MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000150 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617204740166495^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_05_K2_1.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	67.0	null	2-UNIMOD:1,19-UNIMOD:21,596-UNIMOD:21,628-UNIMOD:4,594-UNIMOD:21,9-UNIMOD:21,4-UNIMOD:21,536-UNIMOD:21,541-UNIMOD:21,620-UNIMOD:21,14-UNIMOD:21,26-UNIMOD:21,752-UNIMOD:21,757-UNIMOD:21	0.15	67.0	16	5	2
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	59.0	null	118-UNIMOD:21,120-UNIMOD:21,27-UNIMOD:21,101-UNIMOD:21,143-UNIMOD:21,26-UNIMOD:21	0.27	59.0	17	5	2
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	57.0	null	495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21	0.05	57.0	1	1	1
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0	null	641-UNIMOD:21,646-UNIMOD:21,638-UNIMOD:21,692-UNIMOD:21,696-UNIMOD:21,691-UNIMOD:21	0.08	54.0	11	2	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	115-UNIMOD:21,114-UNIMOD:21,159-UNIMOD:21,175-UNIMOD:21,447-UNIMOD:4,455-UNIMOD:21,447-UNIMOD:385,225-UNIMOD:21,231-UNIMOD:21,453-UNIMOD:21,70-UNIMOD:21,113-UNIMOD:21,164-UNIMOD:21,206-UNIMOD:21,105-UNIMOD:21,158-UNIMOD:28,163-UNIMOD:21,173-UNIMOD:21	0.22	51.0	46	11	2
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null	743-UNIMOD:21,758-UNIMOD:4,751-UNIMOD:21	0.04	51.0	10	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null	259-UNIMOD:21,193-UNIMOD:35,198-UNIMOD:21,327-UNIMOD:35,341-UNIMOD:21,199-UNIMOD:21,201-UNIMOD:21,225-UNIMOD:21	0.28	51.0	12	5	2
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	147-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,65-UNIMOD:21,64-UNIMOD:21	0.22	50.0	6	3	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	557-UNIMOD:21,809-UNIMOD:21,561-UNIMOD:21	0.06	49.0	9	3	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	405-UNIMOD:21,418-UNIMOD:21,401-UNIMOD:21,332-UNIMOD:21,209-UNIMOD:21,411-UNIMOD:21,172-UNIMOD:21,417-UNIMOD:21,331-UNIMOD:21,399-UNIMOD:21,155-UNIMOD:21,135-UNIMOD:21	0.19	49.0	16	7	5
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	202-UNIMOD:21,204-UNIMOD:21,17-UNIMOD:21,207-UNIMOD:21,310-UNIMOD:35,312-UNIMOD:21,198-UNIMOD:21,286-UNIMOD:21,368-UNIMOD:21,30-UNIMOD:35	0.18	48.0	27	6	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	241-UNIMOD:4,243-UNIMOD:21,295-UNIMOD:21	0.08	48.0	5	3	2
PRT	sp|Q86W56|PARG_HUMAN	Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	241-UNIMOD:4,247-UNIMOD:4,250-UNIMOD:4,261-UNIMOD:21,313-UNIMOD:4,323-UNIMOD:21,137-UNIMOD:21,302-UNIMOD:21	0.11	48.0	4	4	4
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	1183-UNIMOD:21	0.03	47.0	2	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	494-UNIMOD:21,498-UNIMOD:21,710-UNIMOD:21,716-UNIMOD:4,691-UNIMOD:21,695-UNIMOD:21,1711-UNIMOD:21,435-UNIMOD:21,1715-UNIMOD:21,714-UNIMOD:21,601-UNIMOD:21,1290-UNIMOD:35,1296-UNIMOD:4,1297-UNIMOD:21,1029-UNIMOD:21,1031-UNIMOD:21,1324-UNIMOD:4,1328-UNIMOD:21,669-UNIMOD:4,672-UNIMOD:21,1032-UNIMOD:21	0.11	47.0	26	12	5
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	47.0	null	1-UNIMOD:1,7-UNIMOD:21,1-UNIMOD:35,11-UNIMOD:21,450-UNIMOD:21,12-UNIMOD:21	0.04	47.0	36	2	0
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	2-UNIMOD:1,15-UNIMOD:21	0.15	47.0	5	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	34-UNIMOD:21,37-UNIMOD:21,41-UNIMOD:21	0.11	46.0	5	2	1
PRT	sp|Q13409-2|DC1I2_HUMAN	Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	73-UNIMOD:21,83-UNIMOD:21,81-UNIMOD:21,80-UNIMOD:35,67-UNIMOD:35	0.04	46.0	4	1	0
PRT	sp|P48960|CD97_HUMAN	CD97 antigen OS=Homo sapiens OX=9606 GN=CD97 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	44-UNIMOD:4,57-UNIMOD:21,62-UNIMOD:4,68-UNIMOD:4,70-UNIMOD:21	0.04	46.0	3	1	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	241-UNIMOD:4,243-UNIMOD:21,234-UNIMOD:21,242-UNIMOD:21,240-UNIMOD:21	0.06	45.0	7	2	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	175-UNIMOD:35,563-UNIMOD:21	0.15	45.0	7	5	3
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	28-UNIMOD:21	0.16	45.0	9	2	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	11-UNIMOD:4,25-UNIMOD:4,28-UNIMOD:21	0.03	44.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	104-UNIMOD:4,125-UNIMOD:21,104-UNIMOD:385,234-UNIMOD:21,237-UNIMOD:21	0.36	44.0	19	7	3
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	221-UNIMOD:21,242-UNIMOD:21,220-UNIMOD:21,236-UNIMOD:35	0.18	44.0	13	3	0
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	607-UNIMOD:21,401-UNIMOD:21,402-UNIMOD:21,296-UNIMOD:21,599-UNIMOD:21	0.09	44.0	9	3	0
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	227-UNIMOD:21,213-UNIMOD:35,219-UNIMOD:35,638-UNIMOD:21,680-UNIMOD:21,678-UNIMOD:21,394-UNIMOD:21,401-UNIMOD:21,752-UNIMOD:21,427-UNIMOD:21,436-UNIMOD:21	0.17	44.0	14	6	3
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	44.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35,300-UNIMOD:21,297-UNIMOD:21,305-UNIMOD:35,106-UNIMOD:21	0.16	44.0	12	3	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	373-UNIMOD:4,377-UNIMOD:21,386-UNIMOD:21,173-UNIMOD:21,179-UNIMOD:4,385-UNIMOD:21,171-UNIMOD:21,285-UNIMOD:21,289-UNIMOD:21,185-UNIMOD:21,381-UNIMOD:21,64-UNIMOD:21	0.15	43.0	23	5	1
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	718-UNIMOD:21,727-UNIMOD:21,721-UNIMOD:21,720-UNIMOD:21,729-UNIMOD:21,723-UNIMOD:21	0.04	43.0	6	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	472-UNIMOD:21,425-UNIMOD:35,428-UNIMOD:21	0.09	43.0	4	2	0
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	79-UNIMOD:4,83-UNIMOD:21,117-UNIMOD:21,113-UNIMOD:21,251-UNIMOD:21,255-UNIMOD:4,120-UNIMOD:35,254-UNIMOD:21,249-UNIMOD:21,58-UNIMOD:21	0.23	43.0	18	4	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	223-UNIMOD:21,102-UNIMOD:21,225-UNIMOD:21,218-UNIMOD:35	0.26	43.0	10	2	0
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	576-UNIMOD:4,584-UNIMOD:21,17-UNIMOD:21	0.04	42.0	2	2	2
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	158-UNIMOD:21	0.12	42.0	3	3	3
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	117-UNIMOD:21,134-UNIMOD:4,174-UNIMOD:21,178-UNIMOD:21,177-UNIMOD:21,184-UNIMOD:21	0.38	42.0	6	2	0
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	183-UNIMOD:21,197-UNIMOD:21,182-UNIMOD:35,156-UNIMOD:28,161-UNIMOD:35,165-UNIMOD:35	0.12	42.0	6	2	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	2022-UNIMOD:21,2029-UNIMOD:21,2020-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null	2-UNIMOD:1,11-UNIMOD:21,630-UNIMOD:21	0.09	42.0	4	2	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	792-UNIMOD:21,504-UNIMOD:21	0.09	41.0	2	2	2
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	861-UNIMOD:21	0.05	41.0	4	3	2
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	296-UNIMOD:4,308-UNIMOD:21	0.05	41.0	2	2	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	177-UNIMOD:21,44-UNIMOD:21,47-UNIMOD:4,221-UNIMOD:21	0.22	41.0	4	3	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	40-UNIMOD:21,41-UNIMOD:21,263-UNIMOD:21,26-UNIMOD:21,229-UNIMOD:21,272-UNIMOD:21,19-UNIMOD:21,14-UNIMOD:21,72-UNIMOD:21,79-UNIMOD:21,205-UNIMOD:21,419-UNIMOD:21,37-UNIMOD:21,337-UNIMOD:4,339-UNIMOD:4,336-UNIMOD:21	0.37	41.0	30	12	7
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	232-UNIMOD:21,241-UNIMOD:21,231-UNIMOD:21	0.04	41.0	4	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	287-UNIMOD:21,295-UNIMOD:21,444-UNIMOD:21,439-UNIMOD:21	0.06	41.0	7	2	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	270-UNIMOD:4,272-UNIMOD:21,274-UNIMOD:4,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4,275-UNIMOD:21,242-UNIMOD:4,243-UNIMOD:35,250-UNIMOD:21,254-UNIMOD:4,248-UNIMOD:21,245-UNIMOD:21,246-UNIMOD:21	0.22	41.0	16	3	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	145-UNIMOD:28,155-UNIMOD:21,160-UNIMOD:21,162-UNIMOD:21,159-UNIMOD:21,164-UNIMOD:21	0.07	41.0	24	3	1
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	1-UNIMOD:1,12-UNIMOD:21,1-UNIMOD:35,192-UNIMOD:21,104-UNIMOD:21,195-UNIMOD:21,191-UNIMOD:21,201-UNIMOD:21	0.29	41.0	13	4	2
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	370-UNIMOD:21	0.07	40.0	5	2	1
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	1391-UNIMOD:21,1399-UNIMOD:4,1407-UNIMOD:4,749-UNIMOD:21,286-UNIMOD:21,283-UNIMOD:21,642-UNIMOD:21,285-UNIMOD:21,470-UNIMOD:4,483-UNIMOD:21	0.08	40.0	23	9	6
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	308-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	36-UNIMOD:21,40-UNIMOD:21,195-UNIMOD:21,196-UNIMOD:21	0.29	39.0	5	4	3
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	139-UNIMOD:21,145-UNIMOD:21,136-UNIMOD:21	0.10	39.0	19	3	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	79-UNIMOD:21,64-UNIMOD:21,16-UNIMOD:21,74-UNIMOD:21,86-UNIMOD:21	0.57	39.0	5	3	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	237-UNIMOD:4	0.10	39.0	4	1	0
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1,8-UNIMOD:21,14-UNIMOD:4,18-UNIMOD:4	0.12	39.0	2	1	0
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	221-UNIMOD:21,315-UNIMOD:21,333-UNIMOD:4,267-UNIMOD:21,310-UNIMOD:21	0.14	38.0	6	3	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	515-UNIMOD:21,521-UNIMOD:21,774-UNIMOD:21,624-UNIMOD:21,517-UNIMOD:21,526-UNIMOD:21	0.06	38.0	5	3	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	15-UNIMOD:21,26-UNIMOD:21,11-UNIMOD:21,9-UNIMOD:21,20-UNIMOD:35	0.06	38.0	10	2	0
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	62-UNIMOD:21	0.05	38.0	2	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	641-UNIMOD:21,668-UNIMOD:21	0.04	38.0	3	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35	0.05	38.0	4	1	0
PRT	sp|Q9UBV2|SE1L1_HUMAN	Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	96-UNIMOD:21	0.03	38.0	3	1	0
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	2221-UNIMOD:4,2223-UNIMOD:21,2231-UNIMOD:21,1129-UNIMOD:4,1131-UNIMOD:21,1139-UNIMOD:21,1801-UNIMOD:21,1923-UNIMOD:21,2342-UNIMOD:4,2344-UNIMOD:21,2233-UNIMOD:21	0.03	37.0	9	5	3
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	214-UNIMOD:21,138-UNIMOD:35,202-UNIMOD:21	0.18	37.0	10	4	0
PRT	sp|P32004|L1CAM_HUMAN	Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1248-UNIMOD:21,1247-UNIMOD:21	0.02	37.0	4	1	0
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	280-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21,506-UNIMOD:35,507-UNIMOD:21,278-UNIMOD:35,521-UNIMOD:21,514-UNIMOD:35,330-UNIMOD:21,1098-UNIMOD:4,1123-UNIMOD:21,510-UNIMOD:21	0.11	37.0	15	6	4
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1114-UNIMOD:21,507-UNIMOD:21,513-UNIMOD:4,552-UNIMOD:21,265-UNIMOD:21	0.05	37.0	5	5	5
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1208-UNIMOD:21,1211-UNIMOD:21,1207-UNIMOD:21,1215-UNIMOD:21,1218-UNIMOD:21,1203-UNIMOD:21	0.02	37.0	6	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	629-UNIMOD:21,637-UNIMOD:21,404-UNIMOD:21	0.05	37.0	4	2	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	367-UNIMOD:21,370-UNIMOD:35,289-UNIMOD:21,141-UNIMOD:21,143-UNIMOD:21,154-UNIMOD:21,145-UNIMOD:21,149-UNIMOD:21,300-UNIMOD:21,119-UNIMOD:21,306-UNIMOD:35	0.22	37.0	9	4	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	64-UNIMOD:21,66-UNIMOD:21,90-UNIMOD:21	0.06	37.0	3	2	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	2410-UNIMOD:21,2412-UNIMOD:35	0.00	36.0	2	1	0
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	575-UNIMOD:21,574-UNIMOD:21,210-UNIMOD:21,216-UNIMOD:4	0.07	36.0	8	4	2
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	67-UNIMOD:21,60-UNIMOD:21,104-UNIMOD:21	0.10	36.0	7	3	2
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	830-UNIMOD:4,837-UNIMOD:4,838-UNIMOD:21,842-UNIMOD:4,848-UNIMOD:4	0.01	36.0	3	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	538-UNIMOD:21,824-UNIMOD:21,822-UNIMOD:21,778-UNIMOD:21,779-UNIMOD:4	0.12	36.0	7	4	3
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	144-UNIMOD:21,146-UNIMOD:21,355-UNIMOD:21,374-UNIMOD:21	0.10	36.0	3	2	1
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	272-UNIMOD:21,274-UNIMOD:4,277-UNIMOD:4,182-UNIMOD:21,249-UNIMOD:4,250-UNIMOD:21,251-UNIMOD:4	0.14	36.0	4	3	2
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	988-UNIMOD:21,991-UNIMOD:21,867-UNIMOD:21,873-UNIMOD:21	0.03	36.0	2	2	2
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	152-UNIMOD:21,165-UNIMOD:21,157-UNIMOD:21,393-UNIMOD:21,398-UNIMOD:21,222-UNIMOD:21	0.17	36.0	8	5	3
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	122-UNIMOD:21	0.04	36.0	6	2	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	235-UNIMOD:35	0.12	36.0	7	3	1
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	298-UNIMOD:21	0.05	36.0	2	1	0
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	617-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	128-UNIMOD:21,35-UNIMOD:21	0.09	36.0	2	2	2
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	244-UNIMOD:4,254-UNIMOD:21,213-UNIMOD:21,217-UNIMOD:21	0.06	36.0	3	2	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	722-UNIMOD:21,717-UNIMOD:35,725-UNIMOD:21,713-UNIMOD:21	0.04	36.0	12	2	0
PRT	sp|Q96QU8|XPO6_HUMAN	Exportin-6 OS=Homo sapiens OX=9606 GN=XPO6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	204-UNIMOD:21,208-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	2747-UNIMOD:21,2887-UNIMOD:21,3658-UNIMOD:4,3660-UNIMOD:21	0.02	36.0	4	3	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	643-UNIMOD:21,85-UNIMOD:21,86-UNIMOD:21,91-UNIMOD:21,460-UNIMOD:21,189-UNIMOD:21,534-UNIMOD:21	0.16	36.0	17	8	4
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,21-UNIMOD:21,43-UNIMOD:21	0.16	36.0	3	2	1
PRT	sp|P09496-2|CLCA_HUMAN	Isoform Non-brain of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	176-UNIMOD:21	0.10	36.0	2	1	0
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,24-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	16-UNIMOD:21	0.05	35.0	3	2	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	13-UNIMOD:21	0.05	35.0	2	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	98-UNIMOD:21,102-UNIMOD:21,777-UNIMOD:21,1012-UNIMOD:4,1014-UNIMOD:21,533-UNIMOD:21	0.08	35.0	13	6	3
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	69-UNIMOD:21	0.05	35.0	3	1	0
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	2054-UNIMOD:21,2058-UNIMOD:21,939-UNIMOD:21,946-UNIMOD:21,215-UNIMOD:21	0.03	35.0	5	3	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	275-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	79-UNIMOD:21,51-UNIMOD:21,64-UNIMOD:21,21-UNIMOD:21	0.60	35.0	11	6	4
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.09	35.0	13	1	0
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	142-UNIMOD:21,148-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	103-UNIMOD:21,106-UNIMOD:4,24-UNIMOD:21,37-UNIMOD:21,28-UNIMOD:21,98-UNIMOD:21	0.06	35.0	5	2	0
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	182-UNIMOD:21,173-UNIMOD:21	0.17	35.0	3	2	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	2-UNIMOD:1,9-UNIMOD:21,22-UNIMOD:4,73-UNIMOD:4,75-UNIMOD:21,76-UNIMOD:21	0.30	35.0	4	2	0
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	363-UNIMOD:21,367-UNIMOD:21,357-UNIMOD:21,368-UNIMOD:21,369-UNIMOD:21	0.04	34.0	6	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	3-UNIMOD:4,11-UNIMOD:21,7-UNIMOD:21	0.09	34.0	5	1	0
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	426-UNIMOD:21	0.04	34.0	4	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	74-UNIMOD:21,76-UNIMOD:21	0.08	34.0	10	4	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	39-UNIMOD:21,53-UNIMOD:21,36-UNIMOD:21,49-UNIMOD:21	0.43	34.0	10	3	2
