	1900.7579	M	A	2	19
PSM	HQGVMVGMGQKDSYVGDEAQSK	731	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3192.5	26.83358	3	2462.025971	2462.024341	R	R	42	64
PSM	HQGVMVGMGQKDSYVGDEAQSK	732	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3190.3	26.77703	4	2462.024894	2462.024341	R	R	42	64
PSM	QLSILVHPDK	733	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4591.2	54.22797	2	1211.5951	1211.5946	R	N	79	89
PSM	QLSSGVSEIR	734	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3704.2	39.67207	2	1137.5045	1137.5062	R	H	80	90
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	735	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3561.4	36.09153	4	3431.366094	3431.356309	R	E	62	93
PSM	MEPSSLELPADTVQR	736	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.4250.2	50.49513	3	1793.7905	1793.7902	-	I	1	16
PSM	KGSLLIDSSTIDPAVSK	737	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3703.2	39.64352	3	1809.915671	1809.912512	K	E	125	142
PSM	NMSIIDAFK	738	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4198.2	49.8374	2	1117.489447	1117.487898	R	S	617	626
PSM	QASLDGLQQLR	739	sp|Q3MII6|TBC25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4026.2	47.12957	2	1290.5939	1290.5964	R	D	504	515
PSM	GAVYSFDPVGSYQRDSFK	740	sp|P20618|PSB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3787.4	41.7697	3	2101.919471	2101.914637	K	A	147	165
PSM	AEPAKIEAFRASLSK	741	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3278.2	28.92747	4	1696.856494	1696.854937	K	L	142	157
PSM	SRSSDIVSSVR	742	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3026.2	22.61953	3	1271.586671	1271.587095	R	R	900	911
PSM	SLEQDALR	743	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3139.2	25.49055	2	1010.440047	1010.443391	K	A	1508	1516
PSM	SGSVYEPLK	744	sp|Q93100|KPBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3243.4	28.04853	2	1058.466447	1058.468543	R	S	25	34
PSM	KCSLSLVGR	745	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3155.2	25.8983	2	1098.526047	1098.525681	K	G	253	262
PSM	SYDLTPVDK	746	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3326.2	30.14608	2	1116.474247	1116.474022	K	F	316	325
PSM	ADFIRESSEAQVQK	747	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3125.4	25.14037	3	1686.756671	1686.761431	K	F	860	874
PSM	QLSSGVSEIR	748	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3239.6	27.95427	2	1154.531047	1154.533268	R	H	80	90
PSM	ARTSSTDEVLSLEEK	749	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3328.2	30.19718	3	1743.795971	1743.792790	R	D	526	541
PSM	KSCVEEPEPEPEAAEGDGDKK	750	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.2913.3	19.84668	4	2379.979294	2379.977767	K	G	106	127
PSM	SSVLIAQQTDTSDPEK	751	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3213.3	27.3264	3	1797.805871	1797.803355	K	V	453	469
PSM	DSAQNSVIIVDK	752	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3232.5	27.78215	2	1287.667247	1287.667045	K	N	194	206
PSM	RKASQLVGIEK	753	sp|Q9NPD8|UBE2T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2973.2	21.28327	3	1307.694071	1307.696251	K	K	181	192
PSM	NNASTDYDLSDK	754	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2978.5	21.42012	2	1341.565847	1341.568454	K	S	301	313
PSM	SLSSSLDDTEVK	755	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3410.4	32.28813	2	1359.580247	1359.580672	K	K	156	168
PSM	KKSCPNPGEIR	756	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.2795.2	17.22548	3	1364.627171	1364.627186	K	N	160	171
PSM	SGSSPGLRDGSGTPSRHSLSGSSPGMK	757	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3007.5	22.13948	4	2745.159694	2745.157888	R	D	1441	1468
PSM	GSITEYTAAEEK	758	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3170.5	26.26695	2	1377.575047	1377.570108	K	E	113	125
PSM	AVADAIRTSLGPK	759	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3270.4	28.73817	2	1377.701247	1377.701731	K	G	43	56
PSM	ASVPREPGGPSPR	760	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2922.3	20.07053	3	1385.645171	1385.645279	K	V	1052	1065
PSM	NMSVIAHVDHGK	761	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3146.4	25.67907	3	1386.611171	1386.611536	R	S	21	33
PSM	SPSASITDEDSNV	762	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3302.5	29.55027	2	1400.531847	1400.534450	R	-	999	1012
PSM	TASGSSVTSLDGTR	763	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3092.4	24.30855	2	1417.606447	1417.608618	R	S	328	342
PSM	RFASGGCDNLIK	764	sp|P55735|SEC13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3222.2	27.53738	2	1416.621847	1416.622101	K	L	181	193
PSM	LAEALPKQSVDGK	765	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3068.3	23.68517	3	1434.708971	1434.711961	R	A	165	178
PSM	SRSLSASPALGSTK	766	sp|O95544|NADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3025.2	22.59357	3	1440.693971	1440.697374	K	E	44	58
PSM	SRSGEGEVSGLMR	767	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3185.3	26.64793	3	1443.618671	1443.617743	R	K	471	484
PSM	SRWNQDTMEQK	768	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2811.3	17.5444	3	1517.595671	1517.597008	R	T	20	31
PSM	IHKNSSTYWEGK	769	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2923.5	20.1032	3	1528.669871	1528.671159	K	A	277	289
PSM	QASVADYEETVKK	770	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3092.2	24.30188	3	1546.689971	1546.691620	R	A	82	95
PSM	SQSMDIDGVSCEK	771	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=1.1.2995.5	21.84002	2	1550.560847	1550.562991	R	S	103	116
PSM	KETSGTQGIEGHLK	772	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2951.2	20.72555	3	1563.729971	1563.729402	R	G	352	366
PSM	KRSASAPTLAETEK	773	sp|Q86W92-2|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2871.4	18.87742	3	1567.760471	1567.760702	R	E	530	544
PSM	RASSARANITLSGK	774	sp|E9PRG8|CK098_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3003.2	22.02843	3	1590.724571	1590.728036	K	K	54	68
PSM	SMSVYCTPNKPSR	775	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3052.2	23.27305	3	1605.666671	1605.668065	K	T	493	506
PSM	YDSRTTIFSPEGR	776	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3309.3	29.72047	3	1607.697671	1607.698102	R	L	5	18
PSM	SLTKPLAENEEGEK	777	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3042.4	23.02533	3	1623.739271	1623.739298	K	Q	343	357
PSM	SVTEQGAELSNEER	778	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3069.4	23.71402	3	1627.674971	1627.672675	K	N	28	42
PSM	GSSLSGTDDGAQEVVK	779	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3133.5	25.34793	2	1628.690647	1628.693076	R	D	275	291
PSM	KAEAGAGSATEFQFR	780	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3300.4	29.49743	2	1648.721447	1648.724651	K	G	150	165
PSM	ADSILAYHQQNVPR	781	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3320.2	29.9919	3	1690.781471	1690.782835	R	A	260	274
PSM	RNSSSPVSPASVPGQR	782	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3021.6	22.50363	3	1704.791771	1704.794462	R	R	655	671
PSM	SCSLVLEHQPDNIK	783	sp|Q14318|FKBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3327.3	30.17498	3	1718.770571	1718.769887	R	A	294	308
PSM	ETQKSIYYITGESK	784	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3246.4	28.12545	3	1725.787571	1725.786248	K	E	478	492
PSM	VRQASVADYEETVKK	785	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3068.6	23.69517	3	1801.856471	1801.861145	R	A	80	95
PSM	QASTDAGTAGALTPQHVR	786	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3081.4	24.02525	3	1859.851571	1859.852705	R	A	107	125
PSM	RKSEQEFSFDTPADR	787	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3259.4	28.46125	3	1891.809371	1891.810172	K	S	1125	1140
PSM	ASGNYATVISHNPETKK	788	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3085.3	24.125	4	1895.883294	1895.877857	R	T	129	146
PSM	NGRYSISRTEAADLCK	789	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3152.4	25.8302	3	1919.856371	1919.856076	K	A	39	55
PSM	KLSVPTSDEEDEVPAPKPR	790	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3285.3	29.11057	4	2173.031694	2173.030395	K	G	103	122
PSM	RKDSVWGSGGGQQSVNHLVK	791	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	25.77217	4	2218.062494	2218.064429	K	E	310	330
PSM	ESEDKPEIEDVGSDEEEEKK	792	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3008.4	22.16182	4	2320.007694	2320.007791	K	D	251	271
PSM	SVSVDSGEQREAGTPSLDSEAK	793	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3160.3	26.00765	3	2328.014471	2328.011844	R	E	116	138
PSM	SFAVGMFK	794	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3869.2	43.74917	2	965.408247	965.408191	K	G	72	80
PSM	MPSLPSYK	795	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3531.2	35.32656	2	1001.429447	1001.429321	R	V	303	311
PSM	MPSLPSYK	796	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3522.2	35.10352	2	1001.429447	1001.429321	R	V	303	311
PSM	GMSVYGLGR	797	sp|Q15417|CNN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3588.2	36.77782	2	1018.430247	1018.430718	K	Q	257	266
PSM	GFSLEELR	798	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3835.2	42.89228	2	1029.452447	1029.453227	R	V	75	83
PSM	RKTSDFNTFLAQEGCTK	799	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3415.2	32.4107	4	2081.926094	2081.924156	R	G	197	214
PSM	IGFGSFVEK	800	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3904.3	44.54832	2	1062.479647	1062.478714	R	T	182	191
PSM	DGSYAWEIK	801	sp|Q14696|MESD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3734.3	40.42463	2	1147.457047	1147.458706	R	D	163	172
PSM	SQGMALSLGDK	802	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3435.2	32.91808	2	1185.508247	1185.510090	K	I	933	944
PSM	SDSSQPMLLR	803	sp|P11532|DMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3429.3	32.77063	2	1212.520047	1212.520989	R	V	3621	3631
PSM	SISLYYTGEK	804	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3543.3	35.6311	2	1239.541447	1239.542436	R	G	458	468
PSM	RLGSLVDEFK	805	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3761.3	41.11413	2	1242.599847	1242.600954	K	E	517	527
PSM	SYGANFSWNK	806	sp|O43181|NDUS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3586.2	36.71672	2	1252.497047	1252.491404	K	R	159	169
PSM	HGRDDSFDSLDSFGSR	807	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3441.2	33.07353	3	1876.738271	1876.737735	R	S	196	212
PSM	SADTLWDIQK	808	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3790.4	41.83995	2	1255.549647	1255.548584	K	D	320	330
PSM	SYDVPPPPMEPDHPFYSNISK	809	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3689.4	39.29467	4	2512.068494	2512.065795	R	D	118	139
PSM	GSSGVGLTAAVLR	810	sp|P33993|MCM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3740.3	40.58983	2	1266.634447	1266.633317	R	D	408	421
PSM	LVQDVANNTNEEAGDGTTTATVLAR	811	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3442.4	33.10622	4	2559.235294	2559.241253	K	S	97	122
PSM	SQSQLLNTLTK	812	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3700.5	39.5786	2	1311.643847	1311.643547	R	K	8	19
PSM	SLEDQVEMLR	813	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3570.2	36.314	2	1314.552647	1314.552684	K	T	168	178
PSM	GADFLVTEVENGGSLGSKK	814	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3799.4	42.06973	3	1986.931871	1986.929953	K	G	189	208
PSM	SADTLWDIQK	815	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.4026.3	47.1329	2	1335.516847	1335.514915	K	D	320	330
PSM	SLFFPDEAINK	816	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4060.2	47.79588	2	1359.610047	1359.611184	K	H	172	183
PSM	SFSTALYGESDL	817	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4504.2	53.37763	2	1368.549247	1368.548644	K	-	900	912
PSM	TLSSSAQEDIIR	818	sp|Q9H788|SH24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3448.5	33.26527	2	1398.639847	1398.639190	R	W	313	325
PSM	GILAADESTGSIAK	819	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3424.4	32.64988	2	1411.658847	1411.659591	K	R	29	43
PSM	AITGASLADIMAK	820	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3688.5	39.27272	2	1436.603047	1436.602350	R	R	81	94
PSM	TLTIVDTGIGMTK	821	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3782.6	41.64115	2	1444.687647	1444.688449	R	A	28	41
PSM	IVSAQSLAEDDVE	822	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3783.3	41.6601	2	1454.617247	1454.617786	R	-	133	146
PSM	DASISKGDFQNPGDQEWLK	823	sp|Q8IWW6-3|RHG12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3762.4	41.14488	3	2213.960771	2213.963044	R	H	301	320
PSM	VMSDFAINQEQK	824	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3665.2	38.69282	2	1488.631847	1488.631996	R	E	649	661
PSM	NQSFCPTVNLDK	825	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3488.6	34.2531	2	1501.627847	1501.627246	R	L	66	78
PSM	SLPVPGALEQVASR	826	sp|O95785-3|WIZ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4051.2	47.58697	3	1502.748371	1502.749409	K	L	12	26
PSM	DSALQDTDDSDDDPVLIPGAR	827	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3952.4	45.66873	3	2293.969271	2293.958746	R	Y	648	669
PSM	DTSFSGLSLEEYK	828	sp|Q9BRT2|UQCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3980.4	46.26957	2	1554.652047	1554.649086	R	L	77	90
PSM	RVSAIVEQSWNDS	829	sp|P63146|UBE2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3677.5	38.99902	2	1569.682647	1569.682452	K	-	140	153
PSM	LVSQEEMEFIQR	830	sp|P82909|RT36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3892.2	44.24813	3	1587.705971	1587.700410	K	G	88	100
PSM	SLTNDWEDHLAVK	831	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3714.2	39.92579	3	1606.706171	1606.702853	K	H	315	328
PSM	DVTPPPETEVVLIK	832	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3961.2	45.84667	3	1615.811471	1615.811007	K	N	519	533
PSM	DVTPPPETEVVLIK	833	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3970.2	46.0497	3	1615.811471	1615.811007	K	N	519	533
PSM	SMSDVSAEDVQNLR	834	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3546.3	35.70553	3	1629.672071	1629.670567	K	Q	704	718
PSM	NSVTPDMMEEMYK	835	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3825.3	42.64892	2	1653.615247	1653.612583	K	K	229	242
PSM	SSMDGAGAEEVLAPLR	836	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3958.2	45.78119	3	1681.740671	1681.738252	R	L	53	69
PSM	SSMDGAGAEEVLAPLR	837	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,3-UNIMOD:35	ms_run[1]:scan=1.1.3808.2	42.28393	3	1697.737271	1697.733167	R	L	53	69
PSM	NRPTSISWDGLDSGK	838	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3486.5	34.19827	3	1711.754471	1711.756680	K	L	48	63
PSM	MQSACLLSDMESFK	839	sp|Q15042|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.4237.2	50.33878	3	1741.679471	1741.676246	R	A	674	688
PSM	FQSSHHPTDITSLDQYVER	840	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3626.4	37.72905	4	2339.024494	2339.021956	R	M	512	531
PSM	QFASQANVVGPWIQTK	841	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4166.3	49.25013	3	1852.889171	1852.887300	R	M	653	669
PSM	KHSQFIGYPITLYLEK	842	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4062.3	47.83681	3	2016.014171	2016.012166	K	E	183	199
PSM	QLSILVHPDKNQDDADR	843	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3413.2	32.35903	4	2042.941294	2042.942249	R	A	79	96
PSM	QKHSQAVEELAEQLEQTK	844	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3689.6	39.30133	3	2175.024071	2175.020893	R	R	1192	1210
PSM	DNLTLWTSDMQGDGEEQNK	845	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3624.5	37.67745	3	2195.929571	2195.927707	R	E	226	245
PSM	RGTGGVDTAAVGGVFDVSNADR	846	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3718.4	40.03592	3	2200.001471	2199.990990	K	L	320	342
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	847	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3785.5	41.71495	4	3393.356094	3393.345713	K	F	86	114
PSM	ASGVAVSDGVIK	848	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3485.4	34.16897	2	1143.6103	1143.6130	M	V	2	14
PSM	SGDEMIFDPTMSK	849	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4112.2	48.5052	2	1594.5949	1594.5927	M	K	2	15
PSM	SGWESYYK	850	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3939.2	45.38558	2	1140.4187	1140.4160	M	T	2	10
PSM	QQSTSSDRVSQTPESLDFLK	851	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4045.3	47.46247	3	2315.0347	2315.0313	R	V	1000	1020
PSM	QASTDAGTAGALTPQHVR	852	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3288.4	29.19142	3	1842.8278	1842.8256	R	A	107	125
PSM	MHRDSCPLDCK	853	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3021.3	22.49363	3	1539.5647	1539.5664	-	V	1	12
PSM	LRSDAGLESDTAMK	854	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.2928.4	20.22847	3	1588.680971	1588.680403	K	K	5	19
PSM	QVSSVNEEDFVR	855	sp|P40189|IL6RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3916.3	44.79278	2	1470.6051	1470.6023	K	L	836	848
PSM	RLSSLRASTSK	856	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3053.2	23.29837	3	1444.584371	1444.587777	R	S	233	244
PSM	DRSSFYVNGLTLGGQK	857	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3853.2	43.33278	3	1821.834671	1820.845829	K	C	55	71
PSM	RSLTNSHLEK	858	sp|Q9H2H9|S38A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2809.2	17.50128	3	1263.598571	1263.597266	R	K	51	61
PSM	RQNPSRCSVSLSNVEAR	859	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3077.2	23.9147	4	2038.940094	2038.936786	R	R	720	737
PSM	CESAFLSK	860	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3128.3	25.2143	2	1020.396247	1020.398749	K	R	36	44
PSM	KASISYFK	861	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3167.3	26.18257	2	1022.482447	1022.483799	R	N	77	85
PSM	RASYNEPKPEVTYISQK	862	sp|Q8IWB9|TEX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3181.4	26.54732	4	2088.991294	2088.988136	R	I	591	608
PSM	SSLGPVGLDK	863	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3348.2	30.71195	2	1051.493047	1051.495092	K	M	34	44
PSM	KLSEIMEK	864	sp|P00568|KAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3165.2	26.12817	2	1056.490647	1056.492649	K	G	56	64
PSM	SGTSEFLNK	865	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3165.3	26.1315	2	1061.442047	1061.443056	K	M	169	178
PSM	SMSTEGLMK	866	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3284.3	29.08467	2	1062.414447	1062.412684	K	F	451	460
PSM	TSLGPNGLDK	867	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3160.2	26.00098	2	1080.482647	1080.485256	R	M	50	60
PSM	QRGSETDTDSEIHESASDK	868	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2811.4	17.55107	4	2170.870894	2170.865180	R	D	1260	1279
PSM	KQSEPFFK	869	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3178.4	26.46923	2	1089.488447	1089.489613	R	A	82	90
PSM	SCEVPTRLNSASLK	870	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3247.4	28.15117	3	1640.757071	1640.759322	R	Q	97	111
PSM	KYSGLIVNK	871	sp|Q86TI2|DPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3151.3	25.801	2	1100.561047	1100.563112	R	A	43	52
PSM	GMSVSDLADK	872	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3336.2	30.40333	2	1101.442647	1101.441342	K	L	386	396
PSM	RNSFTPLSSSNTIR	873	sp|O60825|F262_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3325.2	30.12042	3	1658.781671	1658.777749	R	R	464	478
PSM	GFSIPECQK	874	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3405.4	32.15975	2	1144.460047	1144.462412	R	L	95	104
PSM	QASVTLQPLK	875	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3401.3	32.05298	2	1163.593647	1163.595140	R	I	251	261
PSM	HQGVMVGMGQKDSYVGDEAQSK	876	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3216.2	27.39795	4	2430.039294	2430.034511	R	R	42	64
PSM	RSPSKPLPEVTDEYK	877	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3168.4	26.21183	3	1824.864071	1824.865896	R	N	91	106
PSM	EQVANSAFVER	878	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3100.5	24.51027	2	1248.607247	1248.609865	K	V	365	376
PSM	AASSAAQGAFQGN	879	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3052.5	23.28305	2	1258.497447	1258.497946	R	-	317	330
PSM	SNSHAAIDWGK	880	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.3	25.1111	2	1264.518647	1264.523766	K	M	1666	1677
PSM	LMIEMDGTENK	881	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3378.4	31.47307	2	1279.576447	1279.578824	K	S	93	104
PSM	GGSGSGPTIEEVD	882	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3338.2	30.45432	2	1283.492447	1283.491857	K	-	629	642
PSM	QEGRKDSLSVNEFK	883	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3132.2	25.31255	4	1715.788094	1715.787980	R	E	26	40
PSM	CSVSLSNVEAR	884	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3315.3	29.86863	2	1300.550447	1300.548267	R	R	726	737
PSM	FRASSQSAPSPDVGSGVQT	885	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3250.6	28.2352	3	1956.855071	1956.857850	R	-	124	143
PSM	ARSEQFINLR	886	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3354.2	30.8657	2	1312.630247	1312.628900	R	E	472	482
PSM	VASETHSEGSEYEELPK	887	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3198.6	26.96255	3	1970.815871	1970.814648	R	R	1130	1147
PSM	YKLDEDEDEDDADLSK	888	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3184.6	26.63173	3	1978.756271	1978.756858	K	Y	167	183
PSM	KESYSIYVYK	889	sp|P33778|H2B1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3365.4	31.15157	2	1358.615247	1358.615935	R	V	35	45
PSM	KRDFSLEQLR	890	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3294.3	29.34348	3	1370.673371	1370.670765	K	Q	100	110
PSM	RVSLVGADDLRK	891	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	26.59262	3	1407.718271	1407.723529	K	M	1376	1388
PSM	EVDEQMLNVQNK	892	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3252.5	28.28348	2	1445.678647	1445.682044	K	N	325	337
PSM	RSTSPIIGSPPVR	893	sp|Q86TB9|PATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3209.2	27.2212	3	1445.737571	1445.739179	R	A	176	189
PSM	KISSDLDGHPVPK	894	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3030.3	22.7264	3	1471.707371	1471.707210	R	Q	102	115
PSM	SGVAYIAAPSGSAADK	895	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3322.5	30.053	2	1543.695047	1543.691954	R	V	554	570
PSM	NIIHGSDSVESAEK	896	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3042.3	23.022	3	1564.676171	1564.677032	R	E	115	129
PSM	LRAFSRGGSLESR	897	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3136.3	25.4166	3	1594.701671	1594.701822	R	S	23	36
PSM	ERGSDASGQLFHGR	898	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3017.2	22.38717	3	1595.685371	1595.684183	R	A	1230	1244
PSM	SRSPESQVIGENTK	899	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3006.2	22.10365	3	1610.725571	1610.730130	R	Q	305	319
PSM	NRTSVDFKDTDYK	900	sp|P49902|5NTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3046.3	23.12498	3	1667.716571	1667.719231	R	R	508	521
PSM	KCSLPAEEDSVLEK	901	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3301.5	29.52538	2	1683.743647	1683.742669	K	L	634	648
PSM	HASSGSFLPSANEHLK	902	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3250.3	28.2252	3	1760.786171	1760.788314	R	E	115	131
PSM	KASAHSIVECDPVRK	903	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2964.4	21.05835	4	1775.839294	1775.838970	R	E	34	49
PSM	THSTSSSLGSGESPFSR	904	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3304.5	29.60085	3	1882.710671	1882.713568	R	S	329	346
PSM	KISGGSVVEMQGDEMTR	905	sp|O75874|IDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3331.3	30.27772	3	1902.821771	1902.821664	K	I	4	21
PSM	ERRSTVLGLPQHVQK	906	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3178.2	26.46257	4	1906.916094	1906.917962	R	E	158	173
PSM	RKDSAIQQQVANLQMK	907	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3182.4	26.57323	3	1952.946371	1952.950311	R	I	1227	1243
PSM	SSGGSYRDSYDSYATHNE	908	sp|Q14011|CIRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3048.3	23.17573	3	2074.748471	2074.754173	R	-	155	173
PSM	TRSNPEGAEDRAVGAQASVGSR	909	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2948.3	20.67998	3	2294.034371	2294.040065	R	S	27	49
PSM	SLLSAALAK	910	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3697.2	39.49295	2	952.497647	952.499449	K	S	1071	1080
PSM	SFVLNLGK	911	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3840.2	43.01825	2	956.473647	956.473234	K	D	30	38
PSM	NLLSVAYK	912	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3758.2	41.03528	2	986.480847	986.483799	R	N	44	52
PSM	MPSLPSYK	913	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3539.2	35.52915	2	1001.429447	1001.429321	R	V	303	311
PSM	MPSLPSYK	914	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3556.2	35.9572	2	1001.429447	1001.429321	R	V	303	311
PSM	ISLADIAQK	915	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3659.2	38.54137	2	1037.512647	1037.515827	R	L	417	426
PSM	LQSVVVVPK	916	sp|Q9BYW2|SETD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3422.2	32.59145	2	1047.571447	1047.572948	R	N	1066	1075
PSM	RGTGQSDDSDIWDDTALIK	917	sp|Q16637|SMN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3926.2	45.04313	4	2171.939294	2171.937223	R	A	23	42
PSM	SISLEPLQK	918	sp|Q8N0T1|RBIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3605.5	37.18233	2	1093.542447	1093.542042	K	E	67	76
PSM	DIVENYFMRDSGSK	919	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3818.2	42.51027	3	1739.728871	1739.722602	K	A	128	142
PSM	TFSWASVTSK	920	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3809.3	42.3149	2	1192.516847	1192.516556	R	N	248	258
PSM	SPSLNLLQNK	921	sp|O43353|RIPK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3594.2	36.89013	2	1192.585647	1192.585304	R	S	529	539
PSM	RATISSPLELEGTVSR	922	sp|Q96GS4|BORC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3649.3	38.29118	3	1794.888971	1794.887694	R	H	194	210
PSM	QQSTSSDRVSQTPESLDFLK	923	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3967.2	45.98853	4	2412.028094	2412.024732	R	V	1000	1020
PSM	RLGSLVDEFK	924	sp|P12956|XRCC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	41.33558	2	1242.599847	1242.600954	K	E	517	527
PSM	SFSEDAVTDSSGSGTLPR	925	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3504.4	34.65107	3	1891.783871	1891.783682	K	A	1192	1210
PSM	SLSALAFSPDGK	926	sp|O43379|WDR62_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3844.4	43.12102	2	1271.582447	1271.579884	K	Y	113	125
PSM	LRSSFESSCPQQWIK	927	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3608.3	37.25322	3	1931.862371	1931.860099	K	Y	82	97