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	313-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	496-UNIMOD:4,498-UNIMOD:4,504-UNIMOD:21,1342-UNIMOD:21,1348-UNIMOD:21,1445-UNIMOD:21,1448-UNIMOD:21	0.04	34.0	5	3	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	441-UNIMOD:21,426-UNIMOD:35	0.05	34.0	2	1	0
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	163-UNIMOD:21,158-UNIMOD:21,122-UNIMOD:21,120-UNIMOD:21,118-UNIMOD:21	0.14	34.0	6	2	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	18-UNIMOD:21,319-UNIMOD:21,322-UNIMOD:21,237-UNIMOD:21,309-UNIMOD:21	0.20	34.0	10	6	3
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	229-UNIMOD:4,237-UNIMOD:21,243-UNIMOD:21	0.16	34.0	7	2	1
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	10-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	483-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	48-UNIMOD:21,56-UNIMOD:21,94-UNIMOD:21,439-UNIMOD:21,361-UNIMOD:21,334-UNIMOD:21,80-UNIMOD:21	0.31	34.0	14	8	4
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	671-UNIMOD:21,670-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	67-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,115-UNIMOD:21,116-UNIMOD:4,74-UNIMOD:21,126-UNIMOD:21,78-UNIMOD:21,62-UNIMOD:21	0.14	34.0	7	3	2
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	9-UNIMOD:21,337-UNIMOD:4,50-UNIMOD:21	0.09	34.0	3	3	3
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,14-UNIMOD:21,1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35	0.09	34.0	7	2	0
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,12-UNIMOD:21	0.14	34.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	114-UNIMOD:21,123-UNIMOD:4,438-UNIMOD:21,177-UNIMOD:21	0.10	33.0	4	3	2
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	692-UNIMOD:21,100-UNIMOD:21	0.07	33.0	3	2	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	439-UNIMOD:21	0.08	33.0	3	2	0
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	41-UNIMOD:21,46-UNIMOD:21	0.19	33.0	4	1	0
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1125-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	210-UNIMOD:21,211-UNIMOD:21,246-UNIMOD:21,247-UNIMOD:4	0.10	33.0	9	2	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	14-UNIMOD:21,211-UNIMOD:21	0.10	33.0	5	2	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	445-UNIMOD:21,450-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	51-UNIMOD:21,54-UNIMOD:21,53-UNIMOD:21	0.05	33.0	5	1	0
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	335-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	341-UNIMOD:4,342-UNIMOD:4,352-UNIMOD:21,354-UNIMOD:4,1677-UNIMOD:4,1682-UNIMOD:21,2728-UNIMOD:21,1294-UNIMOD:21	0.03	33.0	5	4	3
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	22-UNIMOD:21,7-UNIMOD:28	0.02	33.0	5	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	8-UNIMOD:21,106-UNIMOD:21	0.27	33.0	3	3	3
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	47-UNIMOD:21	0.18	33.0	9	3	1
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	165-UNIMOD:21,164-UNIMOD:21	0.10	33.0	2	2	2
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	120-UNIMOD:21,135-UNIMOD:21,134-UNIMOD:21,122-UNIMOD:21	0.04	33.0	3	2	1
PRT	sp|Q9BVK6|TMED9_HUMAN	Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	80-UNIMOD:21,85-UNIMOD:35,72-UNIMOD:28	0.11	33.0	6	1	0
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	261-UNIMOD:21,341-UNIMOD:21,338-UNIMOD:21,368-UNIMOD:21,6-UNIMOD:21,337-UNIMOD:21	0.24	33.0	7	6	4
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	308-UNIMOD:4,343-UNIMOD:21,2-UNIMOD:1,8-UNIMOD:21	0.09	33.0	2	2	2
PRT	sp|O95197|RTN3_HUMAN	Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,30-UNIMOD:21,34-UNIMOD:4,246-UNIMOD:21,17-UNIMOD:21	0.05	33.0	6	2	0
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	60-UNIMOD:21,64-UNIMOD:21,63-UNIMOD:21	0.08	32.0	5	1	0
PRT	sp|Q92575|UBXN4_HUMAN	UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	120-UNIMOD:21,144-UNIMOD:4,133-UNIMOD:21,125-UNIMOD:21	0.07	32.0	3	1	0
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	358-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	88-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	473-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	108-UNIMOD:4,118-UNIMOD:21	0.04	32.0	5	2	0
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	85-UNIMOD:21,116-UNIMOD:21,87-UNIMOD:21	0.07	32.0	4	4	4
PRT	sp|Q9NRR5|UBQL4_HUMAN	Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	117-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	156-UNIMOD:21,160-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,8-UNIMOD:21	0.30	32.0	9	4	3
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	547-UNIMOD:21,519-UNIMOD:21,542-UNIMOD:21,532-UNIMOD:21	0.09	32.0	5	3	2
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	8-UNIMOD:4,12-UNIMOD:21,17-UNIMOD:4	0.03	32.0	2	1	0
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	33-UNIMOD:21,38-UNIMOD:21	0.05	32.0	2	1	0
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	534-UNIMOD:21,537-UNIMOD:21,494-UNIMOD:21,442-UNIMOD:4,444-UNIMOD:21	0.09	32.0	7	3	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	248-UNIMOD:21	0.10	32.0	7	1	0
PRT	sp|Q9NX14|NDUBB_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	53-UNIMOD:21,52-UNIMOD:21	0.16	32.0	3	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	193-UNIMOD:21,190-UNIMOD:21,186-UNIMOD:35	0.03	32.0	4	1	0
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,8-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4	0.15	32.0	8	1	0
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35	0.07	32.0	3	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	54-UNIMOD:21,251-UNIMOD:21,320-UNIMOD:21,325-UNIMOD:21,326-UNIMOD:21,327-UNIMOD:35,192-UNIMOD:35	0.19	31.0	13	5	2
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	344-UNIMOD:21,335-UNIMOD:21,370-UNIMOD:21,338-UNIMOD:21,395-UNIMOD:21,359-UNIMOD:21,382-UNIMOD:35,384-UNIMOD:21,394-UNIMOD:21	0.13	31.0	10	4	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	228-UNIMOD:21,117-UNIMOD:21	0.11	31.0	3	2	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	328-UNIMOD:21,334-UNIMOD:4,335-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	9-UNIMOD:21	0.17	31.0	5	2	0
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	430-UNIMOD:21,437-UNIMOD:21,433-UNIMOD:21,434-UNIMOD:21,436-UNIMOD:21	0.01	31.0	4	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	443-UNIMOD:21,434-UNIMOD:35,437-UNIMOD:21,456-UNIMOD:21	0.09	31.0	14	3	1
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	226-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.18	31.0	2	1	0
PRT	sp|Q8N7H5|PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	111-UNIMOD:21,594-UNIMOD:21	0.03	31.0	7	2	0
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	88-UNIMOD:21,93-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	511-UNIMOD:21,4564-UNIMOD:21,5762-UNIMOD:21,4100-UNIMOD:21,41-UNIMOD:21,3426-UNIMOD:21,5763-UNIMOD:21,177-UNIMOD:21,502-UNIMOD:35,3716-UNIMOD:21,93-UNIMOD:21,4430-UNIMOD:21,5099-UNIMOD:21	0.03	31.0	20	12	6
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	722-UNIMOD:21,228-UNIMOD:21,226-UNIMOD:21,81-UNIMOD:21	0.07	31.0	6	4	3
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	31-UNIMOD:21,96-UNIMOD:21,103-UNIMOD:21,152-UNIMOD:21,153-UNIMOD:4	0.21	31.0	4	3	2
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	309-UNIMOD:4,344-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	309-UNIMOD:4,320-UNIMOD:21,323-UNIMOD:21,232-UNIMOD:21,234-UNIMOD:4	0.03	31.0	4	2	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	680-UNIMOD:4,688-UNIMOD:21,692-UNIMOD:4,737-UNIMOD:21,744-UNIMOD:4,745-UNIMOD:21,891-UNIMOD:21,880-UNIMOD:21,898-UNIMOD:21,547-UNIMOD:21,885-UNIMOD:21	0.06	31.0	12	7	3
PRT	sp|P50542|PEX5_HUMAN	Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	317-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	359-UNIMOD:21,389-UNIMOD:21,65-UNIMOD:21	0.13	31.0	4	3	2
PRT	sp|Q9UHX3|AGRE2_HUMAN	Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	85-UNIMOD:4,94-UNIMOD:4,96-UNIMOD:4,97-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	504-UNIMOD:21,506-UNIMOD:21,503-UNIMOD:21	0.07	31.0	3	1	0
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	285-UNIMOD:21,286-UNIMOD:21	0.07	31.0	5	2	0
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,14-UNIMOD:21,133-UNIMOD:21	0.28	31.0	3	2	1
PRT	sp|Q96QD8|S38A2_HUMAN	Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	12-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,8-UNIMOD:21,15-UNIMOD:4	0.07	31.0	2	1	0
PRT	sp|O00418|EF2K_HUMAN	Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,18-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	37-UNIMOD:21,9-UNIMOD:21,124-UNIMOD:21,39-UNIMOD:21	0.15	30.0	6	3	0
PRT	sp|P55327|TPD52_HUMAN	Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	171-UNIMOD:21	0.06	30.0	2	1	0
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	157-UNIMOD:21	0.09	30.0	3	2	1
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	139-UNIMOD:21,142-UNIMOD:21	0.10	30.0	5	2	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	62-UNIMOD:21,88-UNIMOD:21	0.07	30.0	6	2	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	294-UNIMOD:21,304-UNIMOD:21,301-UNIMOD:21,296-UNIMOD:21,303-UNIMOD:21	0.06	30.0	7	2	1
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	462-UNIMOD:21,464-UNIMOD:21,473-UNIMOD:21,461-UNIMOD:21	0.05	30.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	412-UNIMOD:4,462-UNIMOD:21	0.07	30.0	5	3	1
PRT	sp|Q01201|RELB_HUMAN	Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	573-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	193-UNIMOD:21,190-UNIMOD:21	0.05	30.0	9	2	0
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	145-UNIMOD:21,190-UNIMOD:21	0.22	30.0	8	4	2
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	285-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	138-UNIMOD:21,149-UNIMOD:21,37-UNIMOD:21,32-UNIMOD:21,150-UNIMOD:21	0.09	30.0	6	2	0
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	426-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	608-UNIMOD:21,416-UNIMOD:21,338-UNIMOD:21,346-UNIMOD:4	0.06	30.0	3	3	3
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	270-UNIMOD:21,276-UNIMOD:21,143-UNIMOD:21,147-UNIMOD:21	0.15	30.0	3	2	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	205-UNIMOD:21,1231-UNIMOD:21,198-UNIMOD:21,211-UNIMOD:21	0.04	30.0	10	4	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	2-UNIMOD:1,10-UNIMOD:35,13-UNIMOD:21,26-UNIMOD:21,27-UNIMOD:21	0.03	30.0	10	4	2
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35,34-UNIMOD:21,551-UNIMOD:21	0.07	30.0	13	3	2
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,15-UNIMOD:21	0.07	30.0	4	1	0
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	504-UNIMOD:4,509-UNIMOD:21,157-UNIMOD:21,170-UNIMOD:21,163-UNIMOD:21	0.08	29.0	5	2	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	65-UNIMOD:21,89-UNIMOD:21	0.17	29.0	5	4	3
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	776-UNIMOD:35,779-UNIMOD:21,191-UNIMOD:21,2105-UNIMOD:21,1974-UNIMOD:21,1983-UNIMOD:21,2196-UNIMOD:21,792-UNIMOD:21,1980-UNIMOD:21,1986-UNIMOD:21	0.05	29.0	9	8	7
PRT	sp|P18827|SDC1_HUMAN	Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	233-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	142-UNIMOD:21	0.10	29.0	2	1	0
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	346-UNIMOD:21,338-UNIMOD:21	0.03	29.0	6	2	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	56-UNIMOD:21	0.06	29.0	3	1	0
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	31-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:21	0.18	29.0	3	2	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	623-UNIMOD:21,612-UNIMOD:21,618-UNIMOD:21,608-UNIMOD:21,1027-UNIMOD:4,1028-UNIMOD:21,1034-UNIMOD:21	0.03	29.0	14	4	1
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	46-UNIMOD:21,50-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1267-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	270-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	57-UNIMOD:21	0.12	29.0	2	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	819-UNIMOD:21,822-UNIMOD:21,823-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	27-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.06	29.0	6	3	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	791-UNIMOD:21,541-UNIMOD:21	0.04	29.0	4	2	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	210-UNIMOD:21,215-UNIMOD:4,202-UNIMOD:21	0.02	29.0	4	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	37-UNIMOD:21,41-UNIMOD:21,202-UNIMOD:21,152-UNIMOD:4,49-UNIMOD:4,55-UNIMOD:21	0.13	29.0	12	5	3
PRT	sp|Q15155|NOMO1_HUMAN	Nodal modulator 1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	825-UNIMOD:21,824-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	145-UNIMOD:21,146-UNIMOD:21	0.17	29.0	3	2	1
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	259-UNIMOD:21,286-UNIMOD:21,334-UNIMOD:21	0.09	29.0	7	4	1
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	49-UNIMOD:21,45-UNIMOD:21,42-UNIMOD:21,242-UNIMOD:21,256-UNIMOD:21,247-UNIMOD:21,238-UNIMOD:35,252-UNIMOD:21,44-UNIMOD:21	0.17	29.0	11	2	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	117-UNIMOD:21,131-UNIMOD:4,115-UNIMOD:21,99-UNIMOD:4,104-UNIMOD:4	0.09	29.0	4	2	0
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	246-UNIMOD:21,251-UNIMOD:21,237-UNIMOD:21,242-UNIMOD:4,278-UNIMOD:21	0.11	29.0	5	3	2
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	291-UNIMOD:21,297-UNIMOD:4,110-UNIMOD:21,350-UNIMOD:21,293-UNIMOD:21,303-UNIMOD:21,221-UNIMOD:21,290-UNIMOD:21,204-UNIMOD:21,207-UNIMOD:4	0.15	29.0	8	5	3
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	113-UNIMOD:4,115-UNIMOD:21	0.13	29.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	90-UNIMOD:21,206-UNIMOD:4,207-UNIMOD:21,73-UNIMOD:21	0.17	29.0	6	4	2
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	267-UNIMOD:21,276-UNIMOD:21,257-UNIMOD:21,361-UNIMOD:21	0.07	29.0	4	3	2
PRT	sp|Q7Z434-4|MAVS_HUMAN	Isoform 4 of Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	11-UNIMOD:21,24-UNIMOD:21	0.07	29.0	3	1	0
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.19	29.0	1	1	1
PRT	sp|O95359|TACC2_HUMAN	Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	2359-UNIMOD:21,2374-UNIMOD:4,2317-UNIMOD:21,2321-UNIMOD:21,2238-UNIMOD:21,2256-UNIMOD:21,2314-UNIMOD:21,2203-UNIMOD:4,2218-UNIMOD:21,2511-UNIMOD:21	0.04	29.0	8	6	4
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	268-UNIMOD:35,275-UNIMOD:21	0.04	29.0	4	2	0
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21	0.04	29.0	3	1	0
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1414-UNIMOD:21,395-UNIMOD:4,398-UNIMOD:4,400-UNIMOD:4,401-UNIMOD:21,410-UNIMOD:4	0.03	28.0	2	2	2
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	160-UNIMOD:21	0.07	28.0	4	2	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	330-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	104-UNIMOD:21,232-UNIMOD:4,234-UNIMOD:21,101-UNIMOD:21,107-UNIMOD:21	0.10	28.0	5	3	1
PRT	sp|Q15311|RBP1_HUMAN	RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	101-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	133-UNIMOD:21,137-UNIMOD:21	0.11	28.0	2	1	0
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	226-UNIMOD:21,229-UNIMOD:21,225-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	2083-UNIMOD:21,122-UNIMOD:21,129-UNIMOD:21,569-UNIMOD:21,107-UNIMOD:4,115-UNIMOD:21,2054-UNIMOD:21	0.04	28.0	7	5	3