PSM	SGQGFHGNSEVNAILSPR	928	sp|Q8TB72|PUM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3618.5	37.51892	3	1948.880171	1948.879254	R	S	67	85
PSM	MASNIFGPTEEPQNIPK	929	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3708.5	39.78138	3	1967.870471	1967.869995	R	R	43	60
PSM	DMGSVALDAGTAK	930	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3441.3	33.07687	2	1314.551247	1314.552683	K	D	298	311
PSM	KITIADCGQLE	931	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3463.4	33.62545	2	1326.588847	1326.589069	K	-	155	166
PSM	TSIAIDTIINQK	932	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3925.2	45.02072	2	1395.701847	1395.701062	K	R	219	231
PSM	TSSLAPVVGTTTTTPSPSAIK	933	sp|Q92733|PRCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3623.3	37.64492	3	2095.047071	2095.044982	K	A	226	247
PSM	DLSTVEALQNLK	934	sp|Q9BTT0|AN32E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4055.2	47.67107	3	1409.680271	1409.680327	K	N	102	114
PSM	RFSDQFPLPLK	935	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3940.2	45.39762	3	1426.701971	1426.701003	R	E	879	890
PSM	SAEPAEALVLACK	936	sp|Q96CW6|S7A6O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3751.5	40.8703	2	1437.655647	1437.657483	R	R	16	29
PSM	GSLLLGGLDAEASR	937	sp|Q6UVK1|CSPG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3952.2	45.6554	2	1437.686447	1437.686475	R	H	320	334
PSM	KISGTTALQEALK	938	sp|P30622|CLIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3505.3	34.67382	3	1438.742171	1438.743261	R	E	346	359
PSM	LTFDSSFSPNTGK	939	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3645.5	38.20217	2	1479.630447	1479.628291	K	K	97	110
PSM	RLTVSSLQESGLK	940	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3416.2	32.4366	3	1496.759771	1496.759974	R	V	2334	2347
PSM	GFSVVADTPELQR	941	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3876.2	43.8989	3	1497.687971	1497.686475	K	I	97	110
PSM	KTSCEFTGDILR	942	sp|P21281|VATB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3466.4	33.70002	2	1505.662647	1505.658546	K	T	109	121
PSM	DHQYQFLEDAVR	943	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3610.2	37.30445	3	1519.704071	1519.705556	K	N	239	251
PSM	DASRGLATFCLDK	944	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3616.3	37.46025	3	1532.666771	1532.669445	R	E	120	133
PSM	DQSVGDPKIDLIR	945	sp|Q14108|SCRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	36.33843	3	1534.740671	1534.739239	R	T	122	135
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	946	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3833.4	42.85028	4	3081.282894	3081.278791	K	E	160	186
PSM	DTSFSGLSLEEYK	947	sp|Q9BRT2|UQCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3991.3	46.47112	2	1554.652047	1554.649086	R	L	77	90
PSM	KYSSLNLFDTYK	948	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	43.11435	3	1557.710771	1557.711627	K	G	16	28
PSM	SMSDVSAEDVQNLR	949	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3513.3	34.88098	3	1629.669071	1629.670567	K	Q	704	718
PSM	QAGSVGGLQWCGEPK	950	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3578.2	36.51633	3	1652.703671	1652.701807	R	R	190	205
PSM	SCGSLLPELKLEER	951	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3862.2	43.56167	3	1709.804471	1709.805938	R	T	129	143
PSM	MQSACLLSDMESFK	952	sp|Q15042|RB3GP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.4412.2	52.30553	3	1725.687071	1725.681331	R	A	674	688
PSM	RSSWRVISSIEQK	953	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3555.3	35.93473	3	1734.783971	1734.785551	R	T	58	71
PSM	DRGLSIPRADTLDEY	954	sp|O15116|LSM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3837.2	42.94437	3	1799.809271	1799.809109	K	-	119	134
PSM	HVPDSGATATAYLCGVK	955	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3481.6	34.07232	3	1825.803971	1825.807001	K	G	110	127
PSM	HVPDSGATATAYLCGVK	956	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3498.5	34.49938	3	1825.803971	1825.807001	K	G	110	127
PSM	NPDDITQEEYGEFYK	957	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3627.4	37.74847	3	1846.792271	1846.789740	R	S	292	307
PSM	NRSADFNPDFVFTEK	958	sp|Q96GQ7|DDX27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3861.2	43.53627	3	1865.801171	1865.798544	K	E	77	92
PSM	GTPGPDSSGSLGSGEFTGVK	959	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3508.6	34.7618	3	1915.823771	1915.820068	R	E	365	385
PSM	ECSLQVPEDELVSTLK	960	sp|P11441|UBL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.4264.2	50.72262	3	1925.873171	1925.869326	R	Q	12	28
PSM	SLSELESLKLPAESNEK	961	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3973.2	46.12188	3	1952.939171	1952.934369	R	I	238	255
PSM	ENRQSIINPDWNFEK	962	sp|P46459|NSF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3692.5	39.37442	3	1968.876971	1968.873106	K	M	203	218
PSM	LGSVDSFERSNSLASEK	963	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3494.5	34.39919	3	1984.820471	1984.818033	R	D	586	603
PSM	SQSSHSYDDSTLPLIDR	964	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3612.4	37.35972	3	1999.855871	1999.852431	R	N	859	876
PSM	SNSSSEAVLGQEELSAQAK	965	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3485.6	34.17563	3	2013.891071	2013.889210	R	V	393	412
PSM	TRTSIDSIDSGVELTTSPK	966	sp|O15403|MOT7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3534.5	35.41295	3	2085.985571	2085.983110	K	N	231	250
PSM	LYGPSSVSFADDFVRSSK	967	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4169.2	49.33545	3	2120.888771	2120.885719	R	Q	134	152
PSM	CSVCGGAIMPEPGQEETVR	968	sp|Q15654|TRIP6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,2-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3539.5	35.53915	3	2155.870271	2155.873777	R	I	399	418
PSM	DLLLTSSYLSDSGSTGEHTK	969	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3870.4	43.76792	3	2189.975171	2189.972940	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	970	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3981.2	46.29462	3	2192.880971	2192.873028	R	-	228	248
PSM	ARSVDALDDLTPPSTAESGSR	971	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3550.6	35.81572	3	2224.001471	2224.000886	R	S	491	512
PSM	DNLTLWTSDSAGEECDAAEGAEN	972	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4008.6	46.84058	3	2453.983571	2453.976507	R	-	223	246
PSM	SYDVPPPPMEPDHPFYSNISK	973	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3871.4	43.79998	3	2496.076271	2496.070880	R	D	118	139
PSM	TYSIDGPNASRPQSARPSINEIPER	974	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3460.4	33.5596	4	2914.302894	2914.301181	R	T	1131	1156
PSM	VQQTVQDLFGRAPSK	975	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3559.2	36.0333	3	1752.854771	1752.856000	K	A	395	410
PSM	STVHEILCK	976	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3582.2	36.61948	2	1207.5337	1207.5303	M	L	2	11
PSM	QRSLGPSLATDKS	977	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3061.2	23.501	3	1439.679671	1438.681724	R	-	268	281
PSM	DRSSFYVNGLTLGGQK	978	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3749.4	40.81507	3	1821.847271	1820.845829	K	C	55	71
PSM	SGDEMIFDPTMSK	979	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,5-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3959.2	45.79637	2	1594.5953	1594.5927	M	K	2	15
PSM	SSEDSGSRKDSSSEVFSDAAK	980	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2970.6	21.21995	4	2254.924494	2254.922695	K	E	914	935
PSM	QSFTMVADTPENLR	981	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=1.1.4351.2	51.73578	2	1670.7057	1670.7006	K	L	60	74
PSM	AESSESFTMASSPAQR	982	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3537.3	35.48338	3	1806.7108	1806.7126	M	R	2	18
PSM	ATNWGSLLQDK	983	sp|P48637|GSHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4871.2	56.75428	2	1353.5982	1353.5961	M	Q	2	13
PSM	GLSRDMQGLSLDAASQPSK	984	sp|Q96EY5|MB12A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3711.5	39.85833	3	2039.941271	2039.934720	R	G	161	180
PSM	SVAFAAPR	985	sp|Q15532|SSXT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3575.3	36.4421	2	939.4217	939.4210	M	Q	2	10
PSM	RKTLDAEVVEK	986	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2934.2	20.3773	3	1366.681271	1366.685746	R	P	275	286
PSM	SPSTLLPK	987	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	31.1449	2	921.456647	921.457250	R	K	825	833
PSM	AHSSMVGVNLPQK	988	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3076.2	23.88882	3	1462.662371	1462.663965	R	A	172	185
PSM	RLASSVLR	989	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	26.26028	2	980.517047	980.516830	K	C	9	17
PSM	HELQANCYEEVK	990	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2998.4	21.91172	3	1518.679571	1518.677293	K	D	133	145
PSM	MPSLPSYK	991	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3255.2	28.3511	2	1017.422447	1017.424236	R	V	303	311
PSM	MPSLPSYK	992	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3289.3	29.2139	2	1017.423047	1017.424236	R	V	303	311
PSM	MPSLPSYK	993	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3263.2	28.5568	2	1017.423047	1017.424236	R	V	303	311
PSM	MPSLPSYK	994	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3247.3	28.14783	2	1017.423047	1017.424236	R	V	303	311
PSM	MPSLPSYK	995	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3272.2	28.7798	2	1017.423047	1017.424236	R	V	303	311
PSM	RSRSGEGEVSGLMR	996	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3045.3	23.09908	3	1599.717971	1599.718854	K	K	470	484
PSM	NNSVSGLSVK	997	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3085.5	24.13167	2	1083.493847	1083.496155	R	S	498	508
PSM	VGDYGSLSGR	998	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3069.5	23.71735	2	1089.448447	1089.449204	R	E	190	200
PSM	GMGSLDAMDK	999	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	30.22285	2	1103.402047	1103.402848	R	H	413	423
PSM	SPSKPLPEVTDEYK	1000	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3321.4	30.02417	3	1668.765971	1668.764785	R	N	92	106
PSM	RRLSELLR	1001	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3275.2	28.85322	2	1121.604047	1121.607042	R	Y	449	457
PSM	VTLTSEEEAR	1002	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2967.3	21.13243	2	1133.556447	1133.556432	K	L	306	316
PSM	NLQTVNVDEN	1003	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3142.4	25.57482	2	1144.533447	1144.536031	K	-	116	126
PSM	GSFSLGEQSR	1004	sp|Q8TEB1|DCA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3210.6	27.26008	2	1146.470847	1146.470668	R	V	146	156
PSM	RAGSSGNSCITYQPSVSGEHK	1005	sp|Q99755|PI51A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3006.3	22.10698	4	2300.983694	2300.984524	R	A	472	493
PSM	SIDTGMGLER	1006	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3375.2	31.3935	2	1157.479047	1157.478790	K	L	237	247
PSM	QASVTLQPLK	1007	sp|P78345|RPP38_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3393.3	31.84678	2	1163.593647	1163.595140	R	I	251	261
PSM	NRLLSNELK	1008	sp|P06753-3|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3236.2	27.86785	2	1165.585847	1165.585638	R	L	231	240
PSM	KLSQMILDK	1009	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3120.2	25.00453	2	1170.570447	1170.571963	R	K	364	373
PSM	SFQQELDAR	1010	sp|Q99598|TSNAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3279.3	28.95578	2	1172.486447	1172.486318	K	H	41	50
PSM	EAAENSLVAYK	1011	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3150.4	25.77883	2	1193.585847	1193.592818	K	A	143	154
PSM	RKPSVPDSASPADDSFVDPGER	1012	sp|P16333|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3307.2	29.66635	4	2408.067694	2408.064549	K	L	82	104
PSM	AKSTCSCPDLQPNGQDLGENSR	1013	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.3153.5	25.85942	4	2513.036894	2513.031217	K	V	56	78
PSM	DSGSISLQETR	1014	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3115.4	24.8865	2	1271.539247	1271.539476	K	R	776	787
PSM	ELISNASDALDK	1015	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3328.4	30.20385	2	1274.633247	1274.635411	R	I	103	115
PSM	RKSHEAEVLK	1016	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2685.2	16.21382	3	1275.632471	1275.633651	R	Q	61	71
PSM	SNFSNSADDIK	1017	sp|P45973|CBX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3070.5	23.74335	2	1276.495047	1276.497277	K	S	92	103
PSM	SFDANGASTLSK	1018	sp|Q9BTA9|WAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3157.3	25.95008	2	1276.532047	1276.533662	K	L	279	291
PSM	GRLSKEDIER	1019	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2860.2	18.6136	3	1281.610571	1281.607830	K	M	508	518
PSM	RDSGVGSGLEAQESWER	1020	sp|Q12770|SCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3393.5	31.85345	3	1941.819971	1941.821799	R	L	820	837
PSM	SNSFNNPLGNR	1021	sp|O95835|LATS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3350.5	30.77387	2	1298.541047	1298.540479	R	A	462	473
PSM	ERLESLNIQR	1022	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3313.4	29.82305	2	1336.649047	1336.650030	K	E	580	590
PSM	RISEMEEELK	1023	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3353.4	30.84798	2	1342.582847	1342.583983	R	M	993	1003
PSM	DNSTMGYMMAK	1024	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3187.5	26.7065	2	1343.459847	1343.459711	R	K	486	497
PSM	ELISNASDALDK	1025	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3409.3	32.25882	2	1354.597047	1354.601742	R	I	103	115
PSM	SGYGPSDGPSYGR	1026	sp|O95429|BAG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3074.6	23.85007	2	1378.514447	1378.519075	R	Y	7	20
PSM	RLSQSDEDVIR	1027	sp|Q9H7D7|WDR26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3076.6	23.90215	2	1396.631247	1396.634773	K	L	119	130
PSM	SDSGGSSSEPFDR	1028	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3017.5	22.39717	2	1406.498047	1406.498733	R	H	759	772
PSM	LMELHGEGSSSGK	1029	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3015.2	22.33568	3	1410.584771	1410.585046	K	A	228	241
PSM	SRTHSTSSSLGSGESPFSR	1030	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3148.4	25.72857	3	2125.845371	2125.846708	R	S	327	346
PSM	SVQYDDVPEYK	1031	sp|Q13740|CD166_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3370.4	31.28035	2	1421.573847	1421.575193	K	D	77	88
PSM	RRSPSPYYSR	1032	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2821.3	17.76173	3	1427.572271	1427.574830	R	Y	258	268
PSM	TASLTSAASVDGNR	1033	sp|Q9UN36|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3140.4	25.52287	2	1428.621647	1428.624603	R	S	330	344
PSM	SRSPLELEPEAK	1034	sp|Q92466|DDB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3282.2	29.0296	3	1434.675971	1434.675576	R	K	24	36
PSM	EKGSFSDTGLGDGK	1035	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3025.3	22.5969	3	1476.613571	1476.613369	K	M	374	388
PSM	ATSISTQLPDDPAK	1036	sp|Q9UJW0|DCTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3375.5	31.4035	2	1522.690847	1522.691620	R	T	87	101
PSM	RGVSCQFGPDVTK	1037	sp|P53041|PPP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3170.6	26.27028	2	1529.669847	1529.669779	K	A	400	413
PSM	RRTWDDDYVLK	1038	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3296.2	29.39173	3	1545.696971	1545.697708	R	R	1758	1769
PSM	SQSMDIDGVSCEK	1039	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=1.1.2985.6	21.6001	2	1550.561247	1550.562991	R	S	103	116
PSM	SVSSPTSSNTPTPTK	1040	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2889.2	19.27572	2	1569.693047	1569.692348	K	H	131	146
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	1041	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	27-UNIMOD:21	ms_run[1]:scan=1.1.2945.3	20.63858	4	3173.334494	3173.326984	K	E	337	367
PSM	ERESLQQMAEVTR	1042	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2954.6	20.81323	3	1671.728471	1671.728751	K	E	123	136
PSM	AEPAKIEAFRASLSK	1043	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3275.3	28.85655	3	1696.854971	1696.854937	K	L	142	157
PSM	RRLSSTSLASGHSVR	1044	sp|Q9BZL6|KPCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2968.4	21.16143	3	1772.805371	1772.808412	K	L	194	209
PSM	KKMSNALAIQVDSEGK	1045	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3185.4	26.65127	3	1797.867971	1797.869601	K	I	80	96
PSM	KGSGVGEQDGGLIGAEEK	1046	sp|Q06481|APLP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3166.5	26.1636	3	1809.817571	1809.814588	K	V	624	642
PSM	RFSTYSQSPPDTPSLR	1047	sp|Q6ZS17|RIPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3387.6	31.70188	3	1917.861371	1917.862207	K	E	344	360
PSM	RRFSDSEGEETVPEPR	1048	sp|Q13286|CLN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3045.4	23.10242	3	1969.850471	1969.853099	R	L	9	25
PSM	RRSSSVVSAEMSGCSSK	1049	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3004.5	22.06345	3	1973.772971	1973.773743	R	S	290	307
PSM	RKTSDFNTFLAQEGCTK	1050	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3402.2	32.07547	4	2081.927294	2081.924156	R	G	197	214
PSM	SLDSDESEDEEDDYQQK	1051	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3043.6	23.0573	3	2110.736471	2110.737580	K	R	57	74
PSM	SPSKPLPEVTDEYKNDVK	1052	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.5	29.9763	3	2124.999371	2124.998032	R	N	92	110
PSM	GRLGSVDSFERSNSLASEK	1053	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3379.5	31.5009	3	2197.941671	2197.940608	R	D	584	603
PSM	SCVEEPEPEPEAAEGDGDKK	1054	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2996.4	21.86118	3	2251.880771	2251.882804	K	G	107	127
PSM	SSGGSEHSTEGSVSLGDGQLNR	1055	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3231.6	27.75978	3	2319.904571	2319.900594	R	Y	381	403
PSM	IVRGDQPAASGDSDDDEPPPLPR	1056	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3281.6	29.0168	3	2483.098571	2483.096577	K	L	45	68
PSM	IVRGDQPAASGDSDDDEPPPLPR	1057	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3277.6	28.91598	3	2483.098571	2483.096577	K	L	45	68
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	1058	sp|Q9NPQ8|RIC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3268.4	28.69708	3	2742.061871	2742.064016	R	E	424	448
PSM	LVSLIGSK	1059	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3658.2	38.51266	2	895.477847	895.477985	R	T	108	116
PSM	AFLAELEQNSPK	1060	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3748.3	40.78617	3	1425.653471	1425.654112	K	I	4512	4524
PSM	RLSELLR	1061	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	33.54627	2	965.502847	965.505931	R	Y	450	457
PSM	RLSELLR	1062	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3451.2	33.32924	2	965.502847	965.505931	R	Y	450	457
PSM	MPSLPSYK	1063	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3548.2	35.75215	2	1001.429447	1001.429321	R	V	303	311
PSM	GGSGAPILLR	1064	sp|O95571|ETHE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3508.4	34.75513	2	1019.514847	1019.516496	R	Q	17	27
PSM	GLTSVINQK	1065	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3454.4	33.40842	2	1038.508647	1038.511076	R	L	300	309
PSM	AVDSLVPIGR	1066	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3735.2	40.44722	2	1105.553447	1105.553276	K	G	195	205
PSM	ARSVDALDDLTPPSTAESGSR	1067	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3544.2	35.65242	4	2223.996494	2224.000886	R	S	491	512
PSM	DLSLEEIQK	1068	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3546.4	35.70887	2	1153.526247	1153.526786	K	K	44	53
PSM	NRSNTPILVDGKDVMPEVNK	1069	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3534.3	35.40628	4	2305.110894	2305.113747	R	V	105	125
PSM	SDSSYRMSATEILK	1070	sp|Q6T4R5|NHS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3726.2	40.22783	3	1746.690671	1746.693684	R	S	1528	1542
PSM	DQIYDIFQK	1071	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3866.2	43.67318	2	1168.576047	1168.576440	K	L	194	203
PSM	IISIFSGTEK	1072	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4104.3	48.43637	2	1173.569447	1173.568257	K	G	53	63
PSM	SSVFELQVADTPDGEK	1073	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3817.4	42.48957	3	1800.784871	1800.781891	R	Q	241	257
PSM	SINQPVAFVR	1074	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3579.3	36.54555	2	1209.591847	1209.590724	R	R	15	25
PSM	RGSRSQSQLLNTLTK	1075	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3419.5	32.52397	3	1847.865671	1847.865592	K	K	4	19
PSM	SMDLGIADETK	1076	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3553.4	35.88643	2	1258.514847	1258.515235	K	L	852	863
PSM	GPLQSVQVFGR	1077	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3779.3	41.55875	2	1266.611447	1266.612187	K	K	5	16
PSM	SASDLSEDLFK	1078	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3891.4	44.22592	2	1290.537847	1290.538079	K	V	650	661
PSM	SDSFYFVDNK	1079	sp|A6NIH7|U119B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3682.3	39.11695	2	1300.500847	1300.501300	R	L	227	237
PSM	DAGTIAGLNVMR	1080	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3872.2	43.81553	2	1296.589247	1296.589737	K	I	186	198
PSM	NQRGSFEAPRYEGSFPAGPPPTR	1081	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3461.4	33.57707	4	2597.183294	2597.181250	R	A	75	98
PSM	TMSVSDFNYSR	1082	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3557.3	35.98597	2	1385.532847	1385.532282	R	T	1156	1167
PSM	ATSVDYSSFADR	1083	sp|Q86YS7-2|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3432.5	32.85137	2	1397.550247	1397.550041	R	C	853	865
PSM	NLSSPFIFHEK	1084	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3767.2	41.25507	3	1397.640071	1397.638068	R	T	644	655
PSM	QDSLSSEVDTLK	1085	sp|Q08378|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3536.6	35.46753	2	1400.607247	1400.607221	R	Q	463	475
PSM	SISGPSVGVMEMR	1086	sp|Q8NFH5|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3729.5	40.30188	2	1428.615647	1428.614238	R	S	53	66
PSM	SCSDTALNAIVAK	1087	sp|Q86X02|CDR2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3574.5	36.42311	2	1428.631047	1428.631997	K	D	316	329
PSM	TLTIVDTGIGMTK	1088	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4012.4	46.91522	2	1428.696647	1428.693534	R	A	28	41
PSM	SPSLGSDLTFATR	1089	sp|Q13425|SNTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3864.3	43.61578	2	1430.644247	1430.644276	R	T	393	406
PSM	CSVLAAANPVYGR	1090	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3547.6	35.74053	2	1456.654047	1456.653401	R	Y	446	459
PSM	RASSLNVLNVGGK	1091	sp|Q07866-4|KLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3577.2	36.49033	3	1473.672071	1473.674210	K	A	597	610
PSM	SGSLAVDNADPILK	1092	sp|P35573|GDE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3684.4	39.17012	2	1478.703447	1478.701790	K	I	876	890
PSM	IDFSSIAVPGTSSPR	1093	sp|Q5TDH0|DDI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4019.2	46.98561	3	1612.750571	1612.749803	R	Q	94	109
PSM	SKESVPEFPLSPPK	1094	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3616.4	37.46358	3	1620.779171	1620.780041	R	K	28	42
PSM	QLSLEGSGLGVEDLK	1095	sp|Q9UMZ2|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3995.2	46.5614	3	1623.778571	1623.775684	R	D	750	765
PSM	SLNLVDSPQPLLEK	1096	sp|P46019|KPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4062.2	47.82682	3	1631.819171	1631.817155	K	V	729	743
PSM	SLRPDPNFDALISK	1097	sp|Q06587|RING1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3857.4	43.43752	3	1651.798871	1651.797088	R	I	96	110
PSM	NLSFNELYPSGTLK	1098	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4196.2	49.78717	3	1661.773571	1661.770204	R	L	1539	1553
PSM	ALSRQLSSGVSEIR	1099	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3462.3	33.60785	2	1661.754647	1661.753917	R	H	76	90
PSM	DPGSVGDTIPSAELVK	1100	sp|Q14997|PSME4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3783.4	41.66677	2	1663.774047	1663.770598	R	R	1743	1759
PSM	VASMAPVTAEGFQER	1101	sp|Q969S3|ZN622_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3617.2	37.48305	3	1671.734471	1671.732773	K	V	36	51
PSM	SQGSQAELHPLPQLK	1102	sp|Q15172|2A5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3431.2	32.81638	3	1711.827971	1711.829451	R	D	46	61
PSM	RGSDASDFDLLETQSACSDTSESSAAGGQGNSR	1103	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3662.5	38.62423	4	3442.390894	3442.385244	R	R	7328	7361
PSM	SLSSPTVTLSAPLEGAK	1104	sp|Q96PU5|NED4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3890.3	44.19715	3	1736.861471	1736.859748	R	D	446	463
PSM	TITLEVEPSDTIENVK	1105	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3734.5	40.4313	3	1786.922471	1786.920025	K	A	12	28
PSM	QTGKTSIAIDTIINQK	1106	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3656.2	38.4623	3	1809.926771	1809.923745	R	R	215	231
PSM	QFASQANVVGPWIQTK	1107	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4147.2	49.04292	3	1852.889171	1852.887300	R	M	653	669
PSM	SYELPDGQVITIGNER	1108	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4166.4	49.25347	3	1869.851471	1869.850974	K	F	241	257
PSM	SFEAPATINSASLHPEK	1109	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3430.3	32.79502	3	1877.858171	1877.856059	K	E	219	236
PSM	KTSDFNTFLAQEGCTK	1110	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3578.3	36.51966	3	1925.824271	1925.823045	R	G	198	214
PSM	MSASDPNSSIFLTDTAK	1111	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3890.4	44.20049	3	1943.763971	1943.762492	K	Q	350	367
PSM	HLSSLTDNEQADIFER	1112	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3722.3	40.13498	3	1953.844871	1953.846951	R	V	483	499
PSM	LGLMRDDTIYEDEDVK	1113	sp|P14927|QCR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3635.6	37.9622	3	1990.859471	1990.859490	K	E	30	46
PSM	SQSSHSYDDSTLPLIDR	1114	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3604.4	37.15297	3	1999.855871	1999.852431	R	N	859	876
PSM	EGRQSGEAFVELGSEDDVK	1115	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3514.4	34.9103	3	2130.907271	2130.910674	R	M	50	69
PSM	ARSVDALDDLTPPSTAESGSR	1116	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3541.4	35.58502	3	2224.001471	2224.000886	R	S	491	512
PSM	YHTSQSGDEMTSLSEYVSR	1117	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3695.3	39.44508	4	2255.906094	2255.904208	R	M	457	476
PSM	TLNDRSSIVMGEPISQSSSNSQ	1118	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3520.4	35.06113	3	2416.058471	2416.057749	R	-	762	784