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	273-UNIMOD:21,830-UNIMOD:21,834-UNIMOD:21	0.04	28.0	3	2	1
PRT	sp|Q9Y6I3|EPN1_HUMAN	Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	454-UNIMOD:21,460-UNIMOD:21	0.04	28.0	3	2	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	359-UNIMOD:4,361-UNIMOD:21,358-UNIMOD:21,375-UNIMOD:4	0.08	28.0	2	2	2
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	985-UNIMOD:4,989-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P52701|MSH6_HUMAN	DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	292-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	500-UNIMOD:21,495-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q9UNF1|MAGD2_HUMAN	Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	157-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	169-UNIMOD:21	0.11	28.0	2	1	0
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	303-UNIMOD:21,306-UNIMOD:21,270-UNIMOD:21,274-UNIMOD:21,259-UNIMOD:21,267-UNIMOD:21,179-UNIMOD:21,182-UNIMOD:21,344-UNIMOD:21	0.15	28.0	14	6	3
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	112-UNIMOD:21	0.02	28.0	2	2	2
PRT	sp|P54750|PDE1A_HUMAN	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	485-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	55-UNIMOD:21,60-UNIMOD:4,67-UNIMOD:4,438-UNIMOD:21	0.06	28.0	2	2	2
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	188-UNIMOD:21,194-UNIMOD:21,268-UNIMOD:21,270-UNIMOD:21	0.07	28.0	6	3	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	641-UNIMOD:21,645-UNIMOD:4,552-UNIMOD:21,169-UNIMOD:21	0.07	28.0	4	4	4
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	25-UNIMOD:21,16-UNIMOD:21,38-UNIMOD:21	0.26	28.0	21	6	3
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	612-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	38-UNIMOD:21,633-UNIMOD:21,66-UNIMOD:21,41-UNIMOD:21,45-UNIMOD:21,631-UNIMOD:21,551-UNIMOD:21	0.15	28.0	12	6	3
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	66-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P84095|RHOG_HUMAN	Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	44-UNIMOD:21,138-UNIMOD:21	0.20	28.0	2	2	2
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	352-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	223-UNIMOD:21,235-UNIMOD:4,552-UNIMOD:21,871-UNIMOD:21	0.03	28.0	3	3	3
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	127-UNIMOD:21	0.15	28.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	2626-UNIMOD:21,2501-UNIMOD:21,1894-UNIMOD:21,2639-UNIMOD:21,2810-UNIMOD:21,2804-UNIMOD:21,1890-UNIMOD:21,2807-UNIMOD:21,2813-UNIMOD:35	0.03	28.0	10	5	2
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	621-UNIMOD:21,626-UNIMOD:21,620-UNIMOD:21	0.03	28.0	5	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	28.0	2	1	0
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	28.0	3	1	0
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	65-UNIMOD:21,68-UNIMOD:21	0.02	27.0	4	1	0
PRT	sp|Q86TS9|RM52_HUMAN	39S ribosomal protein L52, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	118-UNIMOD:21	0.10	27.0	3	1	0
PRT	sp|Q8N8S7|ENAH_HUMAN	Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	481-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	173-UNIMOD:4,181-UNIMOD:21,152-UNIMOD:21	0.26	27.0	3	3	3
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2272-UNIMOD:21,424-UNIMOD:21,1320-UNIMOD:21,1329-UNIMOD:21,2343-UNIMOD:21,440-UNIMOD:21,1043-UNIMOD:21,2388-UNIMOD:21,2335-UNIMOD:21,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,872-UNIMOD:4,876-UNIMOD:21,2100-UNIMOD:21,1124-UNIMOD:21	0.07	27.0	17	13	9
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1505-UNIMOD:21,2501-UNIMOD:4,2503-UNIMOD:21	0.01	27.0	2	2	2
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	302-UNIMOD:21,2-UNIMOD:1,8-UNIMOD:21,80-UNIMOD:21,82-UNIMOD:21	0.09	27.0	8	4	2
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	456-UNIMOD:4,460-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|A0FGR8|ESYT2_HUMAN	Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	691-UNIMOD:21,705-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	257-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null	51-UNIMOD:21,53-UNIMOD:21,135-UNIMOD:21,138-UNIMOD:4,139-UNIMOD:21,132-UNIMOD:21,127-UNIMOD:21,136-UNIMOD:21,44-UNIMOD:21,199-UNIMOD:21	0.12	27.0	10	3	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	56-UNIMOD:21	0.07	27.0	3	2	1
PRT	sp|Q9NZT2|OGFR_HUMAN	Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	403-UNIMOD:21,378-UNIMOD:21,484-UNIMOD:21,315-UNIMOD:21,670-UNIMOD:21	0.17	27.0	6	5	4
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	513-UNIMOD:21,516-UNIMOD:21,421-UNIMOD:21,515-UNIMOD:21,512-UNIMOD:21	0.08	27.0	7	3	1
PRT	sp|Q9NVA1|UQCC1_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens OX=9606 GN=UQCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	293-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1033-UNIMOD:21,1055-UNIMOD:4,526-UNIMOD:4,528-UNIMOD:21,533-UNIMOD:21	0.05	27.0	2	2	2
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2044-UNIMOD:21,2045-UNIMOD:21,2042-UNIMOD:21	0.01	27.0	3	1	0
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	184-UNIMOD:21,189-UNIMOD:21	0.06	27.0	2	1	0
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	235-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	89-UNIMOD:21,99-UNIMOD:21,101-UNIMOD:4,492-UNIMOD:21,828-UNIMOD:21	0.08	27.0	3	3	3
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	320-UNIMOD:21,164-UNIMOD:4,168-UNIMOD:21,162-UNIMOD:21,303-UNIMOD:21,302-UNIMOD:21	0.16	27.0	9	5	3
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	33-UNIMOD:21,36-UNIMOD:35	0.05	27.0	5	1	0
PRT	sp|P51148|RAB5C_HUMAN	Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	124-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2161-UNIMOD:21,2169-UNIMOD:4,2172-UNIMOD:21,2176-UNIMOD:21,1616-UNIMOD:21,1619-UNIMOD:4	0.02	27.0	3	3	3
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q6L8Q7|PDE12_HUMAN	2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	215-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	393-UNIMOD:21,415-UNIMOD:21,367-UNIMOD:4,376-UNIMOD:21,379-UNIMOD:4,380-UNIMOD:4	0.12	27.0	4	3	2
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	385-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	44-UNIMOD:21,51-UNIMOD:21	0.08	27.0	4	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	575-UNIMOD:21,400-UNIMOD:21	0.06	27.0	3	2	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	87-UNIMOD:21,94-UNIMOD:21,212-UNIMOD:21,86-UNIMOD:21,192-UNIMOD:21	0.08	27.0	8	4	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	2319-UNIMOD:21,2327-UNIMOD:21,1533-UNIMOD:21,1084-UNIMOD:21,2372-UNIMOD:21,2378-UNIMOD:4,1453-UNIMOD:4,1459-UNIMOD:21,1946-UNIMOD:21,1453-UNIMOD:385	0.04	27.0	12	6	2
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1500-UNIMOD:4,1519-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	454-UNIMOD:21,859-UNIMOD:21,462-UNIMOD:21,453-UNIMOD:21,609-UNIMOD:21	0.07	27.0	9	4	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,3-UNIMOD:21,14-UNIMOD:21,761-UNIMOD:21,765-UNIMOD:21,757-UNIMOD:35,13-UNIMOD:21	0.04	27.0	5	2	0
PRT	sp|A1KXE4|F168B_HUMAN	Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35,9-UNIMOD:21	0.10	27.0	3	1	0
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	643-UNIMOD:4,658-UNIMOD:21,1237-UNIMOD:21,1141-UNIMOD:21,1144-UNIMOD:4,1151-UNIMOD:4,1153-UNIMOD:4,1162-UNIMOD:4,1147-UNIMOD:21	0.04	26.0	5	4	3
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	160-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	19-UNIMOD:21,23-UNIMOD:21	0.06	26.0	3	1	0
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	101-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	118-UNIMOD:4,124-UNIMOD:21,251-UNIMOD:21,644-UNIMOD:21,928-UNIMOD:21,639-UNIMOD:21	0.08	26.0	7	6	5
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	199-UNIMOD:21,200-UNIMOD:21	0.11	26.0	8	2	0
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	972-UNIMOD:4,974-UNIMOD:21	0.01	26.0	3	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	104-UNIMOD:21,107-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	212-UNIMOD:21,211-UNIMOD:21	0.09	26.0	4	2	1
PRT	sp|Q92879|CELF1_HUMAN	CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	177-UNIMOD:4,178-UNIMOD:21,168-UNIMOD:35,179-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	149-UNIMOD:21,153-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	227-UNIMOD:21,226-UNIMOD:21	0.05	26.0	4	1	0
PRT	sp|P37275|ZEB1_HUMAN	Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	679-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	31-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	85-UNIMOD:21	0.05	26.0	4	2	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	561-UNIMOD:21,565-UNIMOD:21,539-UNIMOD:21,540-UNIMOD:4,551-UNIMOD:21,556-UNIMOD:21,541-UNIMOD:21,458-UNIMOD:21,546-UNIMOD:21	0.07	26.0	6	3	2
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	47-UNIMOD:21	0.10	26.0	2	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	160-UNIMOD:21	0.08	26.0	3	1	0
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	779-UNIMOD:21,1253-UNIMOD:21,778-UNIMOD:21	0.02	26.0	3	2	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	926-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9BUW7|CI016_HUMAN	UPF0184 protein C9orf16 OS=Homo sapiens OX=9606 GN=C9orf16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	82-UNIMOD:21	0.24	26.0	2	2	2
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	85-UNIMOD:21	0.11	26.0	2	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	482-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1253-UNIMOD:21,1236-UNIMOD:21,1252-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|A6NKF1|SAC31_HUMAN	SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	402-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,10-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	49-UNIMOD:4,64-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	224-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	199-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	505-UNIMOD:21,317-UNIMOD:21,545-UNIMOD:21,442-UNIMOD:21,391-UNIMOD:21	0.12	25.0	10	6	3
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	460-UNIMOD:21,463-UNIMOD:21	0.03	25.0	6	1	0
PRT	sp|Q15599|NHRF2_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	43-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	181-UNIMOD:21,218-UNIMOD:21,171-UNIMOD:4	0.08	25.0	4	3	2
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	137-UNIMOD:21,141-UNIMOD:21	0.06	25.0	3	3	3
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	107-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P04920|B3A2_HUMAN	Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	113-UNIMOD:21,115-UNIMOD:21,173-UNIMOD:21,120-UNIMOD:21,144-UNIMOD:21,147-UNIMOD:21,141-UNIMOD:21,150-UNIMOD:21,148-UNIMOD:21,169-UNIMOD:21,183-UNIMOD:21	0.06	25.0	8	4	1
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	721-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	78-UNIMOD:21	0.17	25.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	85-UNIMOD:21,106-UNIMOD:21,108-UNIMOD:4,303-UNIMOD:21,84-UNIMOD:21	0.10	25.0	7	3	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	143-UNIMOD:21,146-UNIMOD:21,311-UNIMOD:21,308-UNIMOD:21	0.07	25.0	9	3	1
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	583-UNIMOD:21,597-UNIMOD:21,599-UNIMOD:4	0.06	25.0	2	2	2
PRT	sp|Q9Y6Q9|NCOA3_HUMAN	Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	716-UNIMOD:4,728-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q9Y320|TMX2_HUMAN	Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	282-UNIMOD:21,283-UNIMOD:21	0.09	25.0	3	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	181-UNIMOD:21,185-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	468-UNIMOD:21,479-UNIMOD:21	0.05	25.0	3	2	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	53-UNIMOD:21,74-UNIMOD:4,76-UNIMOD:4,86-UNIMOD:4	0.11	25.0	1	1	1
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	115-UNIMOD:21,119-UNIMOD:21	0.08	25.0	2	2	2
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	508-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	866-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	90-UNIMOD:21,130-UNIMOD:21,128-UNIMOD:21,133-UNIMOD:21,187-UNIMOD:21	0.17	25.0	5	3	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	9-UNIMOD:21	0.18	25.0	2	2	2
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	172-UNIMOD:21,164-UNIMOD:35,166-UNIMOD:21	0.03	25.0	10	1	0
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	135-UNIMOD:21	0.10	25.0	2	1	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	399-UNIMOD:21,1255-UNIMOD:21,1268-UNIMOD:21,1264-UNIMOD:21,1240-UNIMOD:4,1247-UNIMOD:21,1248-UNIMOD:21	0.05	25.0	6	4	3
PRT	sp|Q6VY07|PACS1_HUMAN	Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens OX=9606 GN=PACS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	430-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q03164|KMT2A_HUMAN	Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	3036-UNIMOD:21,3640-UNIMOD:21,3643-UNIMOD:21	0.01	25.0	2	2	2
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	130-UNIMOD:21,158-UNIMOD:21	0.15	25.0	2	2	2
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	716-UNIMOD:21,416-UNIMOD:21,428-UNIMOD:21,420-UNIMOD:21,422-UNIMOD:21,427-UNIMOD:35,436-UNIMOD:21,439-UNIMOD:4,243-UNIMOD:21,254-UNIMOD:4,257-UNIMOD:21	0.11	25.0	7	4	3
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	49-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	9-UNIMOD:21	0.15	25.0	1	1	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	999-UNIMOD:21,579-UNIMOD:21	0.03	25.0	3	2	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	152-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	231-UNIMOD:21,277-UNIMOD:21,276-UNIMOD:21	0.19	25.0	10	3	2
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1029-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	301-UNIMOD:21	0.10	25.0	1	1	1
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	229-UNIMOD:21	0.02	25.0	4	2	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,8-UNIMOD:21,13-UNIMOD:21	0.14	25.0	3	1	0
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	147-UNIMOD:21	0.13	24.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	61-UNIMOD:35,66-UNIMOD:21,633-UNIMOD:21,638-UNIMOD:21,637-UNIMOD:21,64-UNIMOD:21,163-UNIMOD:21,617-UNIMOD:35,641-UNIMOD:21	0.15	24.0	13	5	2
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	248-UNIMOD:21	0.07	24.0	2	2	2
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	69-UNIMOD:21,71-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P40763|STAT3_HUMAN	Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	687-UNIMOD:4,701-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q66K74|MAP1S_HUMAN	Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	759-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	989-UNIMOD:21,1000-UNIMOD:21,1011-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q9HB09|B2L12_HUMAN	Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	242-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	238-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	82-UNIMOD:21,94-UNIMOD:21,93-UNIMOD:21,87-UNIMOD:21	0.06	24.0	6	2	0
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	384-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	490-UNIMOD:4,493-UNIMOD:21,715-UNIMOD:4,718-UNIMOD:21	0.03	24.0	3	2	1
PRT	sp|Q6UW78|UQCC3_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	81-UNIMOD:35,92-UNIMOD:21	0.17	24.0	3	1	0
PRT	sp|P07711|CATL1_HUMAN	Cathepsin L1 OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	322-UNIMOD:4,326-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	327-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	341-UNIMOD:21,344-UNIMOD:21	0.07	24.0	4	1	0
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	475-UNIMOD:21,480-UNIMOD:35,144-UNIMOD:21	0.06	24.0	4	2	1
PRT	sp|Q13443|ADAM9_HUMAN	Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	428-UNIMOD:4,430-UNIMOD:4,432-UNIMOD:21,436-UNIMOD:4,441-UNIMOD:4,442-UNIMOD:4,447-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	174-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	675-UNIMOD:21,686-UNIMOD:4,689-UNIMOD:21	0.03	24.0	3	2	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	211-UNIMOD:4,216-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	121-UNIMOD:4,128-UNIMOD:4,129-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q16666|IF16_HUMAN	Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	153-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	50-UNIMOD:21,57-UNIMOD:21	0.13	24.0	2	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	180-UNIMOD:21,194-UNIMOD:4,186-UNIMOD:35,179-UNIMOD:35,189-UNIMOD:21,190-UNIMOD:21	0.07	24.0	4	1	0
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	155-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	65-UNIMOD:21,71-UNIMOD:4	0.04	24.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	34-UNIMOD:21,105-UNIMOD:4,53-UNIMOD:21	0.11	24.0	7	4	3
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	910-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q6NXT4|ZNT6_HUMAN	Zinc transporter 6 OS=Homo sapiens OX=9606 GN=SLC30A6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	375-UNIMOD:21,381-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	1112-UNIMOD:21,1107-UNIMOD:28,678-UNIMOD:4,681-UNIMOD:4,687-UNIMOD:21,1057-UNIMOD:21,1065-UNIMOD:4,1460-UNIMOD:21,614-UNIMOD:21,619-UNIMOD:21,1064-UNIMOD:21,1059-UNIMOD:21	0.05	24.0	8	5	3
PRT	sp|O15027-5|SC16A_HUMAN	Isoform 5 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	2253-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	330-UNIMOD:21,328-UNIMOD:35	0.05	24.0	3	1	0
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	60-UNIMOD:21	0.23	24.0	3	2	1
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	52-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	112-UNIMOD:4	0.13	24.0	5	2	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	745-UNIMOD:21,747-UNIMOD:4,756-UNIMOD:21,395-UNIMOD:21	0.04	24.0	4	3	2
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	425-UNIMOD:21,430-UNIMOD:21,440-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	164-UNIMOD:21,52-UNIMOD:21	0.10	24.0	2	2	2
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	90-UNIMOD:21,308-UNIMOD:21,311-UNIMOD:21,326-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,16-UNIMOD:21,255-UNIMOD:35	0.14	24.0	3	2	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21,9-UNIMOD:21,1-UNIMOD:35	0.26	24.0	3	1	0
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,26-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,11-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P78344|IF4G2_HUMAN	Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,3-UNIMOD:21,32-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	106-UNIMOD:21	0.02	23.0	4	2	0
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	223-UNIMOD:21,230-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:21,65-UNIMOD:4,159-UNIMOD:21,161-UNIMOD:4	0.09	23.0	3	2	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	88-UNIMOD:21,99-UNIMOD:21,164-UNIMOD:21,166-UNIMOD:4	0.13	23.0	2	2	2
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	22-UNIMOD:21,19-UNIMOD:21,335-UNIMOD:4	0.09	23.0	5	2	1
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	201-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1094-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	173-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	263-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	738-UNIMOD:21,734-UNIMOD:21	0.02	23.0	6	1	0
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	856-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	261-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	40-UNIMOD:21,33-UNIMOD:35,41-UNIMOD:21,165-UNIMOD:21,94-UNIMOD:21	0.20	23.0	9	4	2
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	163-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	719-UNIMOD:21,635-UNIMOD:21,641-UNIMOD:21	0.02	23.0	3	2	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	249-UNIMOD:21,612-UNIMOD:21,615-UNIMOD:21,903-UNIMOD:21	0.05	23.0	4	3	2
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	97-UNIMOD:21,160-UNIMOD:21,94-UNIMOD:21	0.09	23.0	3	2	1
PRT	sp|P16383|GCFC2_HUMAN	GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	25-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	223-UNIMOD:21,227-UNIMOD:21,207-UNIMOD:21,211-UNIMOD:21,328-UNIMOD:21,229-UNIMOD:21,129-UNIMOD:21,142-UNIMOD:21	0.06	23.0	10	7	5
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	453-UNIMOD:4,466-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	567-UNIMOD:21,183-UNIMOD:21,187-UNIMOD:21,109-UNIMOD:21,113-UNIMOD:21,306-UNIMOD:21,119-UNIMOD:21,123-UNIMOD:21,120-UNIMOD:21	0.11	23.0	10	5	2
PRT	sp|O95361|TRI16_HUMAN	Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	36-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	73-UNIMOD:21,36-UNIMOD:21,45-UNIMOD:21	0.13	23.0	2	2	2
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	827-UNIMOD:21,831-UNIMOD:21,2198-UNIMOD:21,2202-UNIMOD:4,1118-UNIMOD:4,1120-UNIMOD:21,1127-UNIMOD:4,207-UNIMOD:21,212-UNIMOD:4	0.03	23.0	7	4	2
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:21,58-UNIMOD:21,65-UNIMOD:21,93-UNIMOD:21,28-UNIMOD:21	0.32	23.0	5	3	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	244-UNIMOD:21,249-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	237-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P84074|HPCA_HUMAN	Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens OX=9606 GN=HPCA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	185-UNIMOD:4,189-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	835-UNIMOD:21,234-UNIMOD:4,233-UNIMOD:21	0.03	23.0	5	2	0
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	2150-UNIMOD:4,2154-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	97-UNIMOD:21,100-UNIMOD:21	0.08	23.0	3	1	0
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	114-UNIMOD:21,271-UNIMOD:21,144-UNIMOD:21	0.15	23.0	3	3	3
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	219-UNIMOD:21	0.05	23.0	8	4	2
PRT	sp|P41236|IPP2_HUMAN	Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	77-UNIMOD:21,86-UNIMOD:4,75-UNIMOD:21	0.18	23.0	2	1	0
PRT	sp|Q4V326|GAG2E_HUMAN	G antigen 2E OS=Homo sapiens OX=9606 GN=GAGE2E PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	40-UNIMOD:21,33-UNIMOD:21	0.33	23.0	3	1	0
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	355-UNIMOD:4,361-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	363-UNIMOD:21	0.04	23.0	3	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	413-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	149-UNIMOD:21	0.08	23.0	3	1	0
PRT	sp|Q9ULH7|MRTFB_HUMAN	Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	546-UNIMOD:21,921-UNIMOD:21	0.04	23.0	3	2	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1117-UNIMOD:21,964-UNIMOD:21,1081-UNIMOD:21,973-UNIMOD:21	0.05	23.0	5	3	1
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	47-UNIMOD:21,221-UNIMOD:21,222-UNIMOD:21	0.15	23.0	5	2	0
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,12-UNIMOD:21	0.01	23.0	3	2	1
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	272-UNIMOD:4,273-UNIMOD:21,275-UNIMOD:21,407-UNIMOD:21,378-UNIMOD:21	0.04	22.0	4	3	2
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	172-UNIMOD:21,176-UNIMOD:21,232-UNIMOD:21,224-UNIMOD:21,222-UNIMOD:28	0.12	22.0	6	3	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	441-UNIMOD:4,445-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	97-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O75449|KTNA1_HUMAN	Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	170-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O00115|DNS2A_HUMAN	Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	70-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	863-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	174-UNIMOD:21,179-UNIMOD:21,55-UNIMOD:21	0.15	22.0	3	2	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	203-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	87-UNIMOD:4,96-UNIMOD:21,87-UNIMOD:385	0.06	22.0	3	1	0
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	308-UNIMOD:21,310-UNIMOD:21,427-UNIMOD:4,431-UNIMOD:21	0.07	22.0	6	3	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	363-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	163-UNIMOD:4,167-UNIMOD:21	0.05	22.0	4	3	2
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	455-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	71-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	203-UNIMOD:4,210-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	298-UNIMOD:21,296-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	586-UNIMOD:21,616-UNIMOD:21,613-UNIMOD:35,595-UNIMOD:21	0.07	22.0	5	3	2
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	317-UNIMOD:4,316-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	465-UNIMOD:21,12-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	82-UNIMOD:21,174-UNIMOD:21,80-UNIMOD:28,176-UNIMOD:21,184-UNIMOD:21,83-UNIMOD:21	0.25	22.0	8	3	1
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	333-UNIMOD:21,332-UNIMOD:21	0.03	22.0	3	1	0
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	341-UNIMOD:21,344-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	128-UNIMOD:21,127-UNIMOD:21	0.09	22.0	2	1	0
PRT	sp|O14773|TPP1_HUMAN	Tripeptidyl-peptidase 1 OS=Homo sapiens OX=9606 GN=TPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	73-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	237-UNIMOD:4,238-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	647-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	129-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	86-UNIMOD:21,62-UNIMOD:4,65-UNIMOD:21,83-UNIMOD:21,60-UNIMOD:35	0.34	22.0	5	2	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	183-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	315-UNIMOD:21,322-UNIMOD:21,629-UNIMOD:21,96-UNIMOD:21,321-UNIMOD:21	0.06	22.0	8	3	2
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	353-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	296-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	840-UNIMOD:21,841-UNIMOD:35,842-UNIMOD:4,853-UNIMOD:21,660-UNIMOD:21,843-UNIMOD:21,844-UNIMOD:21,1149-UNIMOD:21	0.04	22.0	7	3	2
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	115-UNIMOD:21,245-UNIMOD:21	0.10	22.0	3	3	3
PRT	sp|P57076|CF298_HUMAN	Cilia- and flagella-associated protein 298 OS=Homo sapiens OX=9606 GN=CFAP298 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	267-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	222-UNIMOD:21,225-UNIMOD:21,451-UNIMOD:21,433-UNIMOD:21	0.11	22.0	7	4	2
PRT	sp|Q00587|BORG5_HUMAN	Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	106-UNIMOD:21,113-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	39-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O75794|CD123_HUMAN	Cell division cycle protein 123 homolog OS=Homo sapiens OX=9606 GN=CDC123 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	289-UNIMOD:4,299-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	456-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	462-UNIMOD:21,469-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	412-UNIMOD:21,413-UNIMOD:21,394-UNIMOD:21,396-UNIMOD:21,410-UNIMOD:21	0.07	22.0	3	2	1
PRT	sp|Q9C0E8|LNP_HUMAN	Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	182-UNIMOD:21,194-UNIMOD:21,179-UNIMOD:21	0.06	22.0	4	1	0
PRT	sp|Q93015-2|NAA80_HUMAN	Isoform 2 of N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1,7-UNIMOD:21,1-UNIMOD:35	0.04	22.0	2	1	0
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,21-UNIMOD:21	0.18	22.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	862-UNIMOD:21,865-UNIMOD:21,673-UNIMOD:21,675-UNIMOD:4,1319-UNIMOD:21,864-UNIMOD:21	0.03	21.0	4	3	2
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	119-UNIMOD:21	0.09	21.0	2	1	0
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	21.0	null	30-UNIMOD:21,28-UNIMOD:21,166-UNIMOD:21,168-UNIMOD:21	0.14	21.0	4	2	1
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	93-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1314-UNIMOD:21,1316-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.18	21.0	2	2	2
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	218-UNIMOD:21,227-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	20-UNIMOD:21,23-UNIMOD:21,19-UNIMOD:21	0.03	21.0	3	2	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	110-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	55-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q9UM00|TMCO1_HUMAN	Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	235-UNIMOD:21	0.07	21.0	3	2	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	71-UNIMOD:35,77-UNIMOD:21,81-UNIMOD:21	0.08	21.0	4	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	370-UNIMOD:21,408-UNIMOD:21,410-UNIMOD:21	0.09	21.0	8	5	2
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	29-UNIMOD:21,32-UNIMOD:21,46-UNIMOD:21,76-UNIMOD:21,80-UNIMOD:4,71-UNIMOD:21	0.23	21.0	4	3	2
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	82-UNIMOD:21	0.16	21.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	346-UNIMOD:21,349-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	583-UNIMOD:21,360-UNIMOD:4,362-UNIMOD:21,366-UNIMOD:4,360-UNIMOD:385	0.12	21.0	6	4	2
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	176-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|O95299|NDUAA_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	340-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9BVG9|PTSS2_HUMAN	Phosphatidylserine synthase 2 OS=Homo sapiens OX=9606 GN=PTDSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	16-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q5PRF9|SMAG2_HUMAN	Protein Smaug homolog 2 OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	271-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	444-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	76-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	21.0	6	2	0
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1757-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P15923|TFE2_HUMAN	Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	379-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P18850|ATF6A_HUMAN	Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	94-UNIMOD:21,104-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P08651|NFIC_HUMAN	Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	305-UNIMOD:21,287-UNIMOD:35,304-UNIMOD:21,323-UNIMOD:21	0.09	21.0	3	2	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	111-UNIMOD:21,120-UNIMOD:4,114-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	780-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1299-UNIMOD:21,1302-UNIMOD:4,146-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	315-UNIMOD:21,322-UNIMOD:21	0.02	21.0	3	1	0