PSM	HNGTGGKSIYGEKFEDENFILK	1119	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3612.3	37.35638	4	2562.182494	2562.179185	R	H	70	92
PSM	NVNIYRDSAIPVESDTDDEGAPR	1120	sp|Q96D46|NMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3545.5	35.68727	3	2612.139971	2612.139170	K	I	455	478
PSM	HQGVMVGMGQKDSYVGDEAQSK	1121	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3057.4	23.40492	4	2447.014494	2446.029426	R	R	42	64
PSM	IVRASNGDAWVEAHGK	1122	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3117.3	24.93267	3	1788.827771	1788.830848	K	L	144	160
PSM	SPSTLLPK	1123	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	30.9397	2	921.456647	921.457250	R	K	825	833
PSM	QNPSRCSVSLSNVEAR	1124	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3387.5	31.69855	3	1865.8090	1865.8086	R	R	721	737
PSM	QQSTSSDRVSQTPESLDFLK	1125	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4597.2	54.28358	3	2395.0082	2394.9972	R	V	1000	1020
PSM	SLYPSLEDLK	1126	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4861.2	56.6555	2	1285.5863	1285.5838	M	V	2	12
PSM	KLSQMILDK	1127	sp|O00231|PSD11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3106.3	24.65792	2	1170.567647	1170.571963	R	K	364	373
PSM	STSVPQGHTWTQR	1128	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3204.6	27.11012	2	1605.6926	1605.6932	M	V	2	15
PSM	SIMSYNGGAVMAMK	1129	sp|P49720|PSB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4419.5	52.43392	2	1580.6469	1580.6433	M	G	2	16
PSM	SADAAAGAPLPR	1130	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3389.2	31.74012	2	1217.5421	1217.5436	M	L	2	14
PSM	SGSIKGSRYFQSPSR	1131	sp|Q16629|SRSF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3146.3	25.67573	4	1815.768494	1815.770629	R	S	181	196
PSM	GAGSVFR	1132	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3060.2	23.47502	2	772.324047	772.326904	K	A	11	18
PSM	AKSIVFHRK	1133	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2830.2	17.95017	3	1164.616871	1164.616879	K	K	133	142
PSM	QRASQDTEDEESGASGSDSGGSPLR	1134	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2944.3	20.6215	3	2602.028771	2602.041641	R	G	7	32
PSM	KLSDDNTIGKEEIQQR	1135	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3066.3	23.63337	4	1952.918494	1952.920451	K	L	1829	1845
PSM	MPSLPSYK	1136	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3281.4	29.01013	2	1017.423047	1017.424236	R	V	303	311
PSM	MPSLPSYK	1137	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3297.2	29.41757	2	1017.423047	1017.424236	R	V	303	311
PSM	HGSYEDAVHSGALND	1138	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3080.2	23.99253	3	1570.663571	1570.664814	K	-	542	557
PSM	KTSLAPYVK	1139	sp|P49642|PRI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3086.4	24.15433	2	1085.548247	1085.552213	K	V	385	394
PSM	TTIFSPEGR	1140	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	29.79188	2	1086.470847	1086.474691	R	L	9	18
PSM	LGSVDSFER	1141	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3355.2	30.89012	2	1088.453647	1088.453955	R	S	586	595
PSM	CSSILLHGK	1142	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3059.3	23.45253	2	1093.497647	1093.499132	R	E	518	527
PSM	SLQSVAEER	1143	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3184.3	26.62173	2	1097.474247	1097.475419	R	A	97	106
PSM	ERVPSVAEAPQLRPAGTAAAK	1144	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3292.2	29.28847	4	2198.126494	2198.120882	R	T	536	557
PSM	GRTASETRSEGSEYEEIPK	1145	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3061.4	23.50767	4	2204.957294	2204.958687	R	R	1081	1100
PSM	TRVTDSSVSVQLRE	1146	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	27.32307	3	1655.789171	1655.787980	R	-	262	276
PSM	GVSINQFCK	1147	sp|Q9Y3B7|RM11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3405.3	32.15642	2	1131.476647	1131.478396	R	E	43	52
PSM	NMSYQGFTK	1148	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3303.2	29.56537	2	1154.443647	1154.446762	R	D	333	342
PSM	QREESETRSESSDFEVVPK	1149	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3166.4	26.16027	4	2318.007694	2318.006365	R	R	1238	1257
PSM	TLSDYNIQK	1150	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3283.3	29.05873	2	1160.513447	1160.511470	R	E	55	64
PSM	DGSDVIYPAR	1151	sp|P25685|DNJB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3238.3	27.91963	2	1171.490847	1171.491069	R	I	250	260
PSM	LGSLVENNER	1152	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3227.5	27.65498	2	1209.538647	1209.539082	K	V	863	873
PSM	HQGVMVGMGQKDSYVGDEAQSK	1153	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3174.4	26.36628	4	2430.041294	2430.034511	R	R	42	64
PSM	DQVANSAFVER	1154	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3134.4	25.36975	2	1234.591847	1234.594215	K	L	500	511
PSM	DNSTMGYMMAK	1155	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3322.4	30.04967	2	1247.498447	1247.498465	R	K	486	497
PSM	VIGSGCNLDSAR	1156	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3007.4	22.13615	2	1247.589647	1247.592835	R	F	158	170
PSM	SGQGAFGNMCR	1157	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3171.4	26.28922	2	1263.456447	1263.452592	R	G	87	98
PSM	MKSLEQDALR	1158	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3155.4	25.90497	2	1269.577647	1269.578838	R	A	1506	1516
PSM	SMGLPTSDEQK	1159	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3164.5	26.11237	2	1271.509047	1271.510484	K	K	298	309
PSM	SFSSPENFQR	1160	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3336.5	30.41333	2	1277.510447	1277.507782	R	Q	134	144
PSM	NAGVEGSLIVEK	1161	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	30.81895	2	1294.618047	1294.616998	K	I	482	494
PSM	LFSQGQDVSNK	1162	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3278.4	28.93413	2	1301.564847	1301.565297	R	V	1797	1808
PSM	SSTKKSVQYDDVPEYK	1163	sp|Q13740|CD166_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3060.6	23.48835	3	1952.877371	1952.876854	R	D	72	88
PSM	EFDGKSLVSVTK	1164	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3406.2	32.17897	3	1388.656871	1388.658863	K	E	300	312
PSM	EFDGKSLVSVTK	1165	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	32.20433	3	1388.656871	1388.658863	K	E	300	312
PSM	EFDGKSLVSVTK	1166	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3408.2	32.2298	3	1388.656871	1388.658863	K	E	300	312
PSM	SRCVSVQTDPTDEIPTK	1167	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3343.4	30.59022	3	2091.864671	2091.858518	K	K	90	107
PSM	KASGPPVSELITK	1168	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3356.4	30.92147	2	1405.720247	1405.721798	R	A	34	47
PSM	HRGSADYSMEAK	1169	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2810.2	17.5129	3	1430.565071	1430.564979	K	K	214	226
PSM	LAEALPKQSVDGK	1170	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3060.4	23.48168	3	1434.708971	1434.711961	R	A	165	178
PSM	SWRESCDSALR	1171	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3078.3	23.94425	3	1445.576471	1445.575879	K	A	119	130
PSM	AHSSMVGVNLPQK	1172	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3244.6	28.08078	2	1446.668647	1446.669050	R	A	172	185
PSM	SGSMDPSGAHPSVR	1173	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2903.3	19.58975	3	1463.584571	1463.586443	R	Q	18	32
PSM	SFDPSAREPPGSTAGLPQEPK	1174	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3397.5	31.95633	3	2247.024071	2247.020893	K	T	1327	1348
PSM	TWNDPSVQQDIK	1175	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3377.6	31.45535	2	1509.649447	1509.650089	R	F	102	114
PSM	YHTSQSGDEMTSLSEYVSR	1176	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3393.6	31.85678	3	2271.898571	2271.899123	R	M	457	476
PSM	SRSLSQIHEAAVR	1177	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3009.2	22.1809	3	1532.745371	1532.746055	R	M	727	740
PSM	CPNLTHLNLSGNK	1178	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3347.2	30.68615	3	1546.697171	1546.696328	K	I	87	100
PSM	QKASIHEAWTDGK	1179	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3024.3	22.57127	3	1549.698371	1549.692623	R	E	401	414
PSM	NKSTESLQANVQR	1180	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2911.3	19.79522	3	1553.717471	1553.719900	R	L	104	117
PSM	LAVDEEENADNNTK	1181	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2917.4	19.9553	2	1560.687447	1560.690360	K	A	40	54
PSM	SQRYESLKGVDPK	1182	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2996.3	21.85785	3	1585.747271	1585.750138	R	F	26	39
PSM	NRVIGSGCNLDSAR	1183	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3068.4	23.6885	3	1597.701971	1597.703204	K	F	156	170
PSM	RKPSVPDSASPADDSFVDPGER	1184	sp|P16333|NCK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3306.5	29.65123	3	2408.066471	2408.064549	K	L	82	104
PSM	AQSQTDRVDLGTLR	1185	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	29.91513	3	1638.771071	1638.772664	K	G	93	107
PSM	SQSRSNSPLPVPPSK	1186	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3164.3	26.1057	3	1659.797471	1659.798150	R	A	297	312
PSM	RNSDSLPHRLSAAK	1187	sp|Q9BXJ9|NAA15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2983.2	21.53537	4	1710.759694	1710.760399	K	M	757	771
PSM	GVSLTNHHFYDESK	1188	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3225.3	27.59938	3	1712.724071	1712.719566	R	P	22	36
PSM	ALSRQEMQEVQSSR	1189	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3066.5	23.64003	3	1727.762171	1727.766198	K	S	187	201
PSM	FCSNSGRLSGPAELR	1190	sp|Q96PC5|MIA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3252.2	28.27348	3	1729.758071	1729.760719	R	S	1235	1250
PSM	RVSRSSFSSDPDEK	1191	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2858.2	18.59617	3	1755.688271	1755.686625	R	A	123	137
PSM	HASSGSFLPSANEHLK	1192	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3258.3	28.43193	3	1760.786171	1760.788314	R	E	115	131
PSM	RLSTSPDVIQGHQPR	1193	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3077.5	23.9247	3	1769.853371	1769.857397	R	D	264	279
PSM	SAWQATTQQAGLDCR	1194	sp|Q86UK7|ZN598_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3390.3	31.76933	3	1771.736171	1771.734899	K	V	851	866
PSM	LLPRYSHSGSSSPDTK	1195	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2963.5	21.03533	3	1810.825271	1810.825094	R	V	963	979
PSM	RLSQRPTPEELEQR	1196	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3098.4	24.45582	3	1817.877971	1817.878526	R	N	588	602
PSM	QLVRGEPNVSYICSR	1197	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3347.4	30.69282	3	1856.862671	1856.860433	K	Y	269	284
PSM	NKTSTTSSMVASAEQPR	1198	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3058.5	23.43335	3	1873.821971	1873.824107	K	R	17	34
PSM	QNPSRCSVSLSNVEAR	1199	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3180.4	26.52125	3	1882.834571	1882.835675	R	R	721	737
PSM	IARQESTSVLLQQSEK	1200	sp|Q14126|DSG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3228.6	27.6833	3	1895.934971	1895.935372	K	K	546	562
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	1201	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2979.2	21.43482	5	3188.316118	3188.312914	K	K	97	126
PSM	RKDSAIQQQVANLQMK	1202	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3318.5	29.9508	3	1936.959071	1936.955396	R	I	1227	1243
PSM	DHYGYRQSVTYACNK	1203	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3004.4	22.06012	3	1940.784671	1940.787662	R	G	241	256
PSM	AYSSFGGGRGSRGSAGGHGSR	1204	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2824.5	17.83788	4	2126.840094	2126.843294	R	S	11	32
PSM	KQSQIQNQQGEDSGSDPEDTY	1205	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3044.5	23.0799	3	2432.955971	2432.960537	R	-	899	920
PSM	EAAALGSRGSCSTEVEKETQEK	1206	sp|O75348|VATG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3009.5	22.1909	4	2446.064894	2446.068314	K	M	59	81
PSM	GRSSESSCGVDGDYEDAELNPR	1207	sp|P11274|BCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3263.4	28.56347	3	2478.959471	2478.959492	R	F	233	255
PSM	IVRGDQPAASGDSDDDEPPPLPR	1208	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3278.6	28.9408	3	2483.098571	2483.096577	K	L	45	68
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	1209	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3193.6	26.86102	3	2779.104371	2779.094999	K	M	571	596
PSM	NALLSLAK	1210	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3699.2	39.54333	2	908.472247	908.473234	R	G	178	186
PSM	KLSFDFQ	1211	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3807.2	42.263	2	963.410247	963.410300	R	-	465	472
PSM	SFAVGMFK	1212	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.3558.2	36.00793	2	981.400447	981.403106	K	G	72	80
PSM	GLTSVINQK	1213	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3491.2	34.31615	2	1038.509247	1038.511076	R	L	300	309
PSM	ALLYLCGGDD	1214	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3860.3	43.51067	2	1095.489647	1095.490661	K	-	330	340
PSM	RRTTQIINITMTK	1215	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3478.3	33.9853	3	1734.821771	1734.825308	R	K	1809	1822
PSM	TFSLSPDAPR	1216	sp|Q9UMF0|ICAM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3484.3	34.13982	2	1169.511847	1169.511805	R	L	223	233
PSM	TQWKLSLLD	1217	sp|O95163|ELP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4326.2	51.48617	2	1182.572047	1182.568591	R	-	1324	1333
PSM	LETVGSIFSR	1218	sp|Q9Y3D9|RT23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3915.2	44.76787	2	1187.559247	1187.558755	R	T	6	16
PSM	SRESMIQLF	1219	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4072.3	47.95733	2	1189.520647	1189.520261	K	-	449	458
PSM	TDGCHAYLSKNSLDCEIVSAK	1220	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3417.4	32.46907	4	2447.054894	2447.049827	K	S	413	434
PSM	ALSIGFETCR	1221	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3713.3	39.90323	2	1232.527647	1232.526075	K	Y	69	79
PSM	QRIDEFESM	1222	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3528.4	35.25855	2	1233.475647	1233.473705	K	-	569	578
PSM	RSSDSWEVWGSASTNR	1223	sp|Q8N6T3|ARFG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3594.3	36.89347	3	1903.788371	1903.785020	R	N	359	375
PSM	GLSASTMDLSSSS	1224	sp|Q9NSK0|KLC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3684.3	39.16678	2	1321.509247	1321.510878	R	-	607	620
PSM	KITIADCGQLE	1225	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3432.4	32.84803	2	1326.584247	1326.589069	K	-	155	166
PSM	QRMESALDQLK	1226	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3486.2	34.18827	3	1397.635871	1397.637416	R	Q	9	20
PSM	NSGSFPSPSISPR	1227	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3441.6	33.08687	2	1411.611647	1411.613310	R	-	1258	1271
PSM	RFSMVVQDGIVK	1228	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3628.2	37.76753	3	1457.708171	1457.710187	K	A	180	192
PSM	SIDLPIQSSLCR	1229	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.4011.2	46.88697	3	1467.679871	1467.679281	K	Q	579	591
PSM	SNSLRLSLIGDR	1230	sp|O94915|FRYL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3865.2	43.63783	3	1489.669271	1489.669124	R	R	1939	1951
PSM	TGTAEMSSILEER	1231	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3641.4	38.09863	2	1502.631847	1502.632390	K	I	46	59
PSM	DGAGNSFDLSSLSR	1232	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3860.6	43.52067	2	1504.620647	1504.619517	K	Y	1373	1387
PSM	GREFSFEAWNAK	1233	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3687.2	39.23775	3	1520.645771	1520.644944	R	I	718	730
PSM	TTPSVVAFTADGER	1234	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3542.4	35.60965	2	1529.677047	1529.676304	R	L	86	100
PSM	QMSCLMEALEDK	1235	sp|Q92896|GSLG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.4506.3	53.42707	2	1533.596247	1533.591454	R	R	1089	1101
PSM	NSSEASSGDFLDLK	1236	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3795.6	41.97427	2	1548.637247	1548.634499	R	G	86	100
PSM	DGSLASNPYSGDLTK	1237	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3484.5	34.14648	2	1603.677447	1603.676698	R	F	850	865
PSM	SKESVPEFPLSPPK	1238	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3624.3	37.66745	3	1620.779171	1620.780041	R	K	28	42
PSM	SKESVPEFPLSPPK	1239	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3608.2	37.24988	3	1620.779171	1620.780041	R	K	28	42
PSM	KQSLGELIGTLNAAK	1240	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3961.3	45.85667	3	1621.846271	1621.844038	R	V	56	71
PSM	GATLALTQVTPQDER	1241	sp|P43121|MUC18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3627.2	37.7418	3	1678.793171	1678.792731	R	I	98	113
PSM	DGSLIVSSSYDGLCR	1242	sp|P61964|WDR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3831.3	42.79837	3	1707.720071	1707.717517	R	I	182	197
PSM	RTSSEDNLYLAVLR	1243	sp|Q15149-4|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3878.3	43.95947	3	1715.828171	1715.824365	K	A	18	32
PSM	VQQTVQDLFGRAPSK	1244	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3551.3	35.83128	3	1752.854771	1752.856000	K	A	395	410
PSM	DCEECIQLEPTFIK	1245	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.3944.2	45.4991	3	1780.803671	1780.801173	K	G	416	430
PSM	TSDFNTFLAQEGCTK	1246	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3860.4	43.514	3	1797.729071	1797.728082	K	G	199	214
PSM	SLALDIDRDAEDQNR	1247	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3497.4	34.47048	3	1809.789971	1809.789436	K	Y	37	52
PSM	KFSAPRHGSLGFLPR	1248	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3517.2	34.9811	4	1828.852094	1828.853906	R	K	5	20
PSM	VSSKNSLESYAFNMK	1249	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3781.6	41.61563	3	1863.751271	1863.751534	K	A	536	551
PSM	NVSSFPDDATSPLQENR	1250	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3655.5	38.44725	3	1955.826971	1955.826216	R	N	52	69
PSM	RSDSASSEPVGIYQGFEK	1251	sp|Q05655|KPCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3535.5	35.43855	3	2035.890371	2035.888816	R	K	301	319
PSM	DSSTCPGDYVLSVSENSR	1252	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3826.3	42.67439	3	2051.814371	2051.814331	R	V	40	58
PSM	TYSVGVCTFAVGPEQGGCK	1253	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3835.5	42.90228	3	2095.876871	2095.874429	R	D	1833	1852
PSM	STAALSGEAASCSPIIMPYK	1254	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3936.4	45.3027	3	2132.961971	2132.952345	K	A	242	262
PSM	RKTSDFNTFLAQEGCTK	1255	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3529.6	35.2899	3	2161.893371	2161.890487	R	G	197	214
PSM	SSVSRVPCNVEGISPELEK	1256	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3538.4	35.51122	3	2166.003971	2166.002800	K	V	290	309
PSM	NPSTVEAFDLAQSNSEHSR	1257	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3500.5	34.55075	3	2167.919771	2167.917156	R	H	213	232
PSM	RISHSLYSGIEGLDESPSR	1258	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3568.4	36.27175	3	2182.014371	2182.005577	R	N	713	732
PSM	DNLTLWTSDMQGDGEEQNK	1259	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3632.5	37.88105	3	2195.929571	2195.927707	R	E	226	245
PSM	RLSSASTGKPPLSVEDDFEK	1260	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3606.6	37.21157	3	2322.023471	2322.018190	R	L	756	776
PSM	SRWDETPASQMGGSTPVLTPGK	1261	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3622.5	37.6225	3	2381.075771	2381.072277	K	T	336	358
PSM	SGSSSPDSEITELKFPSINHD	1262	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4390.2	52.08805	3	2405.973071	2405.966548	R	-	571	592
PSM	KGSCNLSRVDSTTCLFPVEEK	1263	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3728.3	40.27963	4	2586.094094	2586.089657	K	A	251	272
PSM	ERPTPSLNNNCTTSEDSLVLYNR	1264	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3584.6	36.6824	3	2759.234771	2759.222189	K	V	734	757
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1265	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3563.3	36.1398	5	3562.496618	3562.491898	K	V	60	92
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	1266	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3551.5	35.83795	4	3221.397694	3221.393230	R	S	38	70
PSM	HQGVMVGMGQKDSYVGDEAQSK	1267	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3190.2	26.7737	4	2446.024894	2446.029426	R	R	42	64
PSM	QTGKTSIAIDTIINQK	1268	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.3993.2	46.50813	3	1792.8980	1792.8967	R	R	215	231
PSM	CSLPAEEDSVLEK	1269	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3979.3	46.2446	2	1538.6257	1538.6206	K	L	635	648
PSM	DNLTLWTSDQQDDDGGEGNN	1270	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3971.2	46.07373	3	2193.871271	2192.873028	R	-	228	248
PSM	SGDEMIFDPTMSK	1271	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4141.2	48.93113	2	1594.5949	1594.5927	M	K	2	15
PSM	SGDEMIFDPTMSK	1272	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,5-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3968.2	46.00358	2	1594.5953	1594.5927	M	K	2	15
PSM	CSVSLSNVEAR	1273	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3739.4	40.55748	2	1283.5211	1283.5212	R	R	726	737
PSM	SMPDAMPLPGVGEELK	1274	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5299.2	59.75891	2	1791.7893	1791.7819	M	Q	2	18
PSM	ASGADSKGDDLSTAILK	1275	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3732.3	40.37593	3	1769.8066	1769.8079	M	Q	2	19
PSM	ATNWGSLLQDK	1276	sp|P48637|GSHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4892.2	56.95522	2	1353.5982	1353.5961	M	Q	2	13
PSM	QLSLPLTQSK	1277	sp|Q9C0I1|MTMRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4341.2	51.65432	2	1176.5781	1176.5786	R	S	562	572
PSM	MSGGWELELNGTEAK	1278	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3797.2	42.01183	3	1716.708671	1716.706618	K	L	105	120
PSM	ENILRASHSAVDITK	1279	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3261.3	28.50933	3	1732.847171	1732.850914	K	V	297	312
PSM	SAAEAGGVFHR	1280	sp|Q9BRF8|CPPED_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3321.6	30.03083	2	1222.5143	1222.5127	M	A	2	13
PSM	SIDPALSMLIK	1281	sp|Q9H501|ESF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.4127.2	48.69385	2	1282.623447	1282.624392	K	S	823	834
PSM	GLSEDVSISK	1282	sp|Q15029|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3380.2	31.51572	2	1113.495647	1113.495486	K	F	942	952
PSM	SIGVPIK	1283	sp|P62318|SMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3739.2	40.55082	2	834.4227	834.4247	M	V	2	9
PSM	RLSQIGVENTEENRR	1284	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3073.5	23.82078	3	1879.888871	1879.890153	K	L	43	58
PSM	DRSSFYVNGLTLGGQK	1285	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3824.3	42.62345	3	1821.833771	1820.845829	K	C	55	71
PSM	SLSFSGPR	1286	sp|Q5SYE7|NHSL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3290.2	29.23652	2	929.401247	929.400798	R	Y	1493	1501
PSM	VSLANLKPNPGSK	1287	sp|Q9P015|RM15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3293.2	29.31442	3	1403.717771	1403.717381	R	K	22	35
PSM	SVSQDLIK	1288	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3242.3	28.01968	2	968.455247	968.457978	R	K	377	385
PSM	SHEAEVLK	1289	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2842.3	18.23078	2	991.435047	991.437577	K	Q	63	71
PSM	HSVGVVIGR	1290	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3067.2	23.65578	2	1002.498847	1002.501180	R	S	332	341
PSM	KQSTDEEVTSLAK	1291	sp|P23193|TCEA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3074.3	23.84007	3	1514.685371	1514.686534	R	S	55	68
PSM	DVNAAIATIK	1292	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3386.2	31.6633	2	1014.569047	1014.570960	K	T	327	337
PSM	MPSLPSYK	1293	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3228.2	27.66997	2	1017.423647	1017.424236	R	V	303	311
PSM	TQSLSALPK	1294	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3232.3	27.77548	2	1023.500247	1023.500177	R	E	171	180
PSM	ISDLHRESVDHLTIPSR	1295	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3319.3	29.96963	4	2053.995294	2053.994619	K	C	495	512
PSM	TISETIER	1296	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3174.2	26.35962	2	1027.458047	1027.458706	R	L	700	708
PSM	RASSPFRR	1297	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2823.2	17.79925	3	1055.500271	1055.502577	K	V	620	628
PSM	RLASSVLR	1298	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	29.81638	2	1060.482247	1060.483161	K	C	9	17
PSM	INSSGESGDESDEFLQSRK	1299	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3232.4	27.77882	4	2163.902894	2163.895752	R	G	180	199
PSM	PYQYPALTPEQKK	1300	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3167.4	26.1859	3	1641.7826	1641.7799	M	E	2	15
PSM	NTVSQSISGDPEIDK	1301	sp|Q9BY44|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3177.4	26.4434	3	1668.72187064349	1668.7243758976404	R	K	521	536
PSM	SRSSRAGLQFPVGR	1302	sp|Q96QV6|H2A1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3368.2	31.22248	3	1676.756771	1676.754920	K	I	17	31
PSM	KLTGIKHELQANCYEEVK	1303	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3344.3	30.61227	4	2239.073294	2239.070820	K	D	127	145
PSM	DYHFKVDNDENEHQLSLR	1304	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3347.3	30.68948	4	2258.038894	2258.035223	K	T	28	46
PSM	DVSLGTYGSR	1305	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3282.4	29.03627	2	1133.475847	1133.475419	R	A	934	944
PSM	RHSSDINHLVTQGR	1306	sp|Q5T0N5|FBP1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3007.3	22.13282	3	1698.793571	1698.795131	R	E	486	500
PSM	GSSWSADLDK	1307	sp|Q9NP84|TNR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3348.4	30.71862	2	1144.446247	1144.443785	R	C	39	49
PSM	RSSSDEQGLSYSSLK	1308	sp|Q9NPH3|IL1AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3184.4	26.62507	3	1722.752771	1722.746174	R	N	554	569
PSM	SDLSSSSGSLSLSHGSSSLEHR	1309	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3255.3	28.35443	4	2295.990094	2295.996863	K	S	1279	1301
PSM	QLSSGVSEIR	1310	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	27.4949	2	1154.532847	1154.533268	R	H	80	90
PSM	RMQSLSLNK	1311	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3114.2	24.85522	2	1155.544447	1155.547144	K	-	173	182
PSM	CDEPILSNR	1312	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3113.2	24.83063	2	1182.474647	1182.474039	K	S	133	142
PSM	NSSISGPFGSR	1313	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3310.3	29.74627	2	1187.497047	1187.497217	R	S	483	494