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	242-UNIMOD:21,249-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q86YP4|P66A_HUMAN	Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	100-UNIMOD:21,113-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	276-UNIMOD:21,290-UNIMOD:21,226-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	60-UNIMOD:21,52-UNIMOD:21,42-UNIMOD:21	0.13	21.0	4	2	0
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	665-UNIMOD:21,691-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	345-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	596-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q14914|PTGR1_HUMAN	Prostaglandin reductase 1 OS=Homo sapiens OX=9606 GN=PTGR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	88-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	221-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q86TI2|DPP9_HUMAN	Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	473-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q96KB5|TOPK_HUMAN	Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	22-UNIMOD:4,26-UNIMOD:21,32-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	414-UNIMOD:21,412-UNIMOD:21	0.05	21.0	4	2	0
PRT	sp|Q9P0V3|SH3B4_HUMAN	SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	131-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	45-UNIMOD:21,52-UNIMOD:21,47-UNIMOD:21	0.09	21.0	3	1	0
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	226-UNIMOD:21,269-UNIMOD:21,272-UNIMOD:21	0.10	21.0	3	2	1
PRT	sp|O00429-2|DNM1L_HUMAN	Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	574-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O15400|STX7_HUMAN	Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	2-UNIMOD:1,4-UNIMOD:21,79-UNIMOD:21	0.12	21.0	2	2	2
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1,4-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q969J3|BORC5_HUMAN	BLOC-1-related complex subunit 5 OS=Homo sapiens OX=9606 GN=BORCS5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	75-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1,9-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	46-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	284-UNIMOD:21,81-UNIMOD:21,283-UNIMOD:35	0.06	20.0	6	3	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	106-UNIMOD:21,108-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	607-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	293-UNIMOD:21,208-UNIMOD:21	0.08	20.0	4	2	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	161-UNIMOD:4,32-UNIMOD:21,157-UNIMOD:21	0.25	20.0	4	3	2
PRT	sp|Q8NEZ2|VP37A_HUMAN	Vacuolar protein sorting-associated protein 37A OS=Homo sapiens OX=9606 GN=VPS37A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	14-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	87-UNIMOD:21	0.04	20.0	2	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	154-UNIMOD:21	0.03	20.0	4	1	0
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	452-UNIMOD:21,454-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|Q9Y6I9|TX264_HUMAN	Testis-expressed protein 264 OS=Homo sapiens OX=9606 GN=TEX264 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	244-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q5R3I4|TTC38_HUMAN	Tetratricopeptide repeat protein 38 OS=Homo sapiens OX=9606 GN=TTC38 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	452-UNIMOD:21,2-UNIMOD:1,5-UNIMOD:21,10-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	20.0	2	2	2
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	191-UNIMOD:21,198-UNIMOD:21	0.04	20.0	2	2	2
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	22-UNIMOD:21,390-UNIMOD:21,392-UNIMOD:21	0.04	20.0	3	2	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	301-UNIMOD:21,299-UNIMOD:21,296-UNIMOD:35	0.01	20.0	4	1	0
PRT	sp|P15559|NQO1_HUMAN	NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	109-UNIMOD:21,112-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	96-UNIMOD:21,50-UNIMOD:21	0.03	20.0	3	2	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1472-UNIMOD:21,224-UNIMOD:21	0.02	20.0	2	2	2
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	249-UNIMOD:21,370-UNIMOD:21,220-UNIMOD:21,362-UNIMOD:35	0.09	20.0	5	3	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	72-UNIMOD:21,457-UNIMOD:21,460-UNIMOD:21,544-UNIMOD:21,552-UNIMOD:21	0.08	20.0	4	3	2
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	784-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	20.0	null	534-UNIMOD:21,435-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	559-UNIMOD:21	0.02	20.0	3	1	0
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	144-UNIMOD:21,148-UNIMOD:21,137-UNIMOD:21,149-UNIMOD:21	0.14	20.0	3	1	0
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	432-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	119-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	4521-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1721-UNIMOD:21,1727-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	369-UNIMOD:4,387-UNIMOD:21,388-UNIMOD:4,591-UNIMOD:4,593-UNIMOD:21,595-UNIMOD:21	0.06	20.0	3	3	3
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	361-UNIMOD:21,2155-UNIMOD:21	0.01	20.0	4	2	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	30-UNIMOD:21,34-UNIMOD:21,38-UNIMOD:35	0.03	20.0	5	1	0
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	385-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9UNW1|MINP1_HUMAN	Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	44-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	76-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	256-UNIMOD:4,258-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	260-UNIMOD:4,271-UNIMOD:21,277-UNIMOD:21,282-UNIMOD:4,281-UNIMOD:21	0.06	20.0	2	1	0
PRT	sp|Q14012|KCC1A_HUMAN	Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	354-UNIMOD:4,355-UNIMOD:4,363-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P42702|LIFR_HUMAN	Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1059-UNIMOD:21,1061-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	654-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	108-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	253-UNIMOD:21,91-UNIMOD:21	0.07	20.0	5	3	2
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	151-UNIMOD:21	0.13	20.0	1	1	1
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,5-UNIMOD:35,9-UNIMOD:21	0.19	20.0	2	1	0
PRT	sp|Q13438-2|OS9_HUMAN	Isoform 2 of Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	529-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q6VMQ6|MCAF1_HUMAN	Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	673-UNIMOD:21	0.01	19.0	2	2	2
PRT	sp|Q9NZB2|F120A_HUMAN	Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	991-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	68-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	193-UNIMOD:21,220-UNIMOD:21	0.06	19.0	3	2	1
PRT	sp|Q8IXQ3|CI040_HUMAN	Uncharacterized protein C9orf40 OS=Homo sapiens OX=9606 GN=C9orf40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	69-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	265-UNIMOD:21,281-UNIMOD:21	0.07	19.0	3	2	1
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	426-UNIMOD:4,434-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	141-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|O75496|GEMI_HUMAN	Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	63-UNIMOD:21	0.12	19.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	178-UNIMOD:21,181-UNIMOD:21	0.00	19.0	4	1	0
PRT	sp|Q86TM6|SYVN1_HUMAN	E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	613-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	294-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q8N357|S35F6_HUMAN	Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	365-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	240-UNIMOD:21,244-UNIMOD:21	0.03	19.0	3	1	0
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	732-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	460-UNIMOD:21	0.03	19.0	3	2	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	659-UNIMOD:21,390-UNIMOD:21,396-UNIMOD:21,384-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	67-UNIMOD:4,74-UNIMOD:4,77-UNIMOD:4	0.08	19.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|Q99576-3|T22D3_HUMAN	Isoform 2 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	42-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	248-UNIMOD:21,253-UNIMOD:21,243-UNIMOD:21,874-UNIMOD:21	0.04	19.0	3	3	3
PRT	sp|Q8NBR6|MINY2_HUMAN	Ubiquitin carboxyl-terminal hydrolase MINDY-2 OS=Homo sapiens OX=9606 GN=MINDY2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	94-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q86X55|CARM1_HUMAN	Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	463-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	19-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	27-UNIMOD:21	0.07	19.0	3	1	0
PRT	sp|P49116|NR2C2_HUMAN	Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	219-UNIMOD:21,224-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	297-UNIMOD:21,300-UNIMOD:21,269-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	350-UNIMOD:21	0.00	19.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	505-UNIMOD:21,963-UNIMOD:21,793-UNIMOD:21	0.04	19.0	4	3	2
PRT	sp|Q96G28|CFA36_HUMAN	Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	83-UNIMOD:4,85-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9NWU1|OXSM_HUMAN	3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens OX=9606 GN=OXSM PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	343-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q96Q45|TM237_HUMAN	Transmembrane protein 237 OS=Homo sapiens OX=9606 GN=TMEM237 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	44-UNIMOD:21,47-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	192-UNIMOD:21,172-UNIMOD:21	0.11	19.0	3	2	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	88-UNIMOD:21,111-UNIMOD:4,113-UNIMOD:21,277-UNIMOD:21	0.15	19.0	3	3	3
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	51-UNIMOD:21,63-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	108-UNIMOD:35	0.16	19.0	3	1	0
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	105-UNIMOD:4,108-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	43-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	352-UNIMOD:21,360-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q92503|S14L1_HUMAN	SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	586-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	12-UNIMOD:21,25-UNIMOD:21,24-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O15357|SHIP2_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	154-UNIMOD:21,158-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1,13-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	81-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,9-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	683-UNIMOD:35,687-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1,14-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	718-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	294-UNIMOD:21,301-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	233-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	89-UNIMOD:21,92-UNIMOD:4	0.04	18.0	2	1	0
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	293-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	426-UNIMOD:4,434-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	321-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	201-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	144-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	295-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	795-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	291-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	157-UNIMOD:21,159-UNIMOD:4	0.03	18.0	2	1	0
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	412-UNIMOD:4,417-UNIMOD:21,420-UNIMOD:21,432-UNIMOD:21	0.05	18.0	3	3	3
PRT	sp|Q969Z0|FAKD4_HUMAN	FAST kinase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TBRG4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	64-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	101-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O14910|LIN7A_HUMAN	Protein lin-7 homolog A OS=Homo sapiens OX=9606 GN=LIN7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	130-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	181-UNIMOD:21,186-UNIMOD:21,172-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	255-UNIMOD:21,689-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|Q9H3U1|UN45A_HUMAN	Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	8-UNIMOD:21,15-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	189-UNIMOD:21,193-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	321-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	74-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	658-UNIMOD:4,660-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	64-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	173-UNIMOD:4,181-UNIMOD:21,194-UNIMOD:4	0.10	18.0	1	1	1
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1006-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	70-UNIMOD:21,79-UNIMOD:21	0.10	18.0	2	1	0
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	346-UNIMOD:4,352-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q14542|S29A2_HUMAN	Equilibrative nucleoside transporter 2 OS=Homo sapiens OX=9606 GN=SLC29A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	251-UNIMOD:21	0.07	18.0	2	2	2
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	18.0	1	1	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2029-UNIMOD:21,2032-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	62-UNIMOD:4,64-UNIMOD:21,471-UNIMOD:4,481-UNIMOD:21	0.08	18.0	3	3	3
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	35-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|O75223|GGCT_HUMAN	Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	136-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	619-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	234-UNIMOD:21,388-UNIMOD:21,392-UNIMOD:21,232-UNIMOD:21,394-UNIMOD:21	0.11	18.0	6	4	2
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	38-UNIMOD:21,17-UNIMOD:4,26-UNIMOD:21,17-UNIMOD:385	0.15	18.0	3	2	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	287-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	280-UNIMOD:21,46-UNIMOD:21	0.09	18.0	5	3	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1079-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	203-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|O60333|KIF1B_HUMAN	Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	647-UNIMOD:21,649-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	527-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	238-UNIMOD:21,241-UNIMOD:21,239-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	2	2	2
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	787-UNIMOD:21,498-UNIMOD:21	0.02	18.0	3	2	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	115-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|O60499|STX10_HUMAN	Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	108-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	487-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	18.0	null	1-UNIMOD:1,5-UNIMOD:21,1-UNIMOD:35,104-UNIMOD:21	0.01	18.0	3	2	1
PRT	sp|Q765P7|MTSS2_HUMAN	Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	615-UNIMOD:4,624-UNIMOD:21,634-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|O60831|PRAF2_HUMAN	PRA1 family protein 2 OS=Homo sapiens OX=9606 GN=PRAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	19-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	18.0	null	36-UNIMOD:385,36-UNIMOD:4,38-UNIMOD:21	0.06	18.0	4	1	0
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	65-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	132-UNIMOD:21,137-UNIMOD:21,133-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|Q9NVD7|PARVA_HUMAN	Alpha-parvin OS=Homo sapiens OX=9606 GN=PARVA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,4-UNIMOD:21,14-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1049-UNIMOD:21,1047-UNIMOD:21	0.01	17.0	2	1	0
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	955-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	187-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	9-UNIMOD:21	0.13	17.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	69-UNIMOD:21	0.09	17.0	2	1	0
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1290-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	144-UNIMOD:21,150-UNIMOD:21	0.07	17.0	2	1	0
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	754-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	87-UNIMOD:21	0.05	17.0	3	1	0
PRT	sp|P60953|CDC42_HUMAN	Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	157-UNIMOD:4,158-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1915-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q96BD0|SO4A1_HUMAN	Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	40-UNIMOD:21,34-UNIMOD:21	0.02	17.0	3	1	0
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	394-UNIMOD:21,398-UNIMOD:21	0.04	17.0	3	2	1
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	461-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	125-UNIMOD:21	0.10	17.0	2	1	0
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	110-UNIMOD:21,130-UNIMOD:4	0.18	17.0	3	2	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	304-UNIMOD:21,266-UNIMOD:21,275-UNIMOD:21,281-UNIMOD:4	0.05	17.0	2	2	2
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1038-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	240-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	62-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2138-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q6ZW49|PAXI1_HUMAN	PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	235-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	209-UNIMOD:21,219-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9Y6Y0|NS1BP_HUMAN	Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	274-UNIMOD:4,277-UNIMOD:21,276-UNIMOD:21,284-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	457-UNIMOD:4,459-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|O00330|ODPX_HUMAN	Pyruvate dehydrogenase protein X component, mitochondrial OS=Homo sapiens OX=9606 GN=PDHX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	375-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|O95067|CCNB2_HUMAN	G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	392-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	650-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	186-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	247-UNIMOD:21,253-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	64-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P78310|CXAR_HUMAN	Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	329-UNIMOD:21,332-UNIMOD:21	0.07	17.0	2	1	0
PRT	sp|Q9BQP7|MGME1_HUMAN	Mitochondrial genome maintenance exonuclease 1 OS=Homo sapiens OX=9606 GN=MGME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	68-UNIMOD:21,79-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|Q9ULU4|PKCB1_HUMAN	Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	541-UNIMOD:21,547-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	104-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	186-UNIMOD:21	0.05	17.0	2	1	0
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	104-UNIMOD:21,106-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	96-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	292-UNIMOD:4,303-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	814-UNIMOD:21,796-UNIMOD:21	0.03	17.0	2	2	2
PRT	sp|Q9HDC5|JPH1_HUMAN	Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	413-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	260-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q13370|PDE3B_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase B OS=Homo sapiens OX=9606 GN=PDE3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	561-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	388-UNIMOD:21,221-UNIMOD:21,226-UNIMOD:21	0.03	17.0	2	2	2
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	194-UNIMOD:21	0.10	17.0	2	1	0
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	448-UNIMOD:4,458-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	43-UNIMOD:21,44-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	387-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|O94855|SC24D_HUMAN	Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	299-UNIMOD:4,308-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O75674|TM1L1_HUMAN	TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	321-UNIMOD:21,323-UNIMOD:21	0.05	17.0	3	1	0
PRT	sp|Q16537|2A5E_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,7-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:4,9-UNIMOD:21	0.18	17.0	2	2	2
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	17.0	3	2	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,3-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	1-UNIMOD:1,3-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	335-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	199-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P31629|ZEP2_HUMAN	Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	392-UNIMOD:21,395-UNIMOD:21,400-UNIMOD:21,381-UNIMOD:21	0.01	17.0	2	1	0
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	333-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	224-UNIMOD:21,232-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	346-UNIMOD:28,353-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	275-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	315-UNIMOD:21,310-UNIMOD:35	0.02	16.0	2	1	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	172-UNIMOD:21	0.10	16.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|O75947|ATP5H_HUMAN	ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	39-UNIMOD:21,100-UNIMOD:21,101-UNIMOD:4	0.16	16.0	2	2	2
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	303-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	715-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P53990|IST1_HUMAN	IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	294-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	150-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	170-UNIMOD:4,178-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	182-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	237-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|O95685|PPR3D_HUMAN	Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	41-UNIMOD:4,46-UNIMOD:21,54-UNIMOD:21,60-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	317-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	22-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	55-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	422-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	245-UNIMOD:21,247-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	17-UNIMOD:21	0.21	16.0	1	1	1
PRT	sp|O94925|GLSK_HUMAN	Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	95-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|O15439|MRP4_HUMAN	Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	646-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1180-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q8IWE2|NXP20_HUMAN	Protein NOXP20 OS=Homo sapiens OX=9606 GN=FAM114A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	199-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	467-UNIMOD:21,351-UNIMOD:21,364-UNIMOD:21	0.06	16.0	2	2	2
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	628-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	147-UNIMOD:4,150-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9HAU0|PKHA5_HUMAN	Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	930-UNIMOD:21,937-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|O14579|COPE_HUMAN	Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	307-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	258-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	433-UNIMOD:21,439-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	159-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	100-UNIMOD:4,127-UNIMOD:21,90-UNIMOD:21	0.49	16.0	2	2	2
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	1-UNIMOD:1,8-UNIMOD:4,9-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:21	0.08	16.0	2	1	0
PRT	sp|Q86U42|PABP2_HUMAN	Polyadenylate-binding protein 2 OS=Homo sapiens OX=9606 GN=PABPN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	150-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|Q9BW91|NUDT9_HUMAN	ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	116-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	663-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P30566|PUR8_HUMAN	Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,9-UNIMOD:21,15-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	82-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	49-UNIMOD:4	0.06	15.0	1	1	1
PRT	sp|O94979|SC31A_HUMAN	Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	799-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P42892|ECE1_HUMAN	Endothelin-converting enzyme 1 OS=Homo sapiens OX=9606 GN=ECE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	733-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	2	1	0
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|O43678|NDUA2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Homo sapiens OX=9606 GN=NDUFA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	96-UNIMOD:21	0.11	15.0	1	1	1
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	488-UNIMOD:21,487-UNIMOD:35	0.01	15.0	2	1	0
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	256-UNIMOD:4,258-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q2M2I8|AAK1_HUMAN	AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	623-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q7Z4S6|KI21A_HUMAN	Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1274-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	359-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	265-UNIMOD:21,269-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8NB90|AFG2H_HUMAN	ATPase family protein 2 homolog OS=Homo sapiens OX=9606 GN=SPATA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	398-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	996-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	246-UNIMOD:21,249-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P49757|NUMB_HUMAN	Protein numb homolog OS=Homo sapiens OX=9606 GN=NUMB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	634-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q05D32|CTSL2_HUMAN	CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	165-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	11-UNIMOD:21	0.14	15.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	114-UNIMOD:21,517-UNIMOD:21	0.02	15.0	2	2	2
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	212-UNIMOD:21	0.07	15.0	2	1	0
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	149-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q96HC4|PDLI5_HUMAN	PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	111-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	136-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|Q15018|ABRX2_HUMAN	BRISC complex subunit Abraxas 2 OS=Homo sapiens OX=9606 GN=ABRAXAS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	280-UNIMOD:21	0.04	15.0	2	1	0
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	316-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	307-UNIMOD:21,309-UNIMOD:4	0.02	15.0	2	1	0
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	274-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	10-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	123-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	97-UNIMOD:21,100-UNIMOD:4	0.08	15.0	2	1	0
PRT	sp|Q8WU79|SMAP2_HUMAN	Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	219-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	99-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|Q9Y5J6|T10B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	99-UNIMOD:21	0.25	15.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	268-UNIMOD:21	0.12	15.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1492-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q12906-7|ILF3_HUMAN	Isoform 7 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	504-UNIMOD:21	0.05	15.0	1	1	0
PRT	sp|Q9H078|CLPB_HUMAN	Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	663-UNIMOD:21,668-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,12-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	33-UNIMOD:21,37-UNIMOD:21	0.10	15.0	1	1	1
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	305-UNIMOD:21,314-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q05397|FAK1_HUMAN	Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	910-UNIMOD:21,914-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q8NDV7|TNR6A_HUMAN	Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1044-UNIMOD:21,1047-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8NFM7|I17RD_HUMAN	Interleukin-17 receptor D OS=Homo sapiens OX=9606 GN=IL17RD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	145-UNIMOD:35,153-UNIMOD:35,157-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9HCH0|NCK5L_HUMAN	Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	763-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	108-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	229-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	260-UNIMOD:35,264-UNIMOD:21	0.04	14.0	2	1	0
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	62-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	549-UNIMOD:21,526-UNIMOD:21	0.08	14.0	2	2	2
PRT	sp|Q9NXH9|TRM1_HUMAN	tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	614-UNIMOD:4,620-UNIMOD:4,621-UNIMOD:4,628-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	492-UNIMOD:21,494-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	48-UNIMOD:21,54-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	104-UNIMOD:4,106-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	118-UNIMOD:21	0.09	14.0	1	1	1
PRT	sp|Q96JP5|ZFP91_HUMAN	E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	101-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	349-UNIMOD:4,355-UNIMOD:21	0.04	14.0	2	1	0
PRT	sp|O96019|ACL6A_HUMAN	Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	233-UNIMOD:21,86-UNIMOD:21	0.06	14.0	2	2	2
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	216-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|P63000|RAC1_HUMAN	Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	105-UNIMOD:4,108-UNIMOD:21	0.08	14.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	726-UNIMOD:21,730-UNIMOD:21	0.02	14.0	2	1	0