PSM	RSSDGSLSHEEDLAK	1314	sp|Q13136|LIPA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3001.4	21.9859	3	1789.692971	1789.692104	K	V	237	252
PSM	IEAFRASLSK	1315	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3227.4	27.65165	2	1200.588047	1200.590389	K	L	147	157
PSM	SSSPVTELASR	1316	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3326.4	30.15275	2	1212.540047	1212.538748	R	S	1101	1112
PSM	SYSFDEIRK	1317	sp|P43490|NAMPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3283.5	29.0654	2	1223.523647	1223.522369	K	N	470	479
PSM	KFSEDFGQES	1318	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3289.4	29.21723	2	1252.465647	1252.464914	K	-	428	438
PSM	HQGVMVGMGQKDSYVGDEAQSK	1319	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3277.4	28.90932	4	2510.000094	2510.000842	R	R	42	64
PSM	LGMLSPEGTCK	1320	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3404.5	32.13715	2	1271.530047	1271.529111	R	A	203	214
PSM	KRSEGFSMDR	1321	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2695.2	16.29475	3	1307.529371	1307.532951	R	K	452	462
PSM	SYVKLPSASAQS	1322	sp|Q5T653|RM02_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3344.5	30.61893	2	1316.600847	1316.601348	K	-	294	306
PSM	YALYDATYETK	1323	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3379.4	31.49757	2	1336.616847	1336.618698	R	E	82	93
PSM	GRNSATSADEQPHIGNYR	1324	sp|Q7KZI7|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3001.5	21.98923	3	2051.882771	2051.881045	R	L	37	55
PSM	DMAQSIYRPSK	1325	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3166.6	26.16693	2	1374.600847	1374.600302	K	N	442	453
PSM	SVSLTGAPESVQK	1326	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3245.5	28.10298	2	1381.649047	1381.649027	R	A	191	204
PSM	IPGEKDSVICLK	1327	sp|P08174|DAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3353.2	30.84132	3	1437.696071	1437.693869	K	G	72	84
PSM	ISVREPMQTGIK	1328	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3311.5	29.77738	2	1437.707047	1437.705102	R	A	183	195
PSM	HSSWGDVGVGGSLK	1329	sp|O95210|STBD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3411.2	32.30733	3	1464.636071	1464.639859	R	A	209	223
PSM	KISSDLDGHPVPK	1330	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2982.2	21.50965	3	1471.706471	1471.707210	R	Q	102	115
PSM	SISADDDLQESSR	1331	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3112.5	24.8161	2	1501.591847	1501.593362	R	R	113	126
PSM	QGSIPSTQEMEAR	1332	sp|Q96K21|ANCHR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3199.5	26.98335	2	1512.631647	1512.627974	R	L	211	224
PSM	GRKESEFDDEPK	1333	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2833.2	18.00582	3	1515.621671	1515.624268	K	F	440	452
PSM	GLNSESMTEETLK	1334	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3358.6	30.97807	2	1517.632847	1517.632056	K	R	893	906
PSM	AHSSMVGVNLPQK	1335	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3143.3	25.59747	3	1542.630071	1542.630296	R	A	172	185
PSM	SMSVYCTPNKPSR	1336	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,2-UNIMOD:35,6-UNIMOD:4	ms_run[1]:scan=1.1.2897.2	19.47357	3	1621.663871	1621.662980	K	T	493	506
PSM	KVEEEQEADEEDVSEEEAESK	1337	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3000.5	21.96483	3	2437.014971	2437.013998	K	E	234	255
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1338	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3051.6	23.26108	3	2512.020371	2512.025203	R	A	19	51
PSM	SDSIRPALNSPVERPSSDQEEGETSAQTER	1339	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3248.6	28.18367	4	3351.487694	3351.485216	R	V	507	537
PSM	LIAPVAEEEATVPNNK	1340	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3403.4	32.10795	3	1693.890371	1693.888666	K	I	8	24
PSM	QEGRKDSLSVNEFK	1341	sp|Q99584|S10AD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3130.2	25.26152	3	1715.785271	1715.787980	R	E	26	40
PSM	AAMQRGSLPANVPTPR	1342	sp|P33240|CSTF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3161.4	26.03223	3	1760.837471	1760.839304	R	G	304	320
PSM	ERAMSTTSISSPQPGK	1343	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.2872.3	18.89973	3	1771.776071	1771.781180	K	L	265	281
PSM	VRRPSESDKEDELDK	1344	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2815.2	17.64003	4	1881.84729419132	1881.8469506418103	R	V	623	638
PSM	RRDSAPYGEYGSWYK	1345	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3385.3	31.64182	3	1913.802071	1913.809778	K	A	425	440
PSM	SHTSLKDELSDVSQGGSK	1346	sp|O60271-2|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3237.3	27.89537	3	1953.869771	1953.868081	R	A	242	260
PSM	RSSQPSPTAVPASDSPPTK	1347	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2982.6	21.52298	3	1988.916671	1988.920451	R	Q	111	130
PSM	NIRNSMRADSVSSSNIK	1348	sp|Q53F19|NCBP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3020.6	22.47763	3	2037.869471	2037.870420	K	N	435	452
PSM	DRQSLDGFYSHGMGAEGR	1349	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	31.75345	3	2061.842171	2061.836403	R	E	1504	1522
PSM	SPPREGSQGELTPANSQSR	1350	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2905.4	19.6441	3	2076.923771	2076.922576	K	M	468	487
PSM	TCSMVGNGDTTSQDDCVSK	1351	sp|Q6NYC1|JMJD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,3-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2994.5	21.81568	3	2140.771871	2140.774851	R	E	379	398
PSM	SQSESSDEVTELDLSHGKK	1352	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3180.6	26.52792	3	2154.928571	2154.931803	R	D	657	676
PSM	KVTAEADSSSPTGILATSESK	1353	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3331.5	30.28438	3	2158.009571	2158.004240	R	S	485	506
PSM	RFSQGPTPAAAVPEGTAAEGAPR	1354	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3340.6	30.51922	3	2317.088771	2317.085224	R	Q	234	257
PSM	LGADESEEEGRRGSLSNAGDPEIVK	1355	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3212.4	27.30448	4	2694.220494	2694.213398	R	S	81	106
PSM	RVSVCAETYNPDEEEEDTDPRVIHPK	1356	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3326.5	30.15608	5	3164.382618	3164.375789	R	T	97	123
PSM	SVPTWLK	1357	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3691.2	39.33883	2	909.436647	909.436121	R	L	21	28
PSM	DIGFIKLD	1358	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4095.2	48.28783	2	919.502047	919.501484	K	-	49	57
PSM	KLSELLR	1359	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3418.2	32.48815	2	937.498847	937.499783	K	Y	458	465
PSM	KLSFDFQ	1360	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3817.2	42.4829	2	963.410247	963.410300	R	-	465	472
PSM	SLDFYTR	1361	sp|Q04760|LGUL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3542.2	35.60298	2	980.399047	980.400463	K	V	45	52
PSM	SSIAGLLLK	1362	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3982.2	46.3097	2	980.530447	980.530749	R	A	2833	2842
PSM	DLTDYLMK	1363	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3904.2	44.53831	2	997.480447	997.479034	R	I	186	194
PSM	GFSLEELR	1364	sp|P26373|RL13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3827.4	42.6999	2	1029.452447	1029.453227	R	V	75	83
PSM	NCSSFLIK	1365	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3469.2	33.76472	2	1047.444847	1047.446034	R	R	12	20
PSM	NATLSQVLR	1366	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3552.2	35.85383	2	1080.530647	1080.532874	R	E	205	214
PSM	SKAELLLLK	1367	sp|Q8WUA4|TF3C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3540.3	35.55702	2	1093.615647	1093.614813	K	L	147	156
PSM	TAPYVVTGSVDQTVK	1368	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3438.3	32.99903	3	1643.780171	1643.780769	K	V	391	406
PSM	DQLIYNLLK	1369	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4134.2	48.79397	2	1118.633247	1118.633560	K	E	6	15
PSM	NMSIIDAFK	1370	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3735.3	40.45055	2	1133.482447	1133.482813	R	S	617	626
PSM	SFSQMISEK	1371	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3461.2	33.5704	2	1135.460647	1135.462077	K	Q	1043	1052
PSM	HASDFALWK	1372	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3615.3	37.4341	2	1153.496247	1153.495761	R	A	225	234
PSM	SGNYFFLDD	1373	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.5283.2	59.64522	2	1156.412047	1156.411422	K	-	591	600
PSM	SQGMALSLGDK	1374	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3426.2	32.6947	2	1185.508247	1185.510090	K	I	933	944
PSM	YGSDIVPFSK	1375	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3786.3	41.73402	2	1191.518847	1191.521307	R	V	316	326
PSM	TSDFNTFLAQEGCTK	1376	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3812.5	42.39137	3	1797.732071	1797.728082	K	G	199	214
PSM	SMSAPVIFDR	1377	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3802.3	42.1421	2	1201.520647	1201.520261	K	S	117	127
PSM	SMSAPVIFDR	1378	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3811.6	42.3703	2	1201.520647	1201.520261	K	S	117	127
PSM	SISLYYTGEK	1379	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3535.4	35.43521	2	1239.541447	1239.542436	R	G	458	468
PSM	KISELDAFLK	1380	sp|Q06323|PSME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3928.2	45.09357	2	1242.626647	1242.626106	K	E	36	46
PSM	SQVFSTAADGQTQVEIK	1381	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3540.5	35.56368	3	1887.866171	1887.861539	K	V	469	486
PSM	SSSSPLVVVSVK	1382	sp|Q96B01|R51A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3633.4	37.9036	2	1267.640847	1267.642485	R	S	315	327
PSM	ASGPPVSELITK	1383	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3619.4	37.54153	2	1277.625647	1277.626835	K	A	35	47
PSM	GASEPRLSVAPEMDIMDYCKK	1384	sp|Q96BN8|OTUL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.4038.2	47.31822	4	2556.050094	2556.050101	R	E	74	95
PSM	TSRPENAIIYNNNEDFQVGQAK	1385	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3549.5	35.78713	4	2587.175694	2587.170411	R	V	472	494
PSM	DITEEIMSGAR	1386	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3809.4	42.32157	2	1300.539247	1300.537033	K	T	191	202
PSM	QASLDGLQQLR	1387	sp|Q3MII6|TBC25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3589.3	36.79173	2	1307.623447	1307.623480	R	D	504	515
PSM	RASSLNFLNK	1388	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3598.5	37.00162	2	1308.563247	1308.562868	K	S	579	589
PSM	RYSDFEWLK	1389	sp|Q9UMY4|SNX12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3854.3	43.36018	2	1322.565247	1322.569654	R	N	71	80
PSM	EFSPFGSITSAK	1390	sp|Q13310|PABP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3931.3	45.17297	2	1349.593247	1349.590449	K	V	313	325
PSM	SFSEDVFQSVK	1391	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3858.3	43.46293	2	1351.577047	1351.569714	K	S	18	29
PSM	DVIELTDDSFDK	1392	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3782.5	41.63782	2	1395.641247	1395.640556	K	N	161	173
PSM	MFGSSVDLGNLGQ	1393	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4893.2	56.97987	2	1403.581847	1403.579232	K	-	392	405
PSM	EQFLDGDGWTSR	1394	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3618.6	37.52225	2	1409.620847	1409.621158	K	W	25	37
PSM	SILKLDGDVLMK	1395	sp|Q9BRT6|LLPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3918.2	44.843	3	1410.718271	1410.719355	K	D	31	43
PSM	CLELFSELAEDK	1396	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4178.3	49.54255	2	1452.678047	1452.680647	K	E	412	424
PSM	GRMSMKEVDEQMLNVQNK	1397	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3479.6	34.02053	3	2215.980671	2215.978910	R	N	319	337
PSM	NLGIGKVSSFEEK	1398	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3489.2	34.26537	3	1486.707371	1486.706876	K	M	302	315
PSM	DGAGNSFDLSSLSR	1399	sp|P11717|MPRI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3868.4	43.72382	2	1504.620647	1504.619517	K	Y	1373	1387
PSM	TSSTDEVLSLEEK	1400	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3542.3	35.60632	2	1516.654447	1516.654566	R	D	528	541
PSM	SWTSSSSLSDTYEPNYGTVK	1401	sp|Q8TEU7|RPGF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3744.3	40.69287	3	2287.956371	2287.952204	K	Q	1432	1452
PSM	KGSSSSVCSVASSSDISLGSTK	1402	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3433.5	32.87663	3	2289.946571	2289.943704	R	T	1382	1404
PSM	SLTNDWEDHLAVK	1403	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3575.4	36.44543	3	1526.736671	1526.736522	K	H	315	328
PSM	TTPSVVAFTADGER	1404	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3559.4	36.03997	2	1529.677047	1529.676304	R	L	86	100
PSM	QAGSLASLSDAPPLK	1405	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3692.3	39.36775	3	1533.740771	1533.743990	K	S	276	291
PSM	QMSCLMEALEDK	1406	sp|Q92896|GSLG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:4,6-UNIMOD:35	ms_run[1]:scan=1.1.3849.2	43.24022	2	1549.589647	1549.586369	R	R	1089	1101
PSM	DLSMSEEDQMMR	1407	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3600.3	37.0466	3	1550.548571	1550.545232	R	A	1366	1378
PSM	TTPSYVAFTDTER	1408	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3524.4	35.15983	2	1566.658647	1566.660320	R	L	37	50
PSM	SNSVEKPVSSILSR	1409	sp|Q9UI08|EVL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3440.4	33.05416	3	1581.773171	1581.776352	R	T	329	343
PSM	DASRGLATFCLDK	1410	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3714.3	39.92912	3	1612.638971	1612.635776	R	E	120	133
PSM	EKSMPWNVDTLSK	1411	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3631.3	37.84845	3	1613.714771	1613.716060	K	D	109	122
PSM	QRSQVEEELFSVR	1412	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3635.3	37.9522	3	1685.780171	1685.777415	R	V	2359	2372
PSM	YDSRTTIFSPEGR	1413	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3438.4	33.00237	3	1687.661771	1687.664433	R	L	5	18
PSM	GYSFTTTAEREIVR	1414	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3686.4	39.21958	3	1708.785071	1708.782166	R	D	197	211
PSM	NQLTSNPENTVFDAK	1415	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3622.4	37.61917	3	1756.767971	1756.766910	K	R	82	97
PSM	TLSNAEDYLDDEDSD	1416	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3976.2	46.17067	2	1780.625047	1780.620031	R	-	200	215
PSM	TLSNAEDYLDDEDSD	1417	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3996.3	46.59635	2	1780.625047	1780.620031	R	-	200	215
PSM	INPDGSQSVVEVPYAR	1418	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3617.4	37.48972	3	1809.832871	1809.829845	R	S	58	74
PSM	QISQDVKLEPDILLR	1419	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4080.2	48.06393	3	1845.961571	1845.960130	R	A	166	181
PSM	KEESEESDDDMGFGLFD	1420	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4191.2	49.69998	2	1948.758247	1948.752033	K	-	98	115
PSM	NSSLGSPSNLCGSPPGSIR	1421	sp|Q9C0B0|UNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3444.3	33.15479	3	1965.874571	1965.861556	R	K	373	392
PSM	SCGSSTPDEFPTDIPGTK	1422	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3694.3	39.4226	3	1974.792371	1974.791804	R	G	104	122
PSM	KLSRADLTEYLSTHYK	1423	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3613.2	37.37888	4	2003.974094	2003.971758	R	A	210	226
PSM	KLSRADLTEYLSTHYK	1424	sp|P31930|QCR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3605.4	37.179	4	2003.974094	2003.971758	R	A	210	226
PSM	GSLESPATDVFGSTEEGEK	1425	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3755.5	40.97205	3	2018.837471	2018.835777	K	R	331	350
PSM	SDRGSGQGDSLYPVGYLDK	1426	sp|Q5J8M3|EMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3701.3	39.59697	3	2092.915271	2092.910280	R	Q	32	51
PSM	STSTPNVHMVSTTLPVDSR	1427	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3562.4	36.11732	3	2107.962371	2107.960935	R	M	257	276
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1428	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3993.5	46.52147	3	2407.998371	2407.988786	R	-	223	246
PSM	QLSLSSSRSSEGSLGGQNSGIGGR	1429	sp|Q9UGP4|LIMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3417.5	32.4724	3	2480.068271	2480.069390	R	S	231	255
PSM	RKNSNVDSSYLESLYQSCPR	1430	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3603.4	37.12725	3	2482.096871	2482.094803	K	G	628	648
PSM	SNTKGSMSDGSYSPDYSLAAVDLK	1431	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3772.6	41.39682	3	2572.096271	2572.104030	R	S	475	499
PSM	SQSSEGVSSLSSSPSNSLETQSQSLSR	1432	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3574.6	36.42645	3	2835.246071	2835.240735	R	S	76	103
PSM	IRYESLTD	1433	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3330.2	30.24865	2	1075.4603	1075.4582	K	P	54	62
PSM	ERHPSWRSEETQER	1434	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2852.4	18.47668	4	1905.814894	1905.811903	R	E	402	416
PSM	QASVADYEETVK	1435	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3584.3	36.6724	2	1401.5703	1401.5696	R	K	82	94
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	1436	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3713.6	39.91323	4	3206.393694	3205.398315	R	S	38	70
PSM	QLVRGEPNVSYICSR	1437	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3703.3	39.64685	3	1839.8414	1839.8334	K	Y	269	284
PSM	IVRGDQPAASGDSDDDEPPPLPR	1438	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3273.3	28.80743	4	2484.121294	2483.096577	K	L	45	68
PSM	SLVIPEK	1439	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3662.3	38.61757	2	906.4435	906.4458	M	F	2	9
PSM	QKHSQAVEELAEQLEQTK	1440	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3903.2	44.51115	3	2157.9985	2157.9938	R	R	1192	1210
PSM	MEPSSLELPADTVQR	1441	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3864.2	43.60912	3	1809.7886	1809.7851	-	I	1	16
PSM	MEPSSLELPADTVQR	1442	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3856.2	43.40572	3	1809.7886	1809.7851	-	I	1	16
PSM	YAKESLKEEDESDDDNM	1443	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=1.1.2873.6	18.9351	3	2112.769871	2112.771857	K	-	239	256
PSM	SASSGAEGDVSSEREP	1444	sp|Q8TEA8|DTD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2940.6	20.54463	2	1644.634447	1643.631204	R	-	194	210
PSM	PSVPAAEPEYPK	1445	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3253.4	28.30605	2	1363.6045	1363.6056	A	G	3	15
PSM	CNSLSTLEK	1446	sp|P13473|LAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3554.2	35.90563	2	1113.4391	1113.4408	R	N	153	162
PSM	QQENMQRQSRGEPPLPEEDLSK	1447	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3201.4	27.02865	4	2675.198494	2675.201059	R	L	282	304
PSM	SGGGPVLSWQR	1448	sp|Q53GL7|PAR10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3573.4	36.39445	2	1222.550047	1222.549587	R	L	37	48
PSM	KQLSWLINR	1449	sp|Q8NHM5|KDM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4422.2	52.4961	2	1237.6332	1236.6372	K	L	1139	1148
PSM	AASPPASASDLIEQQQK	1450	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3461.3	33.57373	3	1820.822171	1819.835324	R	R	333	350
PSM	AQALRDNSTMGYMMAK	1451	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3485.5	34.1723	3	1867.769171	1866.782776	K	K	481	497
PSM	GAGSVFR	1452	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3068.2	23.68183	2	772.324047	772.326904	K	A	11	18
PSM	VGVNGFGR	1453	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3071.2	23.7591	2	804.422247	804.424236	K	I	6	14
PSM	KRSLGLEDPSR	1454	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2952.4	20.7545	3	1336.648871	1336.650030	R	L	16	27
PSM	QLSLTPR	1455	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3247.2	28.1445	2	893.434447	893.437183	R	T	55	62
PSM	IMSSPLSK	1456	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.2	29.9663	2	941.430247	941.429321	K	E	29	37
PSM	VISSIEQK	1457	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	29.9408	2	982.471847	982.473628	R	T	63	71
PSM	ALPRRSTSPIIGSPPVR	1458	sp|Q86TB9|PATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3358.2	30.96473	4	1962.982094	1962.980563	R	A	172	189
PSM	SCNCLLLK	1459	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3214.2	27.34855	2	1006.494247	1006.493973	K	V	336	344
PSM	NASASFQELEDKK	1460	sp|Q99543|DNJC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3163.3	26.07963	3	1545.672071	1545.671219	R	E	45	58
PSM	NASASFQELEDKK	1461	sp|Q99543|DNJC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3267.2	28.66002	3	1545.666371	1545.671219	R	E	45	58
PSM	YLSNAYAR	1462	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3223.2	27.54802	2	1036.440447	1036.437911	R	E	209	217
PSM	RQGSFSEDVISHK	1463	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3087.2	24.17333	3	1568.695871	1568.698436	K	G	3924	3937
PSM	QPTIFQNK	1464	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3176.2	26.41098	2	1054.483447	1054.484862	K	K	13	21
PSM	YNQSISLR	1465	sp|Q9UBH6|XPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3180.3	26.51792	2	1059.472847	1059.475025	K	R	663	671
PSM	SMSTEGLMK	1466	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3246.3	28.12212	2	1062.411047	1062.412684	K	F	451	460
PSM	QRYSYQYTVANK	1467	sp|Q969X5|ERGI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3086.3	24.151	3	1599.703571	1599.708273	K	E	203	215
PSM	TASVPLDAVR	1468	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3386.3	31.66663	2	1107.531247	1107.532540	R	A	127	137
PSM	NQIHVKSPPREGSQGELTPANSQSR	1469	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3004.3	22.05678	5	2796.333118	2796.330434	R	M	462	487
PSM	KQSVEDILK	1470	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3227.3	27.64832	2	1138.561447	1138.563506	R	D	406	415
PSM	IYQYIQSR	1471	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3059.5	23.4592	2	1149.519447	1149.521975	R	F	318	326
PSM	NSSTYWEGK	1472	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3127.3	25.18867	2	1150.433247	1150.433220	K	A	280	289
PSM	ERAMSTTSISSPQPGK	1473	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3018.2	22.41277	3	1755.786671	1755.786265	K	L	265	281
PSM	RTSLPCIPR	1474	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3272.3	28.78313	2	1178.561447	1178.563129	R	E	310	319
PSM	SIFKEVEEK	1475	sp|Q2NL82|TSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3265.4	28.6148	2	1187.546847	1187.547522	K	E	539	548
PSM	DVQDSLTVSNEAQTAK	1476	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3203.3	27.07515	3	1784.780771	1784.782954	K	E	211	227
PSM	ARAHSIQIMK	1477	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2964.2	21.05168	3	1233.606071	1233.605328	R	V	119	129
PSM	SIAEGIGPEER	1478	sp|P57678|GEMI4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3237.2	27.89203	2	1236.543047	1236.538748	K	R	1037	1048
PSM	KRPSWFTQN	1479	sp|Q9BYC8|RM32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3198.4	26.95588	2	1242.554047	1242.554673	R	-	180	189
PSM	LVINSGNGAVEDRKPSGLNGEASK	1480	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3178.6	26.4759	4	2491.203294	2491.206796	K	S	682	706
PSM	SLGSAGPSGTLPR	1481	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3262.5	28.54168	2	1278.594047	1278.596931	R	S	332	345
PSM	SASAPTLAETEK	1482	sp|Q86W92-2|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3061.6	23.51433	2	1283.565247	1283.564628	R	E	532	544
PSM	LGSYSGPTSVSR	1483	sp|Q9BZ23|PANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3163.6	26.08963	2	1289.566447	1289.565297	R	Q	187	199
PSM	KFTYLGSQDR	1484	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3162.5	26.06063	2	1293.576647	1293.575468	R	A	296	306
PSM	ISVYYNEATGGK	1485	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3198.5	26.95922	2	1300.624847	1300.629932	R	Y	47	59
PSM	NFSDNQLQEGK	1486	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3114.4	24.86188	2	1358.548247	1358.550375	R	N	161	172
PSM	RSSPPGHYYQK	1487	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2789.2	17.16962	3	1398.611771	1398.608165	R	S	121	132
PSM	NNASTDYDLSDK	1488	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3038.6	22.93262	2	1421.538647	1421.534785	K	S	301	313
PSM	AQSREQLAALKK	1489	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2922.5	20.0772	3	1421.736971	1421.739179	R	H	61	73
PSM	TNSMSSSGLGSPNR	1490	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2973.5	21.29327	2	1473.594047	1473.591922	R	S	155	169
PSM	SCFESSPDPELK	1491	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3301.4	29.52205	2	1474.568647	1474.568728	R	S	871	883
PSM	SCFESSPDPELK	1492	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3293.5	29.32442	2	1474.568647	1474.568728	R	S	871	883
PSM	RTTRYDIDMTK	1493	sp|O00217|NDUS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3015.3	22.33902	3	1478.657471	1478.658880	R	C	139	150
PSM	FGPARNDSVIVADQTPTPTR	1494	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3385.5	31.64848	3	2221.052471	2221.052862	K	F	55	75
PSM	SSGGSEHSTEGSVSLGDGQLNR	1495	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3130.5	25.27152	3	2239.934171	2239.934263	R	Y	381	403
PSM	EFKRETGVDLTK	1496	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3001.2	21.97923	3	1501.717271	1501.717775	K	D	289	301
PSM	SLYASSPGGVYATR	1497	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3386.6	31.67663	2	1507.667647	1507.670825	R	S	51	65
PSM	FARRSVSDNDIR	1498	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2901.5	19.54493	3	1514.697971	1514.699105	R	K	742	754
PSM	SREDLSAQPVQTK	1499	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2921.3	20.04465	3	1537.712771	1537.713752	K	F	617	630
PSM	SKSSLHLLSHETK	1500	sp|O95684|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2982.3	21.51298	3	1545.756071	1545.755223	K	I	213	226
PSM	KQSGSPTLDTAPNGR	1501	sp|Q9H2J7|S6A15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2900.2	19.50815	3	1607.729471	1607.730465	R	Y	697	712
PSM	SQSRSNSPLPVPPSK	1502	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3125.3	25.13703	3	1659.796571	1659.798150	R	A	297	312
PSM	NTVSQSISGDPEIDK	1503	sp|Q9BY44|EIF2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3175.6	26.39865	2	1668.724247	1668.724376	R	K	521	536
PSM	SSLGSLQTPEAVTTRK	1504	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3328.3	30.20052	3	1753.863971	1753.861145	R	G	386	402
PSM	SSLGSLQTPEAVTTRK	1505	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3336.4	30.41	3	1753.863971	1753.861145	R	G	386	402
PSM	RPSDQEVSESMDFR	1506	sp|Q04864|REL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3305.3	29.61932	3	1761.702671	1761.702929	R	Y	265	279
PSM	LPSKADTSQEICSPR	1507	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3074.5	23.84673	3	1767.787871	1767.786265	R	L	1016	1031
PSM	RPFLSRESLSGQAVR	1508	sp|P0C7P4|UCRIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3243.5	28.05187	3	1781.892671	1781.893782	K	R	56	71
PSM	NTVSQSISGDPEIDKK	1509	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3044.4	23.07657	3	1796.818571	1796.819339	R	I	521	537
PSM	FESSYRNSLDSFGGR	1510	sp|Q5BKZ1|ZN326_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3387.3	31.69188	3	1800.752771	1800.746843	R	N	111	126
PSM	DKPHVNVGTIGHVDHGK	1511	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2969.4	21.18705	4	1808.927694	1808.928179	R	T	54	71
PSM	RYDSRTTIFSPEGR	1512	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3280.2	28.97775	3	1843.769171	1843.765544	R	L	4	18
PSM	NGRYSISRTEAADLCK	1513	sp|P16070|CD44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3161.2	26.02557	4	1919.859694	1919.856076	K	A	39	55
PSM	KSSEGGVGVGPGGGDEPPTSPR	1514	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3048.4	23.17907	3	2102.921171	2102.926992	R	Q	1184	1206
PSM	TKEERSSQDHVDEEVFK	1515	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2999.4	21.93732	4	2141.926894	2141.926658	R	R	410	427
PSM	AGSSGNSCITYQPSVSGEHK	1516	sp|Q99755|PI51A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3095.4	24.38157	3	2144.875571	2144.883413	R	A	473	493
PSM	NYSREQHGVAASCLEDLR	1517	sp|O00273|DFFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3338.4	30.46098	3	2183.946671	2183.941931	R	S	26	44
PSM	QDGPMPKPHSVSLNDTETRK	1518	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3062.3	23.52997	4	2316.055694	2316.056961	K	L	155	175
PSM	GGGGNFGPGPGSNFRGGSDGYGSGR	1519	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3267.6	28.67335	3	2349.954671	2349.951250	R	G	214	239
PSM	KSCVEEPEPEPEAAEGDGDKK	1520	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.2915.2	19.8967	3	2379.978971	2379.977767	K	G	106	127
PSM	EVEDKESEGEEEDEDEDLSK	1521	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2957.6	20.8909	3	2418.896471	2418.895931	K	Y	147	167
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	1522	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3345.6	30.64783	3	2418.915071	2418.911873	R	R	42	68
PSM	IVRGDQPAASGDSDDDEPPPLPR	1523	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	28.96245	3	2483.098571	2483.096577	K	L	45	68
PSM	ERPERCSSSSGGGSSGDEDGLELDGAPGGGK	1524	sp|Q9P258|RCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3126.4	25.16627	4	3086.251294	3086.252045	R	R	37	68
PSM	SVPTWLK	1525	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3682.2	39.11362	2	909.436647	909.436121	R	L	21	28
PSM	SLSGLILK	1526	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3923.2	44.9698	2	909.491447	909.493635	R	N	74	82
PSM	NLSFEIK	1527	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3670.2	38.81217	2	929.424047	929.425950	R	K	433	440
PSM	KLSFDFQ	1528	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3827.2	42.69323	2	963.410247	963.410300	R	-	465	472
PSM	SLSPILPGR	1529	sp|Q6ZSZ5|ARHGI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3601.2	37.069	2	1018.521047	1018.521247	R	H	1289	1298
PSM	TSLPCIPR	1530	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3497.2	34.46382	2	1022.459647	1022.462018	R	E	311	319
PSM	SPSVAAMASPQLCR	1531	sp|P25325-2|THTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3482.3	34.08817	3	1553.670371	1553.673150	R	A	15	29
PSM	SLPGLASSVK	1532	sp|Q9NUL7|DDX28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3500.2	34.54075	2	1037.513847	1037.515827	R	E	524	534
PSM	GISLNPEQWSQLK	1533	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4258.2	50.6111	3	1578.745271	1578.744324	K	E	102	115
PSM	HGSLGFLPR	1534	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3488.3	34.2431	2	1062.500247	1062.501180	R	K	11	20
PSM	DFSLEQLR	1535	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3855.2	43.38113	2	1086.475247	1086.474691	R	Q	102	110
PSM	DLSTIEPLK	1536	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3738.3	40.52825	2	1094.525447	1094.526058	K	K	102	111
PSM	DASLMVTNDGATILK	1537	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3699.3	39.54667	3	1643.748071	1643.747755	R	N	58	73
PSM	DKFSFDLGKGEVIK	1538	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3738.4	40.53158	3	1661.804171	1661.806590	K	A	75	89
PSM	GSSIFGLAPGK	1539	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3761.2	41.10747	2	1112.524847	1112.526726	R	A	393	404
PSM	RPSWFTQN	1540	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3432.3	32.8447	2	1114.457447	1114.459709	K	-	181	189
PSM	IKRDSQGELMVYPYYGEK	1541	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3505.5	34.68048	4	2255.030094	2255.033372	R	S	1579	1597
PSM	MESALDQLK	1542	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3474.2	33.88448	2	1129.471047	1129.472642	R	Q	11	20
PSM	GSSIFGLAPSK	1543	sp|P09923|PPBI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3741.3	40.60565	2	1142.535847	1142.537291	R	A	390	401
PSM	AGPNASIISLK	1544	sp|Q9H0A0|NAT10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3551.2	35.82795	2	1149.578247	1149.579490	K	S	979	990
PSM	ASSLEDLVLK	1545	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3889.2	44.16833	2	1153.563447	1153.563172	R	E	254	264
PSM	ELSLDDPEVEQVSGR	1546	sp|Q9BTE6|AASD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3742.3	40.63118	3	1751.759471	1751.761490	R	G	172	187
PSM	NFEDVAFDEK	1547	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3494.3	34.39252	2	1212.529247	1212.529883	K	K	376	386
PSM	SMSAPVIFDR	1548	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3530.3	35.30483	2	1217.515047	1217.515176	K	S	117	127
PSM	SVDFDSLTVR	1549	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3828.5	42.72878	2	1217.533247	1217.532934	K	T	458	468
PSM	AHSIQIMKVEEIAASK	1550	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3597.4	36.97235	3	1833.906071	1833.905986	R	C	121	137
PSM	DLFDPIIEDR	1551	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4178.2	49.53255	2	1231.609247	1231.608468	K	H	87	97
PSM	TGTLQPWNSDSTLNSR	1552	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3616.5	37.46692	3	1855.809971	1855.810172	K	Q	249	265
PSM	SIYYITGESK	1553	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3439.4	33.02818	2	1239.541247	1239.542436	K	E	258	268
PSM	TLPQLPNEEK	1554	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3421.3	32.56887	2	1247.578247	1247.579884	R	S	644	654
PSM	VLQSFTVDSSK	1555	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3428.2	32.74635	2	1289.589847	1289.590449	R	A	1439	1450
PSM	RLSSVMTIVK	1556	sp|Q9HC36|MRM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3921.3	44.92232	2	1292.599447	1292.596477	R	S	103	113
PSM	LAKLSDGVAVLK	1557	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3482.2	34.08484	3	1292.708771	1292.710505	R	V	394	406
PSM	SNSLSEQLAINTSPDAVK	1558	sp|Q5T1M5|FKB15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3692.4	39.37108	3	1952.909471	1952.909217	K	A	344	362
PSM	NSLESYAFNMK	1559	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3629.5	37.80368	2	1302.590847	1302.591438	K	A	540	551
PSM	SVPTSTVFYPSDGVATEK	1560	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3731.3	40.34682	3	1963.886171	1963.881605	R	A	439	457
PSM	SPSISNMAALSR	1561	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3543.4	35.63443	2	1312.582647	1312.584652	R	A	341	353
PSM	GGYIGSTYFER	1562	sp|P61081|UBC12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3702.3	39.62188	2	1328.544847	1328.543833	R	C	170	181
PSM	TNSTFNQVVLK	1563	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3522.3	35.10685	2	1329.635047	1329.632983	R	R	39	50
PSM	LLGSVQQDLER	1564	sp|Q96AQ6|PBIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3731.4	40.35015	2	1336.640047	1336.638796	R	S	404	415
PSM	SLSLQPQLTQR	1565	sp|P21731|TA2R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3506.5	34.70647	2	1349.669847	1349.670431	R	S	329	340
PSM	SMPWNVDTLSK	1566	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3924.3	44.99527	2	1356.582647	1356.578504	K	D	111	122
PSM	DTQSPSTCSEGLLGWSQK	1567	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3928.3	45.0969	3	2059.863371	2059.855802	K	D	709	727
PSM	TSSVFEDPVISK	1568	sp|Q9Y2R9|RT07_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3596.4	36.94653	2	1387.628647	1387.627228	K	F	82	94
PSM	MPSLPSYKVGDK	1569	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3485.2	34.1623	3	1400.639171	1400.641104	R	I	303	315
PSM	MFGSSVDLGNLGQ	1570	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.4197.3	49.81245	2	1419.579647	1419.574147	K	-	392	405
PSM	NTGIICTIGPASR	1571	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3524.2	35.15317	2	1438.664447	1438.663965	R	S	44	57
PSM	SVFGTPTLETANK	1572	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3593.5	36.8758	2	1443.665647	1443.664677	K	N	1140	1153
PSM	GILAADESTGSIAK	1573	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3556.6	35.97053	2	1491.625247	1491.625922	K	R	29	43
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	1574	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3478.6	33.9953	4	3054.251694	3054.246274	K	N	1928	1956
PSM	SSSSSSGGGLLPYPR	1575	sp|O60293|ZC3H1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3604.5	37.1563	2	1530.672047	1530.671553	R	R	40	55
PSM	DGTSFGEYGGWYK	1576	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3969.3	46.03833	2	1545.585647	1545.581341	K	A	442	455
PSM	CTSVSSLDSFESR	1577	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3544.4	35.65908	2	1553.608447	1553.606904	R	S	1387	1400
PSM	GSFSEQGINEFLR	1578	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4166.2	49.2468	3	1562.676671	1562.676638	K	E	374	387
PSM	RKDSSEESDSSEESDIDSEASSALFMAK	1579	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.3658.5	38.526	4	3132.268894	3132.260210	R	K	338	366
PSM	GSSFEMTDDDSAIR	1580	sp|Q7L2E3|DHX30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3458.5	33.51157	2	1609.594647	1609.596733	R	A	224	238
PSM	SSFESSCPQQWIK	1581	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3723.3	40.16348	3	1662.673271	1662.674924	R	Y	84	97
PSM	DLSHIGDAVVISCAK	1582	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3827.5	42.70323	3	1663.766471	1663.764073	R	D	150	165
PSM	EGSGNPTPLINPLAGR	1583	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3940.3	45.40095	3	1671.798371	1671.798150	R	A	240	256
PSM	SSFDEMLPGTHFQR	1584	sp|Q02218|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3771.5	41.36805	3	1730.716271	1730.712372	R	V	870	884
PSM	SSYVNMQAFDYEQK	1585	sp|Q9H694|BICC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3769.3	41.31325	3	1788.705971	1788.706618	R	K	721	735
PSM	QISLPDLSQEEPQLK	1586	sp|Q15390|MTFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4114.2	48.54525	3	1803.868271	1803.865561	R	T	117	132
PSM	ATPMPSRPSTTPFIDK	1587	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3457.3	33.48087	3	1824.851471	1824.848137	K	K	891	907
PSM	KTDPSSLGATSASFNFGK	1588	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3533.2	35.37733	3	1893.847871	1893.850974	K	K	258	276
PSM	LNLQNKQSLTMDPVVK	1589	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3549.4	35.7838	3	1906.959371	1906.958750	K	S	749	765
PSM	MASNIFGPTEEPQNIPK	1590	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3907.2	44.60672	3	1951.877471	1951.875080	R	R	43	60
PSM	VKPQPPLSDAYLSGMPAK	1591	sp|P46379|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3604.3	37.14963	3	1977.962171	1977.963501	K	R	1032	1050
PSM	TSRAPSVATVGSICDLNLK	1592	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3788.6	41.79543	3	2147.972771	2147.968737	R	I	2102	2121
PSM	KTSDANETEDHLESLICK	1593	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3599.4	37.0241	3	2168.933771	2168.929695	R	V	20	38
PSM	CSVCSEPIMPEPGRDETVR	1594	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,2-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3433.6	32.87997	3	2297.951471	2297.948005	R	V	504	523
PSM	HNGTGGKSIYGEKFEDENFILK	1595	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3628.3	37.77087	4	2562.185294	2562.179185	R	H	70	92
PSM	TDLNPDNLQGGDDLDPNYVLSSR	1596	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	21-UNIMOD:21	ms_run[1]:scan=1.1.4038.4	47.33155	3	2597.131571	2597.128271	K	V	108	131
PSM	KASLVALPEQTASEEETPPPLLTK	1597	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3898.3	44.39463	3	2628.335171	2628.329931	K	E	398	422
PSM	AASESTEQEEGDAPQEDFIQYIAR	1598	sp|Q8N350|CBARP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4588.3	54.19103	3	2763.167471	2763.154880	R	A	339	363
PSM	AQALRDNSTMGYMMAK	1599	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3436.4	32.9504	3	1867.773371	1866.782776	K	K	481	497
PSM	SSTPPGESYFGVSSLQLK	1600	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4197.2	49.80245	3	1962.899471	1962.897590	K	G	1041	1059
PSM	QYMRRSTCTINYSK	1601	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,6-UNIMOD:21,7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3259.5	28.46458	3	1949.7556	1949.7561	K	D	515	529
PSM	GRLSKEEIER	1602	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2870.4	18.85197	3	1295.624171	1295.623480	K	M	508	518
PSM	SMGLPTSDEQK	1603	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.2906.5	19.67658	2	1287.502447	1287.505399	K	K	298	309
PSM	ASGVAVSDGVIK	1604	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3846.3	43.16722	2	1303.5457	1303.5457	M	V	2	14
PSM	SGDEMIFDPTMSK	1605	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,5-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4533.3	53.66713	2	1610.5913	1610.5876	M	K	2	15
PSM	QLSILVHPDKNQDDADRAQK	1606	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3809.2	42.30824	4	2353.1127	2353.1058	R	A	79	99
PSM	CTSVSSLDSFESR	1607	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.4184.3	49.63662	2	1536.5817	1536.5798	R	S	1387	1400
PSM	SLVIPEK	1608	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3671.2	38.83703	2	906.4435	906.4458	M	F	2	9
PSM	CESAFLSK	1609	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3733.4	40.40199	2	1003.3693	1003.3717	K	R	36	44
PSM	CESAPGCGVWQRPVIDNPNYK	1610	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3914.3	44.753	3	2509.0631	2509.0551	R	G	360	381
PSM	ASLSLAPVNIFK	1611	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.6758.2	69.24203	2	1380.7093	1380.7049	M	A	2	14
PSM	SLYPSLEDLKVDK	1612	sp|O00560|SDCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4316.2	51.33657	2	1627.7777	1627.7741	M	V	2	15
PSM	SMAASGNLGHTPFVDEL	1613	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4059.2	47.77105	3	1840.771871	1840.770281	K	-	437	454
PSM	SVVTGGVQSVMGSR	1614	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3550.4	35.80905	2	1442.652247	1442.658880	K	L	167	181
PSM	RLSSLRASTSK	1615	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3045.2	23.09575	3	1444.584371	1444.587777	R	S	233	244
PSM	AAAAAAAAAAGAAGGRGSGPGR	1616	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3633.3	37.90027	3	1830.8443	1830.8481	M	R	2	24
PSM	SFLFSSR	1617	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5164.2	58.84588	2	964.4037	964.4050	M	S	2	9
PSM	SFLFSSR	1618	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5136.2	58.64265	2	964.4037	964.4050	M	S	2	9
PSM	IKKSTYFSDEEELSD	1619	sp|Q8TBF4|ZCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3368.3	31.22582	3	1869.795671	1869.792122	R	-	203	218
PSM	AESFFQTK	1620	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3351.3	30.79327	2	1036.428047	1036.426678	K	A	173	181
PSM	INSLRKNTILPK	1621	sp|O60783|RT14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3179.3	26.49183	3	1555.787771	1555.788846	R	I	54	66
PSM	NARATLSSIR	1622	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3019.5	22.44868	2	1167.572847	1167.576136	K	H	85	95
PSM	NGRKTLTTVQGIADDYDK	1623	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3556.4	35.96387	3	2074.958771	2073.973214	R	K	39	57
PSM	AFGSGYR	1624	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3048.2	23.1724	2	836.318247	836.321819	R	R	280	287
PSM	KSIDTGMGLER	1625	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.2925.2	20.14483	3	1301.567771	1301.568668	K	L	236	247
PSM	QLSLTPR	1626	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3239.3	27.94427	2	893.434447	893.437183	R	T	55	62
PSM	SIQSGPLK	1627	sp|Q16891|MIC60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3030.2	22.72307	2	908.436047	908.436849	K	I	103	111
PSM	SFSLEEK	1628	sp|Q96BK5|PINX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3284.2	29.08133	2	918.375647	918.373580	K	S	110	117
PSM	NMSVIAHVDHGK	1629	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3143.2	25.59413	3	1386.611171	1386.611536	R	S	21	33
PSM	QTASIFKQPVTK	1630	sp|Q9UBB5|MBD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3249.2	28.19613	3	1426.719671	1426.722132	R	V	247	259
PSM	KQSLYLK	1631	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2998.2	21.90505	2	958.480847	958.488884	R	F	556	563
PSM	LGAPALTSR	1632	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3184.2	26.6184	2	964.471447	964.474297	R	Q	426	435
PSM	SIGRPELK	1633	sp|O00625|PIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2994.2	21.80568	2	978.490047	978.489947	R	N	27	35
PSM	KRSSITEPEGPNGPNIQK	1634	sp|Q13625|ASPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2985.3	21.5901	4	2030.982494	2030.978634	K	L	734	752
PSM	KLSEFGIR	1635	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3403.3	32.10462	2	1028.503247	1028.505597	K	N	505	513
PSM	GNSLFFRK	1636	sp|Q9Y6C9|MTCH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3309.2	29.71713	2	1047.489047	1047.490281	R	V	281	289
PSM	KLSSAMSAAK	1637	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2911.4	19.79855	2	1072.496847	1072.498797	R	A	239	249
PSM	NSSIIGDYK	1638	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3206.2	27.14658	2	1075.456647	1075.458706	K	Q	930	939
PSM	SVGEVMAIGR	1639	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.3179.4	26.49517	2	1113.486047	1113.488961	K	T	794	804
PSM	RASSDLSIASSEEDK	1640	sp|Q9H2G2|SLK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3076.4	23.89548	3	1673.710871	1673.714540	K	L	338	353
PSM	RNTLQLHR	1641	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2881.2	19.07037	3	1116.555071	1116.555341	R	Y	195	203
PSM	SAAQFHNLR	1642	sp|O75127|PTCD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2994.3	21.80902	2	1122.493847	1122.497158	K	F	105	114
PSM	DFSETYER	1643	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3191.3	26.8027	2	1125.401647	1125.401586	R	Y	266	274
PSM	DFSETYER	1644	sp|O94992|HEXI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3183.3	26.59595	2	1125.401647	1125.401586	R	Y	266	274
PSM	AASAYAVGDVK	1645	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3129.4	25.24308	2	1130.496447	1130.500906	R	C	348	359
PSM	RNSNSPPSPSSMNQR	1646	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2864.2	18.71302	3	1737.72187064349	1737.72539604049	R	R	453	468
PSM	NSFREQLEEEEEAK	1647	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3261.4	28.51267	3	1736.775371	1736.785323	K	H	1339	1353
PSM	GGNFGGRSSGPYGGGGQYFAKPR	1648	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3267.3	28.66335	4	2353.041694	2353.038943	K	N	330	353
PSM	NPPGGKSSLVLG	1649	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3259.3	28.45792	2	1204.584647	1204.585304	R	-	143	155
PSM	DITSDTSGDFR	1650	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3189.3	26.75147	2	1212.524447	1212.525861	K	N	167	178
PSM	YESLKGVDPK	1651	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3038.2	22.91928	2	1214.554447	1214.558421	R	F	29	39
PSM	AVANTMRTSLGPNGLDK	1652	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3288.3	29.18808	3	1823.862671	1823.860099	K	M	43	60
PSM	SLVDYENANK	1653	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3172.3	26.31137	2	1231.521247	1231.512199	R	A	316	326
PSM	KSLDQDPVVR	1654	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2968.6	21.1681	2	1235.588047	1235.591118	K	A	772	782
PSM	EKKSLDSDESEDEEDDYQQK	1655	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2871.5	18.88075	4	2495.969294	2495.970099	K	R	54	74
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	1656	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3056.4	23.38015	4	2512.024094	2512.025203	R	A	19	51
PSM	SSSFGRIDRDSYSPR	1657	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3204.5	27.10678	3	1888.749971	1888.750622	K	W	951	966
PSM	IVKPVKVSAPR	1658	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2999.2	21.93065	3	1272.729971	1272.731909	K	V	142	153
PSM	NFSDNQLQEGK	1659	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3015.6	22.34902	2	1278.581847	1278.584044	R	N	161	172
PSM	GGSGSGPTIEEVD	1660	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3308.3	29.69495	2	1283.489447	1283.491857	K	-	629	642
PSM	EALQDVEDENQ	1661	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3137.5	25.44875	2	1288.540847	1288.541905	K	-	245	256
PSM	MGPSGGEGMEPERRDSQDGSSYR	1662	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=1.1.2917.3	19.94863	4	2580.000094	2580.000645	R	R	131	154
PSM	ASIHEAWTDGK	1663	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3113.4	24.8373	2	1293.532247	1293.539082	K	E	403	414
PSM	SGLQTDYATEK	1664	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3080.6	24.00587	2	1291.530647	1291.533328	K	E	264	275
PSM	SSPNPFVGSPPK	1665	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3402.4	32.08213	2	1292.579247	1292.580219	K	G	393	405
PSM	SSVVPCELACR	1666	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3363.4	31.10017	2	1356.556447	1356.556723	K	T	428	439
PSM	RCSLLDCDLK	1667	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3327.4	30.17832	2	1358.574647	1358.572373	K	Q	760	770
PSM	ALSTTASTAAFDK	1668	sp|P57772|SELB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	30.6445	2	1362.605647	1362.606827	R	Q	26	39
PSM	SGSSSSSSGTPASQLYPQSR	1669	sp|O15066|KIF3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3246.5	28.12878	3	2049.864671	2049.864058	K	G	723	743
PSM	RKTSDFNTFLAQEGCTK	1670	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3410.5	32.29147	3	2081.925071	2081.924156	R	G	197	214
PSM	GFGYKGSCFHR	1671	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3097.3	24.42743	2	1394.558647	1394.559106	K	I	45	56
PSM	AETNSRVSGVDGYETEGIR	1672	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3252.4	28.28015	3	2118.921671	2118.921907	R	G	264	283
PSM	RYPSSISSSPQK	1673	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2901.4	19.5416	3	1415.644871	1415.644610	R	D	601	613
PSM	GMSISRPNAVVGR	1674	sp|P15291|B4GT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3232.2	27.77215	3	1422.684971	1422.680284	R	C	325	338
PSM	IACEEEFSDSEEEGEGGRKNSSNFK	1675	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3148.5	25.7319	4	2914.160494	2914.160042	R	K	414	439
PSM	NNSFTAPSTVGKR	1676	sp|O95453|PARN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3021.2	22.4903	3	1457.658371	1457.666408	R	N	555	568
PSM	PCSEETPAISPSK	1677	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2984.6	21.57438	2	1481.6089	1481.6104	M	R	2	15
PSM	SSPSVKPAVDPAAAK	1678	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3026.4	22.6262	3	1503.733571	1503.733425	K	L	182	197
PSM	DLEGLSQRHEEK	1679	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2923.4	20.09987	3	1519.665371	1519.666802	K	V	1393	1405
PSM	SSQSSSQQFSGIGR	1680	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3130.6	25.27485	2	1534.637447	1534.641315	R	S	671	685
PSM	FARLSEHATAPTR	1681	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3020.3	22.46763	3	1535.723471	1535.724592	R	G	116	129
PSM	SSSESYTQSFQSR	1682	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3155.6	25.91163	2	1572.611247	1572.609347	R	K	460	473
PSM	ASISEPSDTDPEPR	1683	sp|Q8N1F8|S11IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3069.6	23.72068	2	1579.639647	1579.640312	R	T	386	400
PSM	RATGNLSASCGSALR	1684	sp|Q96T51|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2997.2	21.87952	3	1599.720371	1599.718854	R	A	72	87
PSM	YDSRTTIFSPEGR	1685	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3391.2	31.79178	3	1607.697671	1607.698102	R	L	5	18
PSM	ESRRSLTNSHLEK	1686	sp|Q9H2H9|S38A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2801.2	17.36258	4	1635.773694	1635.772998	R	K	48	61
PSM	TDSVIIADQTPTPTR	1687	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3390.6	31.77933	2	1693.790047	1693.792396	R	F	42	57
PSM	QKKESEAVEWQQK	1688	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2920.2	20.01625	3	1696.779671	1696.782166	R	A	436	449
PSM	EVRSSIRQVSDVQK	1689	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2934.4	20.38397	3	1709.840471	1709.846163	K	R	276	290
PSM	DNARSSLSASHPMVGK	1690	sp|Q8TEW0|PARD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2952.3	20.75117	4	1735.771694	1735.771284	R	W	216	232
PSM	TPSTVTLNNNSAPANR	1691	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3076.5	23.89882	3	1735.789571	1735.789042	R	A	1679	1695
PSM	ASSVTTFTGEPNTCPR	1692	sp|P52943|CRIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3277.3	28.90598	3	1803.753971	1803.749880	R	C	113	129
PSM	TASFSESRADEVAPAKK	1693	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2984.5	21.57105	3	1872.863471	1872.861873	R	A	453	470
PSM	MNAQNKLSLTQDPVVK	1694	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3305.4	29.62265	3	1880.905271	1880.906715	K	V	752	768
PSM	AQALRDNSTMGYMAAKK	1695	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3087.5	24.18333	3	1934.870171	1934.874369	K	H	616	633
PSM	SLRINSTATPDQDRDK	1696	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3050.5	23.2326	3	1975.836671	1975.840166	K	I	1089	1105
PSM	KRPSRSQEEVPPDSDDNK	1697	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2673.2	16.1217	4	2162.9604941913203	2162.9593546250994	K	T	1224	1242
PSM	TPVDESDDEIQHDEIPTGK	1698	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3296.6	29.40507	3	2203.921571	2203.915819	R	C	923	942