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|Q15771|RAB30_HUMAN	Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	184-UNIMOD:21	0.09	14.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	61-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	900-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	143-UNIMOD:4,147-UNIMOD:4,148-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	241-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.13	14.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	525-UNIMOD:21,527-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|Q96DB5|RMD1_HUMAN	Regulator of microtubule dynamics protein 1 OS=Homo sapiens OX=9606 GN=RMDN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	308-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q9H4X1|RGCC_HUMAN	Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	102-UNIMOD:21,107-UNIMOD:21	0.15	14.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	47-UNIMOD:21	0.07	14.0	1	1	1
PRT	sp|Q9H8W4|PKHF2_HUMAN	Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	233-UNIMOD:21	0.11	14.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	511-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|O43572|AKA10_HUMAN	A-kinase anchor protein 10, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	197-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1	0.34	14.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	198-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	548-UNIMOD:21,563-UNIMOD:4,564-UNIMOD:21,569-UNIMOD:4,558-UNIMOD:21	0.06	14.0	3	2	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	159-UNIMOD:21	0.08	14.0	1	1	1
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	890-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9P218|COKA1_HUMAN	Collagen alpha-1(XX) chain OS=Homo sapiens OX=9606 GN=COL20A1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	77-UNIMOD:21,81-UNIMOD:21,86-UNIMOD:21	0.01	14.0	2	1	0
PRT	sp|Q8WXI7|MUC16_HUMAN	Mucin-16 OS=Homo sapiens OX=9606 GN=MUC16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	402-UNIMOD:21,424-UNIMOD:21	0.00	14.0	1	1	1
PRT	sp|Q969G6|RIFK_HUMAN	Riboflavin kinase OS=Homo sapiens OX=9606 GN=RFK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	77-UNIMOD:21,78-UNIMOD:35	0.08	14.0	1	1	1
PRT	sp|O14638|ENPP3_HUMAN	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3 OS=Homo sapiens OX=9606 GN=ENPP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	439-UNIMOD:21,441-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	50-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	154-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.02	13.0	1	1	1
PRT	sp|Q10571|MN1_HUMAN	Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1007-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	374-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	93-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	43-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	13-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	77-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	9-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	320-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O75369-8|FLNB_HUMAN	Isoform 8 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1474-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9NWT8|AKIP_HUMAN	Aurora kinase A-interacting protein OS=Homo sapiens OX=9606 GN=AURKAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	191-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|P49590|SYHM_HUMAN	Histidine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	67-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	74-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	332-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	325-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	306-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q9UMZ2|SYNRG_HUMAN	Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	580-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9H079|KTBL1_HUMAN	KATNB1-like protein 1 OS=Homo sapiens OX=9606 GN=KATNBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	135-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	54-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	117-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	481-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	978-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q15004|PAF15_HUMAN	PCNA-associated factor OS=Homo sapiens OX=9606 GN=PCLAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	54-UNIMOD:4,58-UNIMOD:21	0.14	13.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	490-UNIMOD:21	0.02	13.0	2	1	0
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	410-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9UPQ9|TNR6B_HUMAN	Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	384-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	355-UNIMOD:21,363-UNIMOD:4	0.04	13.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	399-UNIMOD:21,401-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	190-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	356-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q6XQN6|PNCB_HUMAN	Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	533-UNIMOD:4,537-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9UI09|NDUAC_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	141-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q99576|T22D3_HUMAN	TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	112-UNIMOD:4,122-UNIMOD:21	0.20	13.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,4-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	302-UNIMOD:35	0.05	13.0	1	1	1
PRT	sp|Q15049|MLC1_HUMAN	Membrane protein MLC1 OS=Homo sapiens OX=9606 GN=MLC1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	357-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O95785|WIZ_HUMAN	Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1010-UNIMOD:21,1017-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	409-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P13674|P4HA1_HUMAN	Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	67-UNIMOD:21,68-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|O43745|CHP2_HUMAN	Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	173-UNIMOD:21	0.13	13.0	1	1	1
PRT	sp|Q9NSY1|BMP2K_HUMAN	BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	1105-UNIMOD:28,1114-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q3MHD2|LSM12_HUMAN	Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	93-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q14761|PTCA_HUMAN	Protein tyrosine phosphatase receptor type C-associated protein OS=Homo sapiens OX=9606 GN=PTPRCAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	107-UNIMOD:28,113-UNIMOD:21,134-UNIMOD:4,139-UNIMOD:21	0.22	13.0	1	1	1
PRT	sp|Q6PL24|TMED8_HUMAN	Protein TMED8 OS=Homo sapiens OX=9606 GN=TMED8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	61-UNIMOD:4,62-UNIMOD:21,71-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q16720|AT2B3_HUMAN	Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2B3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	260-UNIMOD:35,268-UNIMOD:35,271-UNIMOD:21,274-UNIMOD:35,290-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P41162|ETV3_HUMAN	ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	412-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	34-UNIMOD:21,37-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q01814|AT2B2_HUMAN	Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	257-UNIMOD:35,271-UNIMOD:35,274-UNIMOD:21,280-UNIMOD:21	0.04	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	67.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3540.6	39.27207	3	2508.0703	2508.0760	M	R	2	32
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	2	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	59.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3343.6	34.19643	3	2994.258971	2994.261530	K	A	106	138
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	3	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	59.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3548.5	39.46982	3	2508.0703	2508.0760	M	R	2	32
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	4	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	57.0	2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2800.5	20.2582	4	3178.154094	3178.161241	R	K	494	522
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	5	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	57.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3335.5	33.9899	3	2994.258971	2994.261530	K	A	106	138
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	6	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4751.2	60.84387	4	3720.676894	3720.684901	K	G	621	655
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	7	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	52.0	18-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4752.2	60.86918	4	3720.676894	3720.684901	K	G	621	655
PSM	LVQDVANNTNEEAGDGTTTATVLAR	8	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3375.6	35.02073	3	2639.205371	2639.207584	K	S	97	122
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	9	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3327.6	33.78498	3	2994.258971	2994.261530	K	A	106	138
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	10	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3248.5	31.73713	4	3093.281294	3093.277137	R	-	738	768
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	11	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3638.5	41.72562	3	2573.996471	2573.998594	R	G	239	267
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	12	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3650.6	42.03672	3	2988.147971	2988.155727	K	E	144	170
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	13	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4749.2	60.81282	4	3720.676894	3720.684901	K	G	621	655
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	14	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	33.82325	4	2994.258094	2994.261530	K	A	106	138
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	15	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3377.6	35.07203	5	4716.099118	4716.094806	K	A	530	573
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	16	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3736.5	44.25923	4	3385.513694	3385.515651	K	A	399	429
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	17	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3532.5	39.06147	3	2508.0703	2508.0760	M	R	2	32
PSM	IADPEHDHTGFLTEYVATR	18	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3568.2	39.94202	4	2330.958494	2330.961009	R	W	190	209
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	19	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	5-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3801.5	45.916	4	3637.638494	3637.645482	R	V	592	630
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	20	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4268.3	55.47583	4	3681.629294	3681.639334	K	K	213	250
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	21	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	18-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4733.2	60.6517	5	3720.676118	3720.684901	K	G	621	655
PSM	SCDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPK	22	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	2-UNIMOD:4,8-UNIMOD:4,11-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3893.5	48.22635	4	4014.590894	4014.596619	K	N	240	277
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	23	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3426.5	36.32376	3	3291.362171	3291.357615	R	S	1160	1192
PSM	NSCQDSEADEETSPGFDEQEDGSSSQTANKPSR	24	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2969.4	24.5552	4	3668.391294	3668.396597	K	F	311	344
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	25	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4981.2	62.82537	3	2996.298971	2996.305323	R	E	492	521
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	26	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3876.3	47.79128	3	2749.2250	2749.2301	-	Y	1	25
PSM	AAAVAAAGAGEPQSPDELLPK	27	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4127.2	53.40155	3	2083.9805	2083.9822	M	G	2	23
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	28	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3256.3	31.93432	4	3093.281294	3093.277137	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	29	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3285.6	32.69245	4	3173.246094	3173.243468	R	-	738	768
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	30	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3372.6	34.94483	4	4716.090894	4716.094806	K	A	530	573
PSM	GGPGSAVSPYPTFNPSSDVAALHK	31	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3836.3	46.75915	3	2515.073771	2515.082187	K	A	30	54
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	32	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	15-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.5190.2	64.48245	3	2952.323471	2952.330281	R	S	59	86
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	33	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3642.6	41.83282	3	2988.147971	2988.155727	K	E	144	170
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	34	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4364.2	56.99842	4	3537.362094	3537.370051	R	V	44	74
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	35	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3360.4	34.62857	4	2991.326494	2991.328110	R	V	221	251
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	36	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3319.6	33.57642	3	2994.258971	2994.261530	K	A	106	138
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	37	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=1.1.3264.6	32.1467	4	4445.550894	4445.553592	K	G	177	218
PSM	DNLTLWTSDTQGDEAEAGEGGEN	38	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=1.1.3883.5	47.97155	3	2407.983371	2407.988786	R	-	223	246
PSM	AAAVAAAGAGEPQSPDELLPK	39	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4137.2	53.60227	3	2083.9805	2083.9822	M	G	2	23
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	40	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	2-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3149.6	29.16002	4	3088.158494	3088.156036	R	A	10	40
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	41	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3298.6	33.03063	3	3722.195171	3722.195067	K	A	158	190
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	42	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3535.4	39.1365	4	2989.534494	2989.541321	K	G	202	228
PSM	ADLLLSTQPGREEGSPLELER	43	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3748.6	44.55779	3	2389.152371	2389.152635	K	L	593	614
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	44	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4393.2	57.31581	3	2747.126171	2747.134344	K	D	208	233
PSM	DDDIAALVVDNGSGMCK	45	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4495.3	58.34947	2	1900.7538	1900.7579	M	A	2	19
PSM	AAAVAAAGAGEPQSPDELLPK	46	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4101.3	52.97385	3	2085.9862	2083.9822	M	G	2	23