PSM	QNGQLVRNDSLVTPSPQQAR	1699	sp|Q9GZY8-2|MFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3253.5	28.30938	3	2287.105271	2287.107023	R	V	137	157
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	1700	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3353.6	30.85465	3	2418.915071	2418.911873	R	R	42	68
PSM	DAELQDQEFGKRDSLGTYSSR	1701	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3359.3	30.99353	4	2481.082094	2481.080927	R	D	859	880
PSM	IVRGDQPAASGDSDDDEPPPLPR	1702	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3282.6	29.04293	3	2483.098571	2483.096577	K	L	45	68
PSM	RNSVERPAEPVAGAATPSLVEQQK	1703	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3289.5	29.22057	4	2613.296494	2613.291195	R	M	1454	1478
PSM	LTASEQAHPQEPAESAHEPRLSAEYEK	1704	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3152.3	25.82687	5	3084.388618	3084.382589	K	V	350	377
PSM	SCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGK	1705	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.2974.6	21.32208	4	3412.343694	3412.340979	K	L	107	139
PSM	FSMPGFK	1706	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3839.2	42.99017	2	892.354847	892.355427	K	A	885	892
PSM	INPDGSQSVVEVPYAR	1707	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3585.6	36.70621	2	1809.827447	1809.829845	R	S	58	74
PSM	NSLLSLSDT	1708	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3748.2	40.78283	2	948.476247	948.476391	K	-	366	375
PSM	DLAGSIIGK	1709	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3568.2	36.26508	2	952.459047	952.463064	K	G	397	406
PSM	SLGLTPVDR	1710	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3416.3	32.43993	2	1036.495247	1036.495426	R	S	1337	1346
PSM	SEFGSVDGPLPHPR	1711	sp|Q5JRA6|TGO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3503.3	34.62183	3	1573.690871	1573.692623	R	W	1702	1716
PSM	SSLGSLQTPEAVTTR	1712	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3513.2	34.87765	3	1625.763371	1625.766182	R	K	386	401
PSM	SDSSSKKDVIELTDDSFDK	1713	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	35.85717	4	2194.953294	2194.951870	R	N	154	173
PSM	NLSTFAVDGK	1714	sp|P0DPI2|GAL3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3525.3	35.18143	2	1130.502247	1130.500906	K	D	142	152
PSM	EKGSTLDLSDLEAEK	1715	sp|O00767|ACOD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3607.2	37.22397	3	1713.769871	1713.770992	K	L	195	210
PSM	GRSDRGSGQGDSLYPVGYLDK	1716	sp|Q5J8M3|EMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3514.3	34.90697	4	2306.031694	2306.032855	R	Q	30	51
PSM	TMSINAAELK	1717	sp|Q69YN4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3494.2	34.38918	2	1156.524847	1156.519927	R	Q	1430	1440
PSM	ETELLGSFSK	1718	sp|Q9NSV4|DIAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3636.2	37.97483	2	1189.524447	1189.526786	K	N	1167	1177
PSM	RNSSEASSGDFLDLK	1719	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3751.4	40.86697	3	1784.702171	1784.701941	R	G	85	100
PSM	INPDGSQSVVEVPYAR	1720	sp|Q9Y2B0|CNPY2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3587.2	36.74058	3	1809.833771	1809.829845	R	S	58	74
PSM	VEVTEFEDIK	1721	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3547.4	35.73387	2	1207.594647	1207.597235	K	S	133	143
PSM	AHESVVKSEDFSLPAYMDRR	1722	sp|P13073|COX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3595.2	36.91475	4	2416.095694	2416.088261	R	D	23	43
PSM	SLAYVDNILK	1723	sp|Q16513|PKN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4138.2	48.86498	2	1214.594847	1214.594806	K	K	78	88
PSM	VQSYEFLQK	1724	sp|Q9NVU0|RPC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3496.4	34.44535	2	1220.549447	1220.547856	R	K	190	199
PSM	SFTLDDESLK	1725	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3645.3	38.19217	2	1233.520047	1233.516615	R	Y	43	53
PSM	VKNSLLSLSDT	1726	sp|Q7L2H7|EIF3M_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3643.3	38.14043	2	1255.605847	1255.606099	K	-	364	375
PSM	DESTDSGLSMSSYSVPR	1727	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3677.3	38.99235	3	1896.745571	1896.744854	R	T	395	412
PSM	DNLTLWTADNAGEEGGEAPQEPQS	1728	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4006.2	46.7807	4	2528.100894	2528.093920	R	-	225	249
PSM	SYSSTLTDMGR	1729	sp|O94875|SRBS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3480.6	34.04637	2	1296.503247	1296.505733	R	S	841	852
PSM	RASSLNFLNK	1730	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3614.5	37.41497	2	1308.563247	1308.562868	K	S	579	589
PSM	QSSDPMLSEFK	1731	sp|Q92888|ARHG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3699.5	39.55333	2	1347.544247	1347.541784	R	N	629	640
PSM	TLTIVDTGIGMTK	1732	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4026.4	47.13623	2	1428.696647	1428.693534	R	A	28	41
PSM	TLTIVDTGIGMTK	1733	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3748.5	40.79284	2	1444.688047	1444.688449	R	A	28	41
PSM	AEAGAGSATEFQFR	1734	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3510.5	34.8101	2	1520.629247	1520.629688	K	G	151	165
PSM	RLTVMSLQESGLK	1735	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3600.2	37.04327	3	1540.768271	1540.768430	R	V	2289	2302
PSM	DGSLASNPYSGDLTK	1736	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3554.5	35.91563	2	1603.676647	1603.676698	R	F	850	865
PSM	LTFDSSFSPNTGKK	1737	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3425.2	32.66902	3	1607.723771	1607.723254	K	N	97	111
PSM	SMGGAAIAPPTSLVEK	1738	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3768.4	41.2875	2	1607.761847	1607.763011	R	D	169	185
PSM	QSFTMVADTPENLR	1739	sp|Q14847|LASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3753.3	40.91492	3	1687.725971	1687.727688	K	L	60	74
PSM	SLYESFVSSSDRLR	1740	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3781.4	41.60897	3	1724.776271	1724.777081	K	E	131	145
PSM	VKSIDLPIQSSLCR	1741	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3780.4	41.58367	3	1774.807571	1774.808989	K	Q	577	591
PSM	SYELPDGQVITIGNER	1742	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3921.2	44.91565	3	1789.885271	1789.884643	K	F	241	257
PSM	TSDFNTFLAQEGCTK	1743	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3803.5	42.17297	2	1797.731847	1797.728082	K	G	199	214
PSM	QTGKTSIAIDTIINQK	1744	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3664.3	38.67197	3	1809.926771	1809.923745	R	R	215	231
PSM	DSSSLSSCTSGILEER	1745	sp|Q9H3Q1|BORG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3663.3	38.64305	3	1806.735971	1806.734289	R	S	306	322
PSM	YQESLGNTVFELENR	1746	sp|O43164|PJA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4114.3	48.55525	3	1877.829071	1877.819674	R	E	193	208
PSM	IISNASCTTNCLAPLAK	1747	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3606.3	37.20156	3	1912.879871	1912.878786	K	V	146	163
PSM	MASNIFGPTEEPQNIPK	1748	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3716.4	39.98425	3	1967.870471	1967.869995	R	R	43	60
PSM	SNSSSEAVLGQEELSAQAK	1749	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3493.4	34.37143	3	2013.891071	2013.889210	R	V	393	412
PSM	RKTSDFNTFLAQEGCTK	1750	sp|Q9UHD1|CHRD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3520.3	35.0578	3	2161.893371	2161.890487	R	G	197	214
PSM	YHTSQSGDEMTSLSEYVSR	1751	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3532.4	35.35853	3	2175.950171	2175.937877	R	M	457	476
PSM	GVVPLAGTNGETTTQGLDGLSER	1752	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3832.3	42.82262	3	2351.105171	2351.100600	K	C	112	135
PSM	DSPPKNSVKVDELSLYSVPEGQSK	1753	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3648.4	38.26985	4	2682.283294	2682.278958	K	Y	28	52
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	1754	sp|P13807|GYS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3561.3	36.0882	4	3185.440494	3185.436140	K	-	708	738
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1755	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:4,18-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3569.4	36.29618	4	3562.499694	3562.491898	K	V	60	92
PSM	DDDIAALVVDNGSGMCK	1756	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4200.3	49.88727	3	1836.7856	1836.7865	M	A	2	19
PSM	TSSTCSNESLSVGGTSVTPR	1757	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3328.6	30.21052	3	2105.892071	2105.893644	R	R	749	769
PSM	QASVADYEETVKK	1758	sp|P49419|AL7A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3356.6	30.92813	2	1529.6647	1529.6645	R	A	82	95
PSM	SGDEMIFDPTMSK	1759	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,5-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3739.5	40.56082	2	1610.5901	1610.5876	M	K	2	15
PSM	NTGIICTIGPASR	1760	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3495.5	34.42373	2	1439.670247	1438.663965	R	S	44	57
PSM	MERASLIQK	1761	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3337.2	30.42903	2	1196.5637	1196.5619	-	A	1	10
PSM	LISISGK	1762	sp|Q9C0A0|CNTP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3360.2	31.016	2	796.407447	796.409571	R	V	518	525
PSM	SMPDAMPLPGVGEELK	1763	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4599.2	54.31452	2	1807.7837	1807.7768	M	Q	2	18
PSM	ATGANATPLDFPSK	1764	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3887.2	44.12112	2	1510.6726	1510.6700	M	K	2	16
PSM	HQGVMVGMGQKDCYVGDEAQSK	1765	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2864.5	18.72635	4	2503.049694	2503.033131	R	R	41	63
PSM	KASFLR	1766	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2969.2	21.18038	2	800.393647	800.394590	K	A	284	290
PSM	PFSAPKPQTSPSPK	1767	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3027.2	22.64527	3	1547.739071	1547.738510	K	R	299	313
PSM	QMSVPGIFNPHEIPEEMCD	1768	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4362.2	51.85954	3	2324.922071	2324.915308	R	-	1053	1072
PSM	AQSREQLAALK	1769	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3046.6	23.13498	2	1293.639847	1293.644216	R	K	61	72
PSM	ADKPDMGEIASFDK	1770	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3644.4	38.17622	2	1564.7071	1564.7074	M	A	2	16
PSM	SDAAVDTSSEITTK	1771	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3242.6	28.02968	2	1465.6782	1465.6779	M	D	2	16
PSM	NMSYQGFTK	1772	sp|Q9P2J5|SYLC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3072.4	23.79158	2	1170.443847	1170.441677	R	D	333	342
PSM	STGGDFGNPLRK	1773	sp|P20340|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3425.5	32.67902	2	1369.6015	1369.6022	M	F	2	14
PSM	CGSVLVR	1774	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3739.3	40.55415	2	852.3538	852.3560	R	L	188	195
PSM	ALSTWK	1775	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3239.2	27.94093	2	784.351047	784.352056	R	Q	174	180
PSM	SRAWVLEK	1776	sp|O43709|BUD23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3224.2	27.57195	2	1067.5158	1067.5160	K	K	248	256
PSM	SRGSSAGFDR	1777	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2884.3	19.15922	2	1160.4591	1160.4606	M	H	2	12
PSM	KLGDMRNSATFK	1778	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3043.3	23.0473	3	1446.664571	1446.669050	R	S	154	166
PSM	STSQGSINSPVYSRHSYTPTTSR	1779	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3189.6	26.76147	4	2672.132094	2672.126905	R	S	450	473
PSM	RISELR	1780	sp|Q96KQ4|ASPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2962.2	20.99987	2	852.421447	852.421867	K	E	309	315
PSM	TLQQFPGGSIDLQK	1781	sp|Q9NTX5|ECHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3750.4	40.84103	3	1610.771171	1610.770539	K	E	46	60
PSM	ILSVELPK	1782	sp|Q9BRX5|PSF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3843.2	43.0926	2	977.521447	977.519850	R	I	83	91
PSM	KGTFTDDLHK	1783	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2972.4	21.26453	2	1240.546647	1240.548919	R	L	2243	2253
PSM	KIESFGSPKGSVCR	1784	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2983.5	21.54537	3	1630.750571	1630.753843	K	R	3201	3215
PSM	RKSNEMITNLGK	1785	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3039.2	22.94413	3	1471.707371	1469.706164	K	K	610	622
PSM	GYSFTTTAER	1786	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3271.3	28.7589	2	1213.488647	1211.485984	R	E	197	207
PSM	RLSESQLSFR	1787	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3430.6	32.80502	2	1381.578047	1381.579247	R	R	616	626
PSM	DTCYSPKPSVYLSTPSSASK	1788	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.3496.6	34.45201	3	2253.989771	2253.986482	K	A	538	558
PSM	MSGGWELELNGTEAK	1789	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3882.2	44.05055	3	1717.697771	1716.706618	K	L	105	120
PSM	RRTLFQTK	1790	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2901.2	19.53493	3	1128.581471	1128.580493	K	N	453	461
PSM	SIVFHR	1791	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3065.2	23.60402	2	837.387247	837.389839	K	K	135	141
PSM	RASAILR	1792	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2930.2	20.2735	2	865.449647	865.453502	R	S	113	120
PSM	TIAPALVSK	1793	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3168.2	26.20517	2	898.546847	898.548768	K	K	72	81
PSM	RYDSRTTIFSPEGR	1794	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3281.3	29.0068	4	1843.769694	1843.765544	R	L	4	18
PSM	DISLSDYK	1795	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3324.2	30.0946	2	939.457047	939.454927	K	G	28	36
PSM	IHRASDPGLPAEEPKEK	1796	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2921.2	20.04132	4	1952.933294	1952.935707	R	S	1855	1872
PSM	TIAPALVSK	1797	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3285.2	29.10723	2	978.515247	978.515099	K	K	72	81
PSM	ALRASESGI	1798	sp|P48960|CD97_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3122.5	25.06612	2	982.443247	982.448476	R	-	827	836
PSM	NIIHGSDSVESAEK	1799	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2953.3	20.77715	3	1484.700071	1484.710701	R	E	115	129
PSM	SLEVIPEK	1800	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3392.2	31.81763	2	993.476247	993.478379	R	A	1113	1121
PSM	LGTPALTSR	1801	sp|P34896|GLYC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3145.2	25.6463	2	994.482247	994.484862	R	G	403	412
PSM	MPSLPSYK	1802	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3306.3	29.64457	2	1017.423047	1017.424236	R	V	303	311
PSM	DWDDDQND	1803	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2977.2	21.3853	2	1021.323047	1021.326098	K	-	541	549
PSM	DGLTDVYNK	1804	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3181.3	26.54398	2	1023.483047	1023.487290	K	I	182	191
PSM	KLSEFGIR	1805	sp|Q9UBT2|SAE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3411.3	32.31067	2	1028.503247	1028.505597	K	N	505	513
PSM	RNSVTPLASPEPTK	1806	sp|Q16875|F263_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3067.3	23.65912	3	1575.760871	1575.765788	R	K	459	473
PSM	GMSSTFSQR	1807	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3173.3	26.33717	2	1079.409847	1079.410710	R	S	84	93
PSM	KKSIPLSIK	1808	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3049.4	23.20415	2	1092.626247	1092.630798	R	N	513	522
PSM	STTPPPAEPVSLPQEPPKPR	1809	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3395.3	31.8983	4	2204.085294	2204.087850	K	V	225	245
PSM	GKSSFFSDR	1810	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3094.3	24.3538	2	1109.453047	1109.454290	R	G	80	89
PSM	RPSWFTQN	1811	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3410.3	32.2848	2	1114.458847	1114.459709	K	-	181	189
PSM	SLSYSPVER	1812	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3258.2	28.4286	2	1116.483247	1116.485256	R	R	2690	2699
PSM	TGYSFVNCK	1813	sp|P43897|EFTS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3311.2	29.76738	2	1154.443647	1154.446762	K	K	57	66
PSM	TRVTDSSVSVQLRE	1814	sp|Q6ZVX7|FBX50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3290.5	29.24652	3	1735.758371	1735.754311	R	-	262	276
PSM	SLSEAMSVEK	1815	sp|Q6P1J9|CDC73_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3364.2	31.11907	2	1159.483247	1159.483207	R	I	172	182
PSM	NRNEQGSTCASLQESAVHPR	1816	sp|Q9UJU6-3|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2985.5	21.59677	4	2320.000094	2320.001571	R	E	248	268
PSM	RSSELLVRK	1817	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2895.2	19.42313	3	1166.614571	1166.617273	R	L	564	573
PSM	QQKASAELIEEEVAK	1818	sp|P12081|HARS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	30.96807	3	1751.837171	1751.834261	K	L	23	38
PSM	SIDTGMGLER	1819	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.3072.5	23.79492	2	1173.472447	1173.473705	K	L	237	247
PSM	GGSGSGPTIEEVD	1820	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3181.5	26.55065	2	1203.524047	1203.525526	K	-	629	642
PSM	NPPGGKSSLVLG	1821	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3267.4	28.66668	2	1204.584647	1204.585304	R	-	143	155
PSM	TTSAGTGGMWR	1822	sp|P60468|SC61B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2968.5	21.16477	2	1219.470647	1219.469288	R	F	47	58
PSM	HASSGSFLPSANEHLK	1823	sp|O76003|GLRX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3340.3	30.50922	3	1840.758371	1840.754645	R	E	115	131
PSM	AYNLNRTPSTVTLNNNSAPANR	1824	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3333.4	30.33263	4	2467.161694	2467.160515	K	A	1673	1695
PSM	RTGSSSSILSASSESSEK	1825	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3034.5	22.83185	3	1878.808871	1878.820796	R	A	2566	2584
PSM	ASGNYATVISHNPETKK	1826	sp|P62917|RL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3082.4	24.05098	3	1895.875871	1895.877857	R	T	129	146
PSM	RRPSDENTIAPSEVQK	1827	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2921.4	20.04798	3	1905.895571	1905.894570	R	W	791	807
PSM	DNSTMGYMAAK	1828	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.2956.6	20.86495	2	1283.456447	1283.456340	R	K	621	632
PSM	YRQDDDQRSSHYDELLAAEAR	1829	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3304.6	29.60418	4	2617.123294	2617.119438	R	A	465	486
PSM	SRMHNIPVYK	1830	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3031.2	22.74902	3	1323.618071	1323.615893	R	D	89	99
PSM	RRSPSPYYSR	1831	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2816.3	17.66815	3	1347.607871	1347.608499	R	Y	258	268
PSM	QRGSETDTDSEIHESASDKDSLSK	1832	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2916.4	19.92422	4	2701.136094	2701.135207	R	G	1260	1284
PSM	ASSVISTAEGTTR	1833	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3164.6	26.1157	2	1358.597847	1358.607890	R	R	1805	1818
PSM	IRYESLTDPSK	1834	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3271.6	28.7689	2	1387.637847	1387.638462	K	L	54	65
PSM	HRFMSAYEQR	1835	sp|Q15428|SF3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3189.2	26.74813	3	1403.578571	1403.580570	R	I	149	159
PSM	IIYGGSVTGATCK	1836	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3252.3	28.27682	2	1405.630447	1405.631268	R	E	244	257
PSM	VGRFSVSKTEDK	1837	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2913.2	19.84335	3	1431.676571	1431.675910	K	I	1955	1967
PSM	RLGRGSVSDCSDGTSELEEPLGEDPR	1838	sp|P50548|ERF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3408.3	32.23314	4	2897.250894	2897.249860	R	A	180	206
PSM	VASFSCMCPEGK	1839	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3392.6	31.83097	2	1451.527447	1451.528460	R	A	357	369
PSM	TGSCSELDACPSK	1840	sp|Q9H1H9|KI13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2960.6	20.96382	2	1490.537647	1490.541861	R	I	1696	1709
PSM	KESLQNLLHSSR	1841	sp|Q658Y4|F91A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3295.2	29.3659	3	1490.725571	1490.724257	R	K	752	764
PSM	NDSLVTPSPQQAR	1842	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.6	25.1211	2	1491.670447	1491.671887	R	V	144	157
PSM	GAGSIREAGGAFGKR	1843	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3023.3	22.54513	3	1512.717671	1512.719840	R	E	36	51
PSM	SVSEINSDDELSGK	1844	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3258.6	28.44193	2	1558.646247	1558.639978	R	G	338	352
PSM	RKSNFSNSADDIK	1845	sp|P45973|CBX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2862.4	18.67142	3	1560.692771	1560.693351	K	S	90	103
PSM	SRGSYCHFVLYK	1846	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3335.3	30.38087	3	1595.695271	1595.695600	K	E	253	265
PSM	ECRQSLSHMLSAK	1847	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3182.2	26.56657	3	1625.702171	1625.705513	K	L	634	647
PSM	ASSQSAPSPDVGSGVQT	1848	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3190.6	26.78703	2	1653.688647	1653.688325	R	-	126	143
PSM	SQSRSNSPLPVPPSK	1849	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3133.2	25.33793	3	1659.796571	1659.798150	R	A	297	312
PSM	ATAGDTHLGGEDFDNR	1850	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3064.5	23.5882	3	1674.721871	1674.723391	K	L	221	237
PSM	TSGRVAVEEVDEEGK	1851	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3067.4	23.66245	3	1683.737771	1683.735275	R	F	436	451
PSM	QRQSGVVVEEPPPSK	1852	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2968.3	21.1581	3	1715.821571	1715.824365	R	T	1050	1065
PSM	DKPAQIRFSNISAAK	1853	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3365.3	31.14823	3	1724.862671	1724.861085	R	A	28	43
PSM	DNARSSLSASHPMVGK	1854	sp|Q8TEW0|PARD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2952.5	20.75783	3	1735.771571	1735.771284	R	W	216	232
PSM	ASGNYATVISHNPETK	1855	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3191.4	26.80603	3	1767.781871	1767.782894	R	K	129	145
PSM	RNSNSPPSPSSMNQR	1856	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2909.4	19.74692	3	1817.691371	1817.691727	R	R	453	468
PSM	KQSLGEDHVILEEQK	1857	sp|Q9HBD1|RC3H2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3178.5	26.47257	3	1831.872371	1831.871709	K	T	1117	1132
PSM	RKTDFFIGGEEGMAEK	1858	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3399.3	32.00108	3	1893.831371	1893.833215	R	L	38	54
PSM	AQALRDNSTMGYMMAK	1859	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.3036.3	22.87362	3	1898.772971	1898.772606	K	K	481	497
PSM	ASGYQSSQKKSCVEEPEPEPEAAEGDGDK	1860	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2977.4	21.39197	5	3188.316118	3188.312914	K	K	97	126
PSM	DISTLNSGKKSLETEHK	1861	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2955.5	20.83568	3	1965.937871	1965.940852	R	A	508	525
PSM	RFSDQAGPAIPTSNSYSK	1862	sp|Q7KZI7-13|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3294.6	29.35348	3	2004.896171	2004.894236	R	K	374	392
PSM	GGNFGGRSSGPYGGGGQYFAK	1863	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3338.3	30.45765	3	2099.889071	2099.885068	K	P	278	299
PSM	QSRRSTQGVTLTDLQEAEK	1864	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3385.6	31.65182	3	2306.030771	2306.030486	R	T	691	710
PSM	RVSRSSFSSDPDESEGIPLK	1865	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3388.3	31.71758	4	2352.003694	2352.003602	R	R	123	143
PSM	RNSVERPAEPVAGAATPSLVEQQK	1866	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3281.5	29.01347	4	2613.296494	2613.291195	R	M	1454	1478
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	1867	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2861.6	18.65253	4	3178.156094	3178.161241	R	K	494	522
PSM	SYTIGL	1868	sp|O14744|ANM5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3956.2	45.7204	2	732.307447	732.309523	R	-	632	638
PSM	SLPPGLLR	1869	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3626.3	37.72238	2	931.486247	931.489219	R	R	428	436
PSM	MPSLPSYKVGDK	1870	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3502.2	34.59268	3	1400.641871	1400.641104	R	I	303	315
PSM	QMSLLLR	1871	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3792.3	41.88788	2	939.459047	939.461289	R	R	323	330
PSM	SFAVGMFK	1872	sp|P49748|ACADV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3878.2	43.94947	2	965.408247	965.408191	K	G	72	80
PSM	SYAGYQTL	1873	sp|P13473-2|LAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3619.2	37.53487	2	981.382647	981.384479	K	-	403	411
PSM	LLSIDLDK	1874	sp|Q14703|MBTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3912.2	44.70358	2	995.495447	995.494029	K	V	952	960
PSM	DVKDGKYSQVLANGLDNK	1875	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3440.3	33.05083	4	2042.966494	2042.967401	K	L	89	107
PSM	DLEEDHACIPIKKSDPVVSYR	1876	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3438.2	32.9957	5	2550.184118	2550.182556	K	E	560	581
PSM	SCNCLLLK	1877	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3415.3	32.41403	2	1086.457847	1086.460304	K	V	336	344
PSM	SCNCLLLK	1878	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3423.3	32.6206	2	1086.457847	1086.460304	K	V	336	344
PSM	SISLEPLQK	1879	sp|Q8N0T1|RBIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3597.3	36.96902	2	1093.542447	1093.542042	K	E	67	76
PSM	NMSIIDAFK	1880	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3727.3	40.24407	2	1133.482447	1133.482813	R	S	617	626
PSM	SSLGSLQTPEAVTTR	1881	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3696.2	39.47077	3	1705.737671	1705.732513	R	K	386	401
PSM	AVSLDSPVSVGSSPPVK	1882	sp|Q9Y6Q9|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3658.3	38.516	3	1704.832871	1704.833533	R	N	855	872
PSM	SIFDPNTFK	1883	sp|Q8TDM6|DLG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3785.3	41.70828	2	1147.495047	1147.495092	K	R	972	981
PSM	TDFRDGSIAV	1884	sp|A1L0T0|ILVBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3493.3	34.3681	2	1159.490247	1159.491069	R	-	623	633
PSM	SRESMIQLF	1885	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4058.2	47.74612	2	1189.520647	1189.520261	K	-	449	458
PSM	SGKASCTLETVWEDK	1886	sp|P29692-2|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3618.4	37.51558	3	1789.758971	1789.759382	R	H	3	18
PSM	SESAPTLHPYSPLSPK	1887	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3474.4	33.89115	3	1789.831871	1789.828782	R	G	100	116
PSM	SRESMIQLF	1888	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3777.2	41.50315	2	1205.514647	1205.515176	K	-	449	458
PSM	SISQLESLNR	1889	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3513.5	34.88765	2	1225.567647	1225.570382	K	E	574	584
PSM	DIDISSPEFK	1890	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3657.3	38.49082	2	1229.521047	1229.521701	K	I	172	182
PSM	LASTNSSVLGADLPSSMK	1891	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3859.4	43.48855	3	1856.860871	1856.859096	R	E	105	123
PSM	NTSRITELKEEIEVK	1892	sp|Q9NQP4|PFD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3507.3	34.72581	3	1867.925771	1867.929224	R	K	29	44
PSM	IGKGSFGEVFK	1893	sp|Q9Y6E0|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3490.3	34.29433	2	1247.594047	1247.595140	K	G	42	53
PSM	NLSMPDLENR	1894	sp|Q13425|SNTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3680.3	39.07073	2	1267.525047	1267.526803	R	L	256	266
PSM	GNRTDGSISGDRQPVTVADYISR	1895	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3477.5	33.96722	4	2543.178894	2543.176559	R	A	595	618
PSM	SIFASPESVTGK	1896	sp|O75940|SPF30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3552.4	35.8605	2	1301.589047	1301.590449	R	V	197	209
PSM	VSLSAPMTTNGLPESTDSK	1897	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3703.4	39.65018	3	2013.896471	2013.896604	K	E	182	201
PSM	TTSFFLNSPEK	1898	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3688.3	39.26605	2	1349.587247	1349.590449	R	E	1276	1287
PSM	SVWGSLAVQNSPK	1899	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3702.5	39.62855	2	1451.682447	1451.680995	K	G	343	356
PSM	GTSGSLADVFANTR	1900	sp|Q9P265|DIP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3754.3	40.94028	2	1474.645647	1474.645338	K	I	199	213
PSM	SFSEDTLMDGPAR	1901	sp|Q9BRG2|SH23A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3688.6	39.27605	2	1504.592447	1504.590525	R	I	123	136
PSM	DASRGLATFCLDK	1902	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3624.2	37.66412	3	1532.666771	1532.669445	R	E	120	133
PSM	SLTNLSFLTDSEK	1903	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4291.2	51.13508	2	1533.699247	1533.696371	K	K	90	103
PSM	TQGESISEQGSTDNESCTNSELNSPLVR	1904	sp|Q9NR09|BIRC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3564.5	36.17228	4	3118.308094	3118.303412	R	R	597	625
PSM	GGSTTGSQFLEQFK	1905	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3936.2	45.29603	3	1565.678771	1565.676304	K	T	354	368
PSM	QVQSLTCEVDALK	1906	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3785.2	41.70495	3	1569.711071	1569.710975	R	G	322	335
PSM	TKQSTVLAPVIDLK	1907	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3743.2	40.65393	3	1591.855871	1591.858625	R	R	45	59
PSM	SPSFASEWDEIEK	1908	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4051.5	47.6003	2	1603.645647	1603.644335	K	I	661	674
PSM	TLNDRSSIVMGEPISQSSSNSQ	1909	sp|Q8TCS8|PNPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3512.3	34.85507	3	2416.058471	2416.057749	R	-	762	784
PSM	ASFENNCEIGCFAK	1910	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,7-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3603.2	37.12058	3	1725.656171	1725.652809	R	L	5	19
PSM	RKSAGSMCITQFMK	1911	sp|Q13111|CAF1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3629.4	37.80035	3	1803.728471	1803.727250	K	K	871	885
PSM	SVPTSTVFYPSDGVATEK	1912	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3722.4	40.13832	3	1963.886171	1963.881605	R	A	439	457
PSM	ANAGPNTNGSQFFICTAK	1913	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3650.4	38.3193	3	1976.8446706434902	1976.8451770994302	M	T	101	119
PSM	MSCFSRPSMSPTPLDR	1914	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,3-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3636.3	37.97817	3	2027.769671	2027.770571	R	C	2114	2130
PSM	INSSGESGDESDEFLQSR	1915	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3439.5	33.03152	3	2035.801571	2035.800789	R	K	180	198
PSM	TDKSSASAPDVDDPEAFPALA	1916	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4032.2	47.21873	3	2182.935371	2182.930741	R	-	388	409
PSM	TDKSSASAPDVDDPEAFPALA	1917	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4020.2	47.01112	3	2182.935371	2182.930741	R	-	388	409
PSM	GEHSIVYLKPSYAFGSVGK	1918	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3875.2	43.87015	4	2197.984494	2197.985039	K	E	214	233
PSM	KASATCSSATAAASSGLEEWTSR	1919	sp|Q96G74|OTUD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3638.2	38.02642	3	2408.036471	2408.031534	R	S	429	452
PSM	SRQPSGAGLCDISEGTVVPEDR	1920	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3683.5	39.14853	3	2489.032871	2489.029500	K	C	688	710
PSM	SYDVPPPPMEPDHPFYSNISK	1921	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3880.3	44.00992	3	2496.076271	2496.070880	R	D	118	139
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	1922	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3805.3	42.21797	3	3014.201171	3014.188484	K	-	661	690
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	1923	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3542.6	35.61632	4	3221.397694	3221.393230	R	S	38	70
PSM	LSELLR	1924	sp|Q92538|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3359.2	30.9902	2	809.404847	809.404820	R	K	173	179
PSM	SGTPPRQGSITSPQANEQSVTPQRR	1925	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3063.6	23.56585	4	2838.280094	2838.281115	K	S	846	871
PSM	HQGVMVGMGQKDSYVGDEAQSK	1926	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3117.4	24.936	4	2447.014494	2446.029426	R	R	42	64
PSM	QMSLLLR	1927	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.6068.2	64.7394	2	922.4317	922.4342	R	R	323	330
PSM	DRSSFYVNGLTLGGQK	1928	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3810.5	42.34262	3	1821.839171	1820.845829	K	C	55	71
PSM	ASGVAVSDGVIK	1929	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3837.3	42.95436	2	1303.5457	1303.5457	M	V	2	14
PSM	QLSILVHPDK	1930	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4570.2	54.01353	2	1211.5951	1211.5946	R	N	79	89
PSM	GALQNIIPASTGAAK	1931	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3648.5	38.27318	2	1490.746647	1490.749409	R	A	201	216
PSM	SLSNKLTLDKLDVK	1932	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3935.2	45.27397	3	1774.8557	1774.8514	M	G	2	16
PSM	QLSSGVSEIR	1933	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3642.2	38.11105	2	1137.5047	1137.5062	R	H	80	90
PSM	MERASLIQK	1934	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3066.6	23.64337	2	1212.5542	1212.5569	-	A	1	10
PSM	MSPNETLFLESTNK	1935	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3766.4	41.2364	3	1689.732371	1689.732104	K	I	85	99
PSM	QSSGPGASSGTSGDHGELVVR	1936	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3062.6	23.53997	3	2063.887571	2063.890941	R	I	39	60
PSM	NVTLPAVFK	1937	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4007.2	46.81565	2	1067.541447	1067.541648	K	A	21	30
PSM	ASGVTVNDEVIK	1938	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3667.5	38.74825	2	1352.6224	1352.6220	M	V	2	14
PSM	MHRDSCPLDCK	1939	sp|P84103|SRSF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.2887.3	19.22567	3	1555.5608	1555.5614	-	V	1	12
PSM	SVTDSIRDEYAFLQK	1940	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3956.3	45.7304	3	1850.847371	1850.845160	K	K	257	272
PSM	EGLSACQQSGFPAVLSSK	1941	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3772.5	41.39348	3	1945.869371	1944.865244	K	R	183	201
PSM	SVMTEEYK	1942	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3026.5	22.62953	2	1065.411447	1065.408979	R	V	99	107
PSM	KESAPQVLLPEEEK	1943	sp|Q14155-1|ARHG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3378.6	31.47973	2	1675.806447	1675.806984	R	I	558	572
PSM	YMSQMSVPEQAELEK	1944	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3782.3	41.63115	3	1848.773771	1848.767504	R	L	88	103
PSM	MSRGSSAGFDR	1945	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3120.3	25.00787	2	1291.4979	1291.5011	-	H	1	12
PSM	TVSYLGLE	1946	sp|O00244|ATOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3994.2	46.5464	2	960.420447	960.420530	K	-	61	69
PSM	SVAAEGALLPQTPPSPR	1947	sp|Q86X27|RGPS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3670.4	38.81883	3	1769.872571	1769.871315	K	N	315	332
PSM	SIFTPTNQIR	1948	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4012.2	46.90855	2	1297.6075	1297.6062	M	L	2	12
PSM	RFSDIQIR	1949	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	30.30017	2	1113.532247	1113.533209	R	R	488	496
PSM	RFSEGTSADREIQR	1950	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2971.5	21.24245	3	1730.7748	1730.7732	R	T	242	256
PSM	VAGIHKKGDSSAEELK	1951	sp|P26373-2|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2759.2	16.74237	4	1750.848494	1747.850580	R	L	83	99
PSM	KSLASRSNVAHHSK	1952	sp|Q6ZS81|WDFY4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3218.4	27.45978	3	1762.725071	1760.716165	K	V	2180	2194
PSM	KEAVATLEK	1953	sp|Q9UPV0|CE164_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3224.2	27.57195	2	1067.516247	1067.526392	R	E	760	769
PSM	RSSVSSGGAGRLSMQELR	1954	sp|O14777|NDC80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3261.6	28.51933	3	2036.883671	2036.886404	K	S	3	21
PSM	ISVREPMQTGIK	1955	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3311.6	29.78072	2	1437.707047	1437.705102	R	A	183	195
PSM	MRSVLISLK	1956	sp|P09496|CLCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3344.4	30.6156	2	1141.591047	1141.593032	R	Q	234	243
PSM	NSVTPDMMEEMYKK	1957	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3763.2	41.15575	3	1782.693971	1781.707546	K	A	229	243
PSM	KQSLGELIGTLNAAK	1958	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4085.2	48.16927	3	1622.832371	1621.844038	R	V	56	71
PSM	KLSELLR	1959	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3410.2	32.28147	2	937.500647	937.499783	K	Y	458	465
PSM	TFSATVR	1960	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3089.2	24.2252	2	860.375847	860.379334	R	A	50	57
PSM	SMLFKR	1961	sp|O75438|NDUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3128.2	25.21097	2	860.393647	860.397961	K	E	42	48
PSM	KKSEQLHNVTAFQGK	1962	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2971.4	21.23912	4	1793.887294	1793.882549	K	G	1014	1029
PSM	IIALDGDTK	1963	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3167.2	26.17923	2	944.518447	944.517862	R	N	335	344
PSM	QVSLPVTK	1964	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3256.2	28.37695	2	950.480847	950.483799	R	S	721	729
PSM	TFEINPR	1965	sp|Q58FF3|ENPLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3306.2	29.64123	2	955.415047	955.416448	K	H	323	330
PSM	NGSFANLR	1966	sp|P52788|SPSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3191.2	26.79937	2	957.406847	957.406946	K	I	55	63
PSM	SRSGEGEVSGLMR	1967	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2936.3	20.43203	3	1459.613171	1459.612658	R	K	471	484
PSM	EGSPARSSTPLHSPSPIR	1968	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3084.2	24.09572	4	1954.926494	1954.926205	R	V	277	295
PSM	GPSSVEDIK	1969	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2984.3	21.56438	2	1010.430247	1010.432157	K	A	240	249
PSM	RTSINVVR	1970	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2959.2	20.9261	2	1023.520647	1023.522644	R	H	682	690
PSM	DGYNYTLSK	1971	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3136.2	25.41327	2	1059.485847	1059.487290	K	T	28	37
PSM	DGGAWGTEQR	1972	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2938.4	20.48712	2	1075.467847	1075.468286	K	E	65	75
PSM	SYDLTPVDK	1973	sp|Q8WVM8|SCFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3318.4	29.94747	2	1116.474247	1116.474022	K	F	316	325
PSM	SNQIPTEVR	1974	sp|Q9BWH2|FUND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3104.4	24.60982	2	1122.507447	1122.507054	K	S	151	160
PSM	GRMSMKEVDEQMLNVQNK	1975	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:35,4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3145.3	25.64963	4	2247.971294	2247.968740	R	N	319	337
PSM	NGSLICTASK	1976	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3028.5	22.68107	2	1129.484847	1129.483876	R	D	185	195
PSM	SASVSSISLTK	1977	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3286.4	29.13975	2	1158.554647	1158.553335	R	G	1132	1143
PSM	EITALAPSTMK	1978	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3320.3	29.99523	2	1160.610047	1160.611110	K	I	318	329
PSM	QDGPMPKPHSVSLNDTETRK	1979	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.2932.4	20.33203	4	2332.051294	2332.051876	K	L	155	175
PSM	NARATLSSIR	1980	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3019.4	22.44535	2	1167.572847	1167.576136	K	H	85	95
PSM	SIDTGMGLER	1981	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.3080.3	23.99587	2	1173.472447	1173.473705	K	L	237	247
PSM	VSSKNSLESYAFNMK	1982	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3360.4	31.02267	3	1799.783171	1799.780118	K	A	536	551
PSM	SSTTSMTSVPK	1983	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3009.4	22.18757	2	1204.505247	1204.504670	R	P	84	95
PSM	NPPGGKSSLVLG	1984	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3276.3	28.88133	2	1204.584647	1204.585304	R	-	143	155
PSM	SRSPESQVIGENTKQP	1985	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3087.4	24.18	3	1835.840471	1835.841472	R	-	305	321
PSM	RASSLNFLNK	1986	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3367.5	31.20672	2	1228.5944470956601	1228.5965370640802	K	S	579	589
PSM	NSSYVHGGVDASGKPQEAVYGQNDIHHK	1987	sp|Q9UN86|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3080.4	23.9992	5	3073.364118	3073.367941	R	V	37	65
PSM	RSLTVSDDAESSEPER	1988	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3012.4	22.26488	3	1856.778371	1856.778931	K	K	2953	2969
PSM	IGRFSEPHAR	1989	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2957.3	20.8809	3	1248.573671	1248.576471	R	F	136	146
PSM	DAINQGMDEELERDEK	1990	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3330.3	30.25198	3	1890.828071	1890.826536	R	V	37	53
PSM	RKTDFFIGGEEGMAEK	1991	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3242.5	28.02635	3	1909.830371	1909.828130	R	L	38	54
PSM	SKPVFSESLSD	1992	sp|O60220|TIM8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3391.4	31.79845	2	1274.542047	1274.543164	K	-	87	98
PSM	GGSGSGPTIEEVD	1993	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3317.4	29.9218	2	1283.489447	1283.491857	K	-	629	642
PSM	QQSEISAAVER	1994	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3112.3	24.80943	2	1296.568047	1296.571111	R	A	451	462
PSM	AQTPPGPSLSGSK	1995	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3012.5	22.26822	2	1305.594047	1305.596597	K	S	1001	1014
PSM	KKASSSDSEDSSEEEEEVQGPPAK	1996	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2872.4	18.90307	4	2629.088494	2629.091611	K	K	80	104
PSM	RNPPGGKSSLVLG	1997	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3093.4	24.3328	2	1360.683247	1360.686415	R	-	142	155
PSM	KPSISITTESLK	1998	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3377.5	31.45202	2	1382.705447	1382.705813	K	S	861	873
PSM	SSSSGHYVSWVK	1999	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	29.15893	3	1402.593671	1402.591846	R	R	430	442
PSM	RIGRFSEPHAR	2000	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2933.2	20.35172	3	1404.675071	1404.677582	R	F	135	146
PSM	EGLELPEDEEEK	2001	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3341.5	30.5418	2	1415.629047	1415.630385	K	K	412	424
PSM	RDSLTGSSDLYK	2002	sp|Q14671|PUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3122.6	25.06945	2	1420.622447	1420.623540	R	R	707	719
PSM	DNPGVVTCLDEAR	2003	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3385.4	31.64515	2	1444.661647	1444.661643	K	H	227	240
PSM	AQGPAASAEEPKPVEAPAANSDQTVTVKE	2004	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3206.5	27.15658	4	2891.415694	2891.414861	K	-	199	228
PSM	QGSEIQDSPDFR	2005	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3272.5	28.7898	2	1457.577047	1457.582404	R	I	477	489
PSM	DRVHHEPQLSDK	2006	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2773.2	16.85573	3	1459.712471	1459.716790	K	V	26	38
PSM	NGVMPSHFSRGSK	2007	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2969.5	21.19038	3	1482.642371	1482.643898	R	S	85	98
PSM	NGVMPSHFSRGSK	2008	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2977.5	21.3953	2	1482.643847	1482.643898	R	S	85	98
PSM	KGSQFGQSCCLR	2009	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.3005.4	22.08502	2	1506.607047	1506.610884	K	A	328	340
PSM	SAVGHEYQSKLSK	2010	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2848.3	18.38258	3	1512.696071	1512.697374	K	H	98	111
PSM	SASASPLTPCSVTR	2011	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3290.6	29.24985	2	1512.665447	1512.664359	R	S	364	378
PSM	QLSSSSSYSGDISR	2012	sp|P33527|MRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3126.5	25.1696	2	1552.639447	1552.640647	R	H	913	927
PSM	VPSPLEGSEGDGDTD	2013	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3400.5	32.037	2	1553.577447	1553.577043	K	-	413	428
PSM	QIRSSTTSMTSVPK	2014	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2855.4	18.53418	3	1617.740171	1617.743338	R	P	81	95
PSM	KDSSSVVEWTQAPK	2015	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3350.2	30.76387	3	1640.747771	1640.744718	R	E	68	82
PSM	TAKKSEEEIDFLR	2016	sp|Q9Y262|EIF3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3345.3	30.63783	3	1644.775871	1644.776018	K	S	204	217
PSM	AFGSGYRRDDDYR	2017	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3048.6	23.18573	2	1656.6664	1656.6677	R	G	280	293
PSM	EAAALGSRGSCSTEVEK	2018	sp|O75348|VATG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.2913.4	19.85002	3	1830.778271	1830.781908	K	E	59	76
PSM	SGPKPFSAPKPQTSPSPK	2019	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3054.2	23.3237	4	1996.905294	1996.906060	R	R	295	313
PSM	SPSKPLPEVTDEYKNDVK	2020	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.4	29.97297	4	2125.002094	2124.998032	R	N	92	110
PSM	GQNQDYRGGKNSTWSGESK	2021	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2843.4	18.24938	4	2177.908894	2177.912739	K	T	468	487
PSM	SIPLSIK	2022	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3508.2	34.74847	2	836.437847	836.440872	K	N	515	522
PSM	ILSGVVTK	2023	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3575.2	36.43877	2	895.478247	895.477985	R	M	72	80
PSM	SMTLEIR	2024	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	34.21395	2	928.406047	928.408919	R	E	346	353
PSM	SLSVLSPR	2025	sp|P53814|SMTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3446.2	33.20338	2	937.462047	937.463398	R	Q	299	307
PSM	KLSFDFQ	2026	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3736.2	40.47335	2	963.409447	963.410300	R	-	465	472
PSM	FSVCVLGDQQHCDEAK	2027	sp|P62906|RL10A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,4-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3535.2	35.42855	4	1971.787294	1971.785614	K	A	63	79
PSM	NDSLPVLR	2028	sp|Q9GZY8-5|MFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3501.2	34.56672	2	992.466647	992.469212	R	G	144	152
PSM	DVFQELEK	2029	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3635.2	37.94887	2	1006.496447	1006.497127	K	R	413	421
PSM	DLSLVPER	2030	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3547.2	35.7272	2	1007.467647	1007.468877	R	L	21	29
PSM	DLSLVPER	2031	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3555.2	35.9314	2	1007.467647	1007.468877	R	L	21	29
PSM	GLTSVINQK	2032	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3483.3	34.11398	2	1038.509247	1038.511076	R	L	300	309
PSM	EIIDLVLDR	2033	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4142.2	48.94272	2	1084.612447	1084.612825	K	I	113	122
PSM	DLNSYLEDK	2034	sp|O43324|MCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3481.5	34.06898	2	1095.504647	1095.508420	K	V	97	106
PSM	AVDSLVPIGR	2035	sp|P25705|ATPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3743.5	40.66393	2	1105.553447	1105.553276	K	G	195	205
PSM	RPSWFTQN	2036	sp|Q9BYC8|RM32_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3442.2	33.09955	2	1114.457447	1114.459709	K	-	181	189
PSM	MSDGLFLQK	2037	sp|P50213|IDH3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3690.3	39.3168	2	1117.488047	1117.487898	R	C	206	215
PSM	GLSQSALPYR	2038	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3506.2	34.69647	2	1170.542047	1170.543439	K	R	10	20
PSM	ILTERGYSFTTTAER	2039	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3445.3	33.18083	3	1823.851571	1823.845495	K	E	192	207
PSM	QLSILVHPDK	2040	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3526.2	35.20278	2	1228.621247	1228.621690	R	N	79	89
PSM	DRSSTTSTWELLDQR	2041	sp|Q9HA77|SYCM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3795.3	41.96427	3	1873.821671	1873.820736	K	T	542	557
PSM	QVVESAYEVIK	2042	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3413.5	32.36903	2	1263.667247	1263.671068	K	L	233	244
PSM	NLSMPDLENR	2043	sp|Q13425|SNTB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3672.4	38.86883	2	1267.525047	1267.526803	R	L	256	266
PSM	KDSFFSNISR	2044	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3482.4	34.0915	2	1279.558247	1279.559818	K	S	562	572
PSM	SIFASPESVTGK	2045	sp|O75940|SPF30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3560.4	36.0657	2	1301.589047	1301.590449	R	V	197	209
PSM	NELESYAYSLK	2046	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3595.4	36.92142	2	1315.628447	1315.629597	R	N	563	574
PSM	SFCISTLANTK	2047	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.3794.4	41.94208	2	1320.579247	1320.578504	K	A	977	988
PSM	DSPPKNSVKVDELSLYSVPEGQSK	2048	sp|Q9BUR5|MIC26_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3657.4	38.49415	4	2682.283294	2682.278958	K	Y	28	52
PSM	DYEEVGADSADGEDEGEEY	2049	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3446.5	33.21338	3	2077.739771	2077.739614	K	-	431	450
PSM	ERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAK	2050	sp|Q12797|ASPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3562.5	36.12065	6	4302.916941	4302.896547	K	E	111	149
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	2051	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3698.5	39.53157	4	2988.164494	2988.155727	K	E	144	170
PSM	NGESSELDLQGIR	2052	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3601.4	37.07567	2	1496.652247	1496.650817	R	I	112	125
PSM	ADTSSQGALVFLSK	2053	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3921.4	44.92898	2	1502.703447	1502.701790	K	D	604	618
PSM	QNVNYQGGRQSEPAAPPLEVSEEQVAR	2054	sp|Q8NBM4|UBAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3499.3	34.51852	4	3032.402094	3032.398907	R	L	286	313
PSM	EAAGKSSGPTSLFAVTVAPPGAR	2055	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4026.5	47.1429	3	2330.076071	2330.070894	K	Q	182	205
PSM	RKDSSEESDSSEESDIDSEASSALFMAK	2056	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.3666.3	38.71713	4	3132.258894	3132.260210	R	K	338	366
PSM	ISSLLEEQFQQGK	2057	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3860.2	43.50733	3	1585.738271	1585.738904	K	L	158	171
PSM	ASSSAGTDPQLLLYR	2058	sp|Q6UVK1|CSPG4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3802.6	42.1521	2	1657.773047	1657.771267	R	V	1607	1622
PSM	SYSPYDMLESIRK	2059	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4104.2	48.42636	3	1667.727371	1667.726625	K	E	234	247
PSM	SQGSQAELHPLPQLK	2060	sp|Q15172|2A5A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3439.2	33.02151	3	1711.827971	1711.829451	R	D	46	61
PSM	DLEIERPILGQNDNK	2061	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3536.4	35.46087	3	1752.895571	1752.900627	R	S	234	249
PSM	LGQDSLTPEQVAWRK	2062	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3516.2	34.95543	3	1806.864371	1806.866564	R	L	508	523
PSM	QVPDSAATATAYLCGVK	2063	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3775.2	41.45502	3	1830.826271	1830.822317	R	A	107	124
PSM	VSKNSETFPTILEEAK	2064	sp|O60610|DIAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3735.4	40.45388	3	1871.893571	1871.891776	K	E	1250	1266
PSM	SIYGEKFEDENFILK	2065	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3991.2	46.46112	3	1910.876771	1910.870312	K	H	77	92
PSM	QYTSPEEIDAQLQAEK	2066	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3687.3	39.24109	3	1928.843771	1928.840469	R	Q	16	32
PSM	DYLSSSFLCSDDDRASK	2067	sp|Q96GX5|GWL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3761.4	41.1208	3	2044.808771	2044.808517	R	N	547	564
PSM	SNCKPSTFAYPAPLEVPK	2068	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3718.3	40.03259	3	2084.966771	2084.964230	K	E	804	822
PSM	DNLTLWTSDQQDDDGGEGNN	2069	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3992.2	46.49647	3	2192.879771	2192.873028	R	-	228	248
PSM	RDSSDDWEIPDGQITVGQR	2070	sp|P15056|BRAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3798.5	42.0507	3	2252.967071	2252.969920	R	I	444	463
PSM	HNGTGGKSIYGEKFEDENFILK	2071	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	37.1463	4	2562.182494	2562.179185	R	H	70	92
PSM	SRPNASGGAACSGPGPEPAVFCEPVVK	2072	sp|Q6L8Q7|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:4,12-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3586.6	36.73005	3	2777.234171	2777.230251	K	L	98	125
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	2073	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3580.4	36.58117	4	3724.482494	3724.469745	R	N	77	111
PSM	SGDEMIFDPTMSK	2074	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,5-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3747.4	40.76348	2	1610.5901	1610.5876	M	K	2	15
PSM	SDSSSKKDVIELTDDSFDK	2075	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3541.3	35.58168	3	2194.9540	2194.9513	R	N	154	173
PSM	CESAFLSK	2076	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3724.3	40.18538	2	1003.3693	1003.3717	K	R	36	44
PSM	GMGSLDAMDK	2077	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3027.4	22.65193	2	1119.397047	1119.397763	R	H	413	423
PSM	RQMSVPGIFNPHEIPEEMCD	2078	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:35,4-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3950.3	45.6205	3	2481.022571	2481.016419	K	-	1052	1072
PSM	QMSVPGIFNPHEIPEEMCD	2079	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,17-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=1.1.4413.2	52.34022	3	2324.922371	2324.915308	R	-	1053	1072
PSM	QMSVPGIFNPHEIPEEMCD	2080	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:35,3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4389.2	52.06339	3	2324.922071	2324.915308	R	-	1053	1072
PSM	CRDDSFFGETSHNYHK	2081	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3334.4	30.35838	3	2061.7705	2061.7671	R	F	230	246
PSM	SSNDYTSQMYSAK	2082	sp|Q99504|EYA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3176.6	26.42432	2	1560.579247	1560.580355	R	P	63	76
PSM	KISGTTALQEALK	2083	sp|P30622|CLIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3507.5	34.73248	2	1438.741847	1438.743261	R	E	346	359
PSM	CSSILLHGK	2084	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	43.35685	2	1076.4712	1076.4721	R	E	518	527
PSM	SIAACHNVGLLAHDGQVNEDGQPDLGK	2085	sp|Q96BR5|COA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3522.4	35.11018	4	2894.307294	2894.301836	K	A	107	134
PSM	QGSTQGRLDDFFK	2086	sp|P39748|FEN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4045.4	47.46913	2	1560.6624	1560.6605	R	V	333	346
PSM	SFLFSSRSSK	2087	sp|Q9H8S9|MOB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4557.2	53.86968	2	1346.5325	1346.5304	M	T	2	12
PSM	SFAESGWR	2088	sp|Q8N6S5|AR6P6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3825.2	42.64225	2	1060.4049	1060.4010	M	S	2	10
PSM	STRESFNPESYELDK	2089	sp|P49903|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3708.4	39.77805	3	1922.8001	1922.7930	M	S	2	17
PSM	DSSTSPGDYVLSVSENSR	2090	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3857.5	43.44418	3	1978.818671	1978.815711	R	V	39	57
PSM	QKLSECSLTK	2091	sp|Q96PZ0|PUS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3230.5	27.73077	2	1255.5497	1255.5514	K	G	33	43
PSM	QLSLTPR	2092	sp|Q9NYK5|RM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3766.2	41.22973	2	876.4073	876.4101	R	T	55	62
PSM	TSSFTEQLDEGTPNRENASTHASK	2093	sp|Q13439-5|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3150.5	25.78217	4	2686.148494	2686.150798	R	S	39	63
PSM	FEYKYSFK	2094	sp|P49257|LMAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3425.3	32.67235	2	1190.502847	1190.504928	R	G	46	54
PSM	KGSRIYLEGK	2095	sp|Q04837|SSBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2927.2	20.19617	3	1229.614271	1229.616938	K	I	104	114
PSM	KLSRECEIK	2096	sp|Q13951|PEBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2813.2	17.60073	3	1241.582771	1241.583924	R	Y	20	29
PSM	EKEEHTQEEGTVPSRTIEEEK	2097	sp|P41162|ETV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2662.2	16.03367	5	2565.1212	2564.1272	R	G	399	420
PSM	QGGGGGGGSVPGIER	2098	sp|P52272|HNRPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3037.5	22.90472	2	1363.590847	1363.588158	K	M	389	404
PSM	SMIEISR	2099	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3281.2	29.00347	2	914.392447	914.393269	K	T	79	86
PSM	RGVSREEIER	2100	sp|Q9UIK4|DAPK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2870.5	18.8553	3	1309.602671	1309.613978	R	E	64	74
PSM	RESCGSSVLTDFEGK	2101	sp|O15231|ZN185_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3539.3	35.53248	3	1750.727471	1750.723331	R	D	463	478
PSM	SMSVYCTPNKPSRTSMSK	2102	sp|P16615|AT2A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,6-UNIMOD:4,15-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=1.1.3013.4	22.29073	4	2235.876894	2235.876494	K	M	493	511
PSM	SRSLSASPALGSTK	2103	sp|O95544|NADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3090.4	24.25733	2	1520.662247	1520.663705	K	E	44	58
PSM	LGDMRNSATFK	2104	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3092.3	24.30522	2	1318.571647	1318.574087	K	S	155	166
PSM	EKLTEELQK	2105	sp|Q7Z7A1|CNTRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3337.2	30.42903	2	1196.564247	1196.568985	K	L	1541	1550
PSM	DMDLACKYSMK	2106	sp|Q96BR5|COA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3366.2	31.17072	3	1440.547871	1440.548861	K	A	167	178
PSM	ALSRQLSSGVSEIR	2107	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	36.46803	3	1662.740771	1661.753917	R	H	76	90
PSM	GYFEYIEENKYSR	2108	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3651.2	38.33753	3	1776.740771	1776.739633	R	A	256	269
PSM	TLDQSPELR	2109	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3712.4	39.8807	2	1137.505047	1137.506719	R	S	1162	1171
PSM	SRSDIDVNAAAGAK	2110	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2948.2	20.66998	2	1453.656047	1453.656237	R	A	368	382
PSM	QLSESFK	2111	sp|Q08945|SSRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3115.2	24.87983	2	917.388847	917.389564	R	S	655	662
PSM	AQALRDNSTMGYMAAKK	2112	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.2928.3	20.22513	4	1950.869294	1950.869284	K	H	616	633
PSM	EIAEAYLGK	2113	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3249.3	28.19947	2	992.516847	992.517862	K	T	129	138
PSM	TSLFENDK	2114	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3172.2	26.30803	2	1032.416647	1032.416507	R	D	702	710
PSM	AKSIVFHR	2115	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2935.3	20.40627	2	1036.519447	1036.521916	K	K	133	141
PSM	KRSASADNLTLPR	2116	sp|Q8ND76|CCNY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3142.2	25.56815	3	1587.716171	1587.717137	R	W	322	335
PSM	SLSAMDVEK	2117	sp|Q6ZV73|FGD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3261.2	28.506	2	1058.442447	1058.435528	K	C	605	614
PSM	TSLGPNGLDK	2118	sp|P48643|TCPE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3151.2	25.79767	2	1080.482647	1080.485256	R	M	50	60
PSM	VETVGQPDRRDSIGVCAEK	2119	sp|Q8IUI8|CRLF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3057.3	23.40158	4	2195.0128941913204	2195.0041969219697	R	Q	321	340
PSM	SIPHITSDR	2120	sp|Q14194|DPYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3094.2	24.35047	2	1104.495847	1104.496489	K	L	8	17
PSM	ARQLSLTPR	2121	sp|Q9NYK5|RM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3059.4	23.45587	2	1120.572647	1120.575408	K	T	53	62
PSM	CNSLSTLEK	2122	sp|P13473|LAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3110.3	24.7606	2	1130.464247	1130.467891	R	N	153	162
PSM	RTSSTCSNESLSVGGTSVTPR	2123	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3187.3	26.69983	4	2261.994894	2261.994755	K	R	748	769
PSM	IGAEVYHNLK	2124	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3063.3	23.55585	2	1142.606247	1142.608408	R	N	184	194
PSM	GFSIPECQK	2125	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3397.2	31.94633	2	1144.460047	1144.462412	R	L	95	104
PSM	DRLGTVYEK	2126	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2999.6	21.94398	2	1159.526047	1159.527455	R	F	633	642
PSM	KTSSFLDQR	2127	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3091.2	24.27643	2	1160.521447	1160.522704	R	F	401	410
PSM	RISAVSVAER	2128	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3046.4	23.12832	2	1166.5756470956603	1166.58088699994	R	V	447	457
PSM	LFSQDECAK	2129	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3295.3	29.36923	2	1176.451847	1176.452241	R	I	94	103
PSM	TCTTVAFTQVNSEDK	2130	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3390.4	31.77267	3	1779.738971	1779.738647	K	G	198	213
PSM	KGTAKVDFLK	2131	sp|Q9P2J5|SYLC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3118.3	24.95745	2	1185.611447	1185.615876	R	K	5	15
PSM	QLSILVHPDKNQDDADRAQK	2132	sp|O75937|DNJC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3283.4	29.06207	4	2370.134894	2370.132903	R	A	79	99
PSM	NSSISGPFGSR	2133	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3286.5	29.14308	2	1187.497047	1187.497217	R	S	483	494
PSM	SIRPGLSPYR	2134	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3203.4	27.07848	2	1224.598447	1224.601623	R	A	52	62
PSM	SDSSQPMLLR	2135	sp|P11532|DMD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3217.3	27.42555	2	1228.517847	1228.515904	R	V	3621	3631
PSM	SASWGSADQLK	2136	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3322.3	30.04633	2	1228.512247	1228.512533	R	E	221	232
PSM	QVTSNSLSGTQEDGLDDPRLEK	2137	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3360.5	31.026	4	2468.106094	2468.106807	R	L	132	154
PSM	TLSSSSMDLSR	2138	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3302.4	29.54693	2	1262.518447	1262.521383	R	R	606	617
PSM	DNSTMGYMMAK	2139	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:35	ms_run[1]:scan=1.1.3110.5	24.76727	2	1263.495247	1263.493380	R	K	486	497
PSM	RSSFSMEEES	2140	sp|P19532|TFE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3116.2	24.90458	2	1267.441047	1267.442798	R	-	566	576
PSM	RTSYEPFHPGPSPVDHDSLESK	2141	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3311.3	29.77072	4	2561.132094	2561.122398	R	R	86	108
PSM	NQSTTYPVYTESTDDK	2142	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3245.3	28.09632	3	1927.775771	1927.772449	R	H	1070	1086
PSM	ALPRRSTSPIIGSPPVR	2143	sp|Q86TB9|PATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3356.3	30.91813	3	1962.985271	1962.980563	R	A	172	189
PSM	NTPSISEEQIK	2144	sp|Q9H814|PHAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3174.5	26.36962	2	1324.590047	1324.591177	K	D	295	306
PSM	SSPSARPPDVPGQQPQAAK	2145	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3030.5	22.73307	3	1996.938071	1996.936769	R	S	82	101
PSM	QIRSSTTSMTSVPKPLK	2146	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3264.4	28.58895	3	2019.948371	2019.946545	R	F	81	98
PSM	GEPNVSYICSR	2147	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3211.5	27.28252	2	1360.555847	1360.548267	R	Y	273	284
PSM	GEPNVSYICSR	2148	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3230.6	27.7341	2	1360.549647	1360.548267	R	Y	273	284
PSM	AQSSPAAPASLSAPEPASQAR	2149	sp|Q8WUI4|HDAC7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3299.3	29.46957	3	2072.956271	2072.952813	R	V	484	505
PSM	EGLELPEDEEEK	2150	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3349.5	30.74792	2	1415.629047	1415.630385	K	K	412	424
PSM	RNSCPLTPVVSK	2151	sp|Q6IN84|MRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3109.5	24.74183	2	1436.685847	1436.684701	R	S	179	191
PSM	ALQRPSAAAPQAENGPAAAPAVAAPAATEAPK	2152	sp|Q15020|SART3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3384.5	31.62387	4	3044.508094	3044.508064	R	M	919	951
PSM	RRLDSSCLESVK	2153	sp|Q9NZJ0|DTL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3050.2	23.2226	3	1528.708571	1528.706893	K	Q	553	565
PSM	SASSPRLSSSLDNK	2154	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3042.2	23.01867	3	1527.694571	1527.693017	R	E	470	484
PSM	SLPGEQEQEVAGSK	2155	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3108.6	24.71948	2	1537.660047	1537.666133	R	V	1609	1623
PSM	RKSTTPCMIPVK	2156	sp|Q9H4I2|ZHX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3175.3	26.38865	3	1576.687271	1576.690788	K	T	5	17
PSM	SDSRGKSSFFSDR	2157	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3143.4	25.6008	3	1634.607671	1634.612732	R	G	76	89
PSM	AKSTCSCPDLQPNGQDLGENSR	2158	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,5-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.3162.6	26.06397	3	2513.031671	2513.031217	K	V	56	78
PSM	AYVFERDQSVGDPK	2159	sp|Q14108|SCRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3242.4	28.02302	3	1689.740171	1689.739967	K	I	116	130
PSM	QQSIAGSADSKPIDVSR	2160	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3107.3	24.6837	3	1837.854971	1837.857122	K	L	138	155
PSM	ANNPEQNRLSECEEQAK	2161	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2965.5	21.08755	3	2095.863671	2095.863012	R	A	141	158
PSM	SGRESVSTASDQPSHSLER	2162	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2897.3	19.48357	3	2108.917571	2108.912405	R	Q	958	977
PSM	QKNSGQNLEEDMGQSEQK	2163	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3023.6	22.55513	3	2128.871171	2128.873242	K	A	33	51
PSM	PKFSVCVLGDQQHCDEAK	2164	sp|P62906|RL10A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,6-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3392.3	31.82097	4	2196.936494	2196.933341	R	A	61	79
PSM	QDGPMPKPHSVSLNDTETRK	2165	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3082.2	24.04432	5	2316.054618	2316.056961	K	L	155	175
PSM	KASSDLDQASVSPSEEENSESSSESEK	2166	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3052.6	23.28638	3	2922.173771	2922.177526	R	T	172	199
PSM	SQSPAASDCSSSSSSASLPSSGRSSLGSHQLPR	2167	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:4,20-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3268.3	28.69042	4	3421.422894	3421.424286	R	G	171	204
PSM	NFDEILR	2168	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3484.2	34.13648	2	905.458047	905.460681	R	V	156	163
PSM	GLFIIDDK	2169	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3742.2	40.62785	2	919.499447	919.501484	R	G	129	137
PSM	ISFFLEK	2170	sp|Q96FF9|CDCA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4052.2	47.61517	2	962.449447	962.451436	R	E	82	89
PSM	KLSFDFQ	2171	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3858.2	43.45627	2	963.409647	963.410300	R	-	465	472
PSM	NDSLPVLR	2172	sp|Q9GZY8-5|MFF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3509.2	34.77433	2	992.466647	992.469212	R	G	144	152
PSM	DISLSDYK	2173	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3457.2	33.4742	2	1019.418047	1019.421258	K	G	28	36
PSM	LASVAQELK	2174	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3414.2	32.38493	2	1037.505447	1037.515827	R	E	142	151
PSM	SFSMQDLR	2175	sp|Q9H6H4|REEP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3553.2	35.87977	2	1062.421647	1062.420547	R	S	150	158
PSM	SLSELESLK	2176	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3788.2	41.7821	2	1084.503247	1084.505322	R	L	238	247
PSM	SADTLWGIQK	2177	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3493.2	34.36477	2	1117.576847	1117.576774	K	E	319	329
PSM	SLPGPAPCLK	2178	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3415.4	32.41737	2	1118.518847	1118.519533	R	H	100	110
PSM	DKFSFDLGK	2179	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3641.3	38.09197	2	1135.495647	1135.495092	K	G	75	84
PSM	DKFSFDLGK	2180	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3632.3	37.87438	2	1135.495647	1135.495092	K	G	75	84
PSM	GRYSLDVWS	2181	sp|P16435|NCPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3802.2	42.13877	2	1161.487847	1161.485590	K	-	669	678
PSM	STFVLDEFK	2182	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4072.2	47.94733	2	1164.511647	1164.510408	K	R	286	295
PSM	SRESMIQLF	2183	sp|Q8N142|PURA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3768.3	41.28417	2	1205.514847	1205.515176	K	-	449	458
PSM	SINQPVAFVR	2184	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3599.2	37.01743	2	1209.591847	1209.590724	R	R	15	25
PSM	QCSFSEYLK	2185	sp|P26374|RAE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3662.4	38.6209	2	1240.481247	1240.483541	R	T	319	328
PSM	TPSLSPASSLDV	2186	sp|Q32P44|EMAL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4023.3	47.06802	2	1252.558647	1252.558815	R	-	885	897
PSM	TSMCSIQSAPPEPATLK	2187	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3504.5	34.6544	3	1896.833771	1896.836252	R	G	410	427
PSM	EGMNIVEAMER	2188	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3713.4	39.90657	2	1277.575847	1277.574407	K	F	134	145
PSM	GYFEYIEENK	2189	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3621.5	37.59665	2	1290.576047	1290.576833	R	Y	256	266
PSM	AMSLVSNEGEGEQNEIR	2190	sp|Q14573|ITPR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3490.4	34.29767	3	1941.815471	1941.813937	R	I	2607	2624
PSM	SCSISPVLEVK	2191	sp|Q9P0V3|SH3B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3593.3	36.86913	2	1297.597047	1297.598905	R	L	371	382
PSM	GLSASTMDLSSSS	2192	sp|Q9NSK0|KLC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3692.6	39.37775	2	1321.509247	1321.510878	R	-	607	620
PSM	SIQEELQQLR	2193	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3741.5	40.61232	2	1322.622847	1322.623146	R	Q	1554	1564
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	2194	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3484.4	34.14315	4	2727.242494	2727.234862	R	G	70	97
PSM	YQLDPTASISAK	2195	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3430.5	32.80168	2	1372.625047	1372.627563	K	V	236	248
PSM	RLDSDAVNTIESQSVSPDHNKEPK	2196	sp|Q9H3H1|MOD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3453.5	33.38757	4	2745.263694	2745.260682	R	E	428	452
PSM	KKASLVALPEQTASEEETPPPLLTK	2197	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3702.4	39.62522	4	2756.427294	2756.424894	R	E	397	422
PSM	DFTPVCTTELGR	2198	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3539.4	35.53582	2	1394.649447	1394.650015	R	A	42	54
PSM	RAEDGSVIDYELIDQDAR	2199	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3735.5	40.45722	3	2143.949471	2143.942308	R	D	179	197
PSM	HFSIMDFNSEK	2200	sp|Q6XZF7|DNMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3750.2	40.83437	3	1433.573171	1433.568668	R	D	576	587
PSM	AITGASLADIMAK	2201	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,6-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3679.4	39.0458	2	1436.603047	1436.602350	R	R	81	94
PSM	TLTIVDTGIGMTK	2202	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3756.6	41.00038	2	1444.688047	1444.688449	R	A	28	41
PSM	SIDLPIQSSLCR	2203	sp|O95757|HS74L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.4025.2	47.10795	2	1467.682047	1467.679281	K	Q	579	591
PSM	GALQNIIPASTGAAK	2204	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3640.2	38.07218	2	1490.746647	1490.749409	R	A	201	216
PSM	SNFSLEDFQHSK	2205	sp|P56937|DHB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3571.4	36.3451	2	1517.619447	1517.618789	K	G	177	189
PSM	CSLPAEEDSVLEK	2206	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3510.6	34.81343	2	1555.646847	1555.647706	K	L	635	648
PSM	TYSLGSALRPSTSR	2207	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3481.3	34.06232	3	1574.742071	1574.745387	R	S	37	51
PSM	VDSTTCLFPVEEK	2208	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3803.4	42.16963	2	1603.685647	1603.684092	R	A	259	272
PSM	VPTANVSVVDLTCR	2209	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3701.5	39.60363	2	1609.754047	1609.753509	R	L	235	249
PSM	KKSPNELVDDLFK	2210	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3733.5	40.40532	3	1611.792671	1611.790940	R	G	112	125
PSM	KQSESEDTLPSFSS	2211	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3512.4	34.8584	2	1620.657047	1620.655628	K	-	287	301
PSM	SGSIGAADSPENWEK	2212	sp|Q96FZ2|HMCES_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3427.2	32.71883	2	1626.651447	1626.656297	K	V	152	167
PSM	SLNLVDSPQPLLEK	2213	sp|P46019|KPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4079.2	48.02493	3	1631.819171	1631.817155	K	V	729	743
PSM	SDSSADCQWLDTLR	2214	sp|Q9NYL2|M3K20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4079.3	48.0316	3	1732.677371	1732.676381	R	M	565	579
PSM	QDRTLTIVDTGIGMTK	2215	sp|Q58FG1|HS904_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3772.4	41.39015	3	1827.878171	1827.880166	K	A	25	41
PSM	ADNFEYSDPVDGSISR	2216	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3598.4	36.99828	3	1850.738171	1850.736004	K	N	471	487
PSM	SCGSSTPDEFPTDIPGTK	2217	sp|P41091|IF2G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3686.6	39.22625	2	1974.794847	1974.791804	R	G	104	122
PSM	ETSLAENIWQEQPHSK	2218	sp|O60566|BUB1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3574.4	36.41978	3	1975.869971	1975.867687	R	G	507	523
PSM	VPTANVSVVDLTCRLEK	2219	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3828.6	42.73212	3	1979.977871	1979.975129	R	P	235	252
PSM	DDGLFSGDPNWFPKKSK	2220	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3942.2	45.45177	3	2016.902171	2016.898258	R	E	140	157
PSM	ILATPPQEDAPSVDIANIR	2221	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3941.3	45.42638	3	2099.036771	2099.030001	K	M	284	303
PSM	DLLLTSSYLSDSGSTGEHTK	2222	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3721.6	40.11957	3	2110.013771	2110.006609	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	2223	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3952.3	45.66207	3	2192.880971	2192.873028	R	-	228	248
PSM	TVGTPIASVPGSTNTGTVPGSEK	2224	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3452.4	33.36007	3	2236.0630	2236.0619	R	D	270	293
PSM	QQSTSSDRVSQTPESLDFLK	2225	sp|Q12965|MYO1E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3753.5	40.92159	3	2332.062971	2332.058401	R	V	1000	1020
PSM	DYEEVGVDSVEGEGEEEGEEY	2226	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3812.6	42.3947	3	2347.906871	2347.897571	K	-	431	452
PSM	DSGSDEDFLMEDDDDSDYGSSK	2227	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3521.5	35.08893	3	2443.862471	2443.860534	K	K	129	151
PSM	SASPDDDLGSSNWEAADLGNEERK	2228	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3643.6	38.15043	3	2642.081171	2642.076964	R	Q	15	39
PSM	KDSSEESDSSEESDIDSEASSALFMAK	2229	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3970.4	46.06303	3	2960.178071	2960.164184	R	K	339	366
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2230	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3561.5	36.09487	4	3562.499694	3562.491898	K	V	60	92
PSM	HQGVMVGMGQKDSYVGDEAQSK	2231	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:35,8-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3204.3	27.10012	4	2462.024894	2462.024341	R	R	42	64
PSM	KQSSSEISLAVER	2232	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3240.6	27.97918	2	1512.714047	1512.718503	R	A	454	467
PSM	LQSIGTENTEENRR	2233	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2932.3	20.3287	3	1725.767471	1725.768307	R	F	44	58
PSM	QRSLGPSLATDK	2234	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3317.5	29.92513	2	1334.6241	1334.6226	R	S	268	280
PSM	GASQAGMTGYGMPR	2235	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=1.1.3370.6	31.28702	2	1494.565847	1494.563266	R	Q	183	197
PSM	ASGVAVSDGVIK	2236	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3579.4	36.54888	2	1223.5700	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	2237	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3673.3	38.89095	2	1223.5770	1223.5794	M	V	2	14
PSM	LDIDSPPITAR	2238	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3614.4	37.41163	2	1276.607447	1276.606433	R	N	33	44
PSM	AHSSMVGVNLPQK	2239	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3056.5	23.38348	2	1462.660447	1462.663965	R	A	172	185
PSM	LRSSVPGVR	2240	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3015.4	22.34235	2	1129.504047	1129.504625	R	L	70	79
PSM	GMGSLDAMDK	2241	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:35,4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3332.3	30.3035	2	1135.390847	1135.392678	R	H	413	423
PSM	ADFDTYDDRAYSSFGGGR	2242	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3944.3	45.50577	3	2120.8187	2120.8108	M	G	2	20
PSM	RQTFITLEK	2243	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3293.4	29.32108	2	1214.604247	1214.606039	R	F	1218	1227
PSM	KETPPPLVPPAAR	2244	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3286.2	29.13308	3	1451.754971	1451.753766	R	E	3	16
PSM	RQMSVPGIFNPHEIPEEMCD	2245	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,18-UNIMOD:35,19-UNIMOD:4	ms_run[1]:scan=1.1.3930.4	45.15093	3	2481.027371	2481.016419	K	-	1052	1072
PSM	QMSVPGIFNPHEIPEEMCD	2246	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:35,3-UNIMOD:21,17-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=1.1.4025.3	47.11795	3	2340.916271	2340.910223	R	-	1053	1072
PSM	QMSVPGIFNPHEIPEEMCD	2247	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4870.2	56.71902	3	2308.928471	2308.920393	R	-	1053	1072
PSM	DLIDDLK	2248	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3799.2	42.06307	2	830.436847	830.438549	R	S	63	70
PSM	DMGSVALDAGTAK	2249	sp|Q9HCN4|GPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3062.5	23.53663	2	1330.548247	1330.547598	K	D	298	311
PSM	PRLSRATVHDPETGK	2250	sp|P13674-2|P4HA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2923.3	20.09653	4	1822.813294	1822.812829	K	L	358	373
PSM	SIAACHNVGLLAHDGQVNEDGQPDLGK	2251	sp|Q96BR5|COA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3531.6	35.3399	4	2894.307294	2894.301836	K	A	107	134
PSM	LGLMRDDTIYEDEDVK	2252	sp|P14927|QCR7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3435.4	32.92475	3	2006.851271	2006.854405	K	E	30	46
PSM	STYYWPRPR	2253	sp|Q4V321|GAG13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3369.4	31.25467	2	1304.570247	1304.570323	R	R	7	16
PSM	ILGSLDALPMEEEEEEDK	2254	sp|Q9BWT1|CDCA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0		ms_run[1]:scan=1.1.2887.2	19.22233	4	2046.9372	2045.9342	R	Y	187	205
PSM	AVSRSQRAGLQFPVGR	2255	sp|Q71UI9|H2AV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3210.2	27.24675	4	1889.894894	1887.886997	K	I	17	33
PSM	RFTDYCDLNK	2256	sp|Q9H4F8|SMOC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3226.5	27.63037	2	1410.564647	1410.563917	R	D	403	413
PSM	KTPSPKINK	2257	sp|Q5TBE3|CI153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2924.6	20.13262	2	1171.542447	1171.540342	R	-	93	102
PSM	HESLRPAAGQSRPPTAR	2258	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2841.4	18.1991	4	1909.927694	1909.927208	R	T	408	425
PSM	RASVFVK	2259	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2950.4	20.70378	2	885.447447	885.447354	K	L	154	161
PSM	RLSSGEDTTELRK	2260	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2887.4	19.229	3	1570.730771	1570.735216	K	K	912	925
PSM	KTRYDTSLGLLTK	2261	sp|O00716-2|E2F3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	27.22453	3	1575.799271	1574.806924	K	K	45	58
PSM	GRLGSVDSFER	2262	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3250.5	28.23187	2	1301.576047	1301.576530	R	S	584	595
PSM	LSDLDSETRSMVEK	2263	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3296.3	29.39507	3	1689.725771	1688.732833	K	M	276	290
PSM	KLELAERVDTDFMQLK	2264	sp|Q9H6P5|TASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3324.4	30.10127	4	2018.009694	2014.979880	R	K	202	218
PSM	SVATITPEELNCERPR	2265	sp|Q92626|PXDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3460.3	33.55293	3	1950.888071	1950.887042	R	I	232	248
PSM	MPSLPSYK	2266	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3529.2	35.27657	2	1017.422447	1017.424236	R	V	303	311