PSM	VPPAPVPCPPPSPGPSAVPSSPK	47	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3409.4	35.89993	3	2378.076971	2378.078288	K	S	366	389
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	48	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	11-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3466.5	37.34908	4	3265.400494	3265.402471	K	-	708	738
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	49	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4159.2	53.94057	4	3836.395294	3836.405155	K	A	469	503
PSM	VPADTEVVCAPPTAYIDFAR	50	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4084.3	52.6428	3	2271.025871	2271.028287	K	Q	71	91
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	51	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3458.6	37.14838	3	3265.400171	3265.402471	K	-	708	738
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	52	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3457.6	37.12262	4	3459.428094	3459.429735	K	L	104	135
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	53	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3907.3	48.58907	4	3536.402094	3536.408665	R	-	207	238
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	54	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4350.2	56.78793	4	3537.362094	3537.370051	R	V	44	74
PSM	AAPEASSPPASPLQHLLPGK	55	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3819.2	46.36852	3	2128.977971	2126.980288	K	A	686	706
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	56	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	14-UNIMOD:21,21-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3421.3	36.2077	4	3071.302094	3071.294441	R	V	221	251
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	57	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3148.6	29.1338	3	2779.094771	2779.094999	K	M	571	596
PSM	ELAQRQEEEAAQQGPVVVSPASDYK	58	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3278.6	32.51003	4	2808.298894	2808.296734	K	D	140	165
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	59	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	7-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3121.6	28.43612	4	3492.326494	3492.326786	K	A	111	145
PSM	DTQSPSTCSEGLLGWSQK	60	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3839.2	46.82953	3	2059.849271	2059.855802	K	D	709	727
PSM	IADPEHDHTGFLTEYVATR	61	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3558.2	39.71965	4	2330.958494	2330.961009	R	W	190	209
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	62	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4861.2	61.88213	3	2620.049171	2620.055380	K	S	180	204
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	63	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3793.2	45.7015	4	3637.638494	3637.645482	R	V	592	630
PSM	VQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVK	64	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3615.6	41.15793	4	3939.724094	3939.727022	K	D	2008	2043
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	65	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3249.6	31.76638	4	3705.520894	3704.512278	K	-	158	196
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	66	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3257.5	31.9659	4	3706.523294	3704.512278	K	-	158	196
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	67	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3617.3	41.20627	3	2758.1429	2758.1503	M	D	2	33
PSM	AAAVAAAGAGEPQSPDELLPK	68	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4111.2	53.18457	3	2083.9805	2083.9822	M	G	2	23
PSM	GYNHGQGSYSYSNSYNSPGGGGGSDYNYESK	69	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3188.6	30.17303	4	3332.259294	3332.259238	K	F	776	807
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	70	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3117.3	28.32318	5	3112.513118	3112.507789	R	S	847	876
PSM	ATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	71	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3189.5	30.19595	4	3668.404494	3668.406493	K	G	291	325
PSM	RVATPVDWKDGDSVMVLPTIPEEEAK	72	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3904.2	48.51135	4	2961.421694	2961.419491	K	K	174	200
PSM	DATNVGDEGGFAPNILENK	73	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.3737.5	44.28405	3	1959.916271	1959.917400	K	E	203	222
PSM	SSSPAPADIAQTVQEDLR	74	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4066.2	52.22104	3	1963.890371	1963.888816	K	T	230	248
PSM	ILATPPQEDAPSVDIANIR	75	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3972.5	50.0525	3	2178.991271	2178.996332	K	M	284	303
PSM	AIVDALPPPCESACTVPTDVDK	76	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3656.4	42.1792	3	2434.075271	2434.079730	R	W	261	283
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	77	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4311.2	56.04428	3	2540.080271	2540.089049	K	S	180	204
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	78	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:28,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2892.6	22.56812	3	3087.2924	3087.2954	K	S	145	174
PSM	MDSAGQDINLNSPNK	79	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3536.6	39.16893	2	1724.7026	1724.7072	-	G	1	16
PSM	VPPAPVPCPPPSPGPSAVPSSPK	80	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3417.5	36.108	3	2378.076971	2378.078288	K	S	366	389
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	81	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:21,21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3420.5	36.18385	3	3071.294171	3071.294441	R	V	221	251
PSM	DATNVGDEGGFAPNILENK	82	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3735.2	44.22423	3	1959.916271	1959.917400	K	E	203	222
PSM	EGEEAGPGDPLLEAVPKTGDEK	83	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3546.5	39.4192	3	2317.028171	2317.036268	K	D	353	375
PSM	EVSSLEGSPPPCLGQEEAVCTK	84	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3492.5	38.01957	3	2453.048171	2453.049158	K	I	1388	1410
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	85	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4412.2	57.52065	3	2747.126171	2747.134344	K	D	208	233
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	86	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.5012.2	63.05707	3	2996.298971	2996.305323	R	E	492	521
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	87	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	27-UNIMOD:21	ms_run[1]:scan=1.1.4308.2	55.96817	4	3274.352094	3274.357556	R	N	282	311
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTK	88	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3899.3	48.38125	5	4931.341618	4931.348895	R	H	475	524
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	89	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3884.4	47.99258	3	2749.2250	2749.2301	-	Y	1	25
PSM	KAEGAATEEEGTPKESEPQAAAEPAEAK	90	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2845.5	21.37052	4	2905.288094	2905.286622	K	E	25	53
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	91	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3415.6	36.06252	4	3185.432094	3185.436140	K	-	708	738
PSM	NGSLDSPGKQDTEEDEEEDEK	92	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2846.5	21.39628	3	2429.922071	2429.923149	K	D	134	155
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	93	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3393.4	35.48133	4	2853.392494	2853.390968	K	K	62	95
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	94	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2828.3	20.9384	4	3024.351694	3024.356099	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	95	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2797.4	20.18512	4	3104.324894	3104.322430	K	S	145	174
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	96	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3306.6	33.23746	3	3722.195171	3722.195067	K	A	158	190
PSM	DNLTLWTSDSAGEECDAAEGAEN	97	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3918.5	48.8556	3	2453.973371	2453.976507	R	-	223	246
PSM	ADEAGKDKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	98	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	36-UNIMOD:21	ms_run[1]:scan=1.1.3636.6	41.67685	5	5127.1986	5127.2009	K	R	714	764
PSM	DDDIAALVVDNGSGMCK	99	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4511.2	58.55553	2	1900.7538	1900.7579	M	A	2	19
PSM	AQETNQTPGPMLCSTGCGFYGNPR	100	sp|O76080|ZFAN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,7-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3876.4	47.79795	3	2764.1006	2764.1076	M	T	2	26
PSM	AAAVAAAGAGEPQSPDELLPK	101	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4092.2	52.76257	3	2085.9862	2083.9822	M	G	2	23
PSM	TAAKGEAAAERPGEAAVASSPSK	102	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2747.2	18.9957	4	2235.054094	2235.053256	K	A	8	31
PSM	VAAETQSPSLFGSTK	103	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3333.4	33.93433	2	1601.730847	1601.733819	K	L	215	230
PSM	LVQDVANNTNEEAGDGTTTATVLAR	104	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3344.6	34.22118	3	2559.244571	2559.241253	K	S	97	122
PSM	SAESPTSPVTSETGSTFK	105	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3263.6	32.12077	2	1891.806647	1891.808834	K	K	280	298
PSM	VPPAPVPCPPPSPGPSAVPSSPK	106	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3426.3	36.3171	3	2378.076971	2378.078288	K	S	366	389
PSM	ETESAPGSPRAVTPVPTKTEEVSNLK	107	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3188.4	30.16637	4	2883.330894	2883.330416	K	T	514	540
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	108	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3240.5	31.52847	4	3093.281294	3093.277137	R	-	738	768
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	109	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3851.5	47.15103	4	3013.328894	3013.339266	K	V	8	36
PSM	LDGLVETPTGYIESLPR	110	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4408.2	57.43737	3	1938.930371	1938.933975	R	V	56	73
PSM	SSSPAPADIAQTVQEDLR	111	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4058.3	52.02507	3	1963.890371	1963.888816	K	T	230	248
PSM	TPEELDDSDFETEDFDVR	112	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3953.3	49.63435	3	2237.850371	2237.852550	R	S	634	652
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	113	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3711.6	43.61615	3	3393.341171	3393.345713	K	F	86	114
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	114	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3880.6	47.9012	4	3465.474894	3465.481982	K	A	399	429
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	115	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3916.4	48.80398	4	3536.402094	3536.408665	R	-	207	238
PSM	EEEIAALVIDNGSGMCK	116	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5418.2	65.96028	2	1956.8122	1956.8205	M	A	2	19
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	117	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.2926.4	23.44635	3	3007.3276	3007.3290	K	S	145	174
PSM	SQEGESVTEDISFLESPNPENK	118	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3993.2	50.52332	3	2516.061371	2515.063940	K	D	81	103
PSM	IACRSPQPDPVGTPTIFKPQSK	119	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3422.3	36.22486	4	2583.196894	2583.195777	K	R	2219	2241
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	120	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3293.5	32.89687	4	3173.246094	3173.243468	R	-	738	768
PSM	GEPAAAAAPEAGASPVEK	121	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2928.4	23.49145	3	1701.763571	1701.761096	K	E	88	106
PSM	TPSPKEEDEEPESPPEK	122	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2807.3	20.41755	3	2003.821871	2003.824878	K	K	202	219
PSM	NGSLDSPGKQDTEEDEEEDEK	123	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2869.2	21.98537	3	2509.885871	2509.889480	K	D	134	155
PSM	PAEKPAETPVATSPTATDSTSGDSSR	124	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2868.6	21.9598	3	2639.154671	2639.159965	K	S	148	174
PSM	PAEKPAETPVATSPTATDSTSGDSSR	125	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2827.2	20.91403	3	2719.122371	2719.126296	K	S	148	174
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	126	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3311.6	33.36795	3	2994.258971	2994.261530	K	A	106	138
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	127	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3113.6	28.22957	4	3492.326494	3492.326786	K	A	111	145
PSM	EAAGGNDSSGATSPINPAVALE	128	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3773.6	45.19332	3	2106.906071	2106.910674	K	-	1236	1258
PSM	DMESPTKLDVTLAK	129	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	38.08683	3	1626.761771	1626.757591	K	D	277	291
PSM	MVIQGPSSPQGEAMVTDVLEDQK	130	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4151.2	53.81082	3	2538.129371	2538.138307	K	E	1107	1130
PSM	VTNGAFTGEISPGMIK	131	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3756.4	44.75203	3	1700.784671	1700.784474	K	D	107	123
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	132	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:35	ms_run[1]:scan=1.1.3694.3	43.17467	4	3472.438094	3472.437249	R	-	207	238
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	133	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.4031.3	51.41273	3	2763.123671	2763.129259	K	D	208	233
PSM	SATSSSPGSPLHSLETSL	134	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4498.2	58.39378	2	1916.773247	1916.780585	K	-	1203	1221
PSM	TPEELDDSDFETEDFDVR	135	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3943.3	49.41195	3	2237.850371	2237.852550	R	S	634	652
PSM	DYEIESQNPLASPTNTLLGSAK	136	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4150.4	53.7853	3	2427.113771	2427.120667	K	E	618	640
PSM	AIVDALPPPCESACTVPTDVDK	137	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3664.5	42.39115	3	2434.075271	2434.079730	R	W	261	283
PSM	DYEIESQNPLASPTNTLLGSAK	138	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4301.2	55.88385	3	2507.081171	2507.086998	K	E	618	640
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	139	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3697.2	43.2388	4	2835.274094	2835.274618	R	T	350	376
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	140	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3483.4	37.7802	4	3431.357694	3431.356309	R	E	62	93
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	141	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3960.5	49.77917	4	3756.429294	3756.438824	K	A	469	503
PSM	DDDIAALVVDNGSGMCK	142	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4247.3	55.10838	2	1820.7879	1820.7915	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	143	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4193.2	54.3818	3	1916.7485	1916.7528	M	A	2	19
PSM	ADLSLADALTEPSPDIEGEIKR	144	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4504.2	58.47157	3	2461.1554	2461.1620	M	D	2	24
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	145	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3545.3	39.3874	4	2508.0735	2508.0760	M	R	2	32
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	146	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3629.5	41.49872	3	2765.2213	2765.2250	-	Y	1	25
PSM	GKEDEGEEAASPMLQIQR	147	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3287.5	32.74038	3	2066.899871	2066.898001	K	D	2400	2418
PSM	SGSSSPDSEITELK	148	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3317.6	33.52472	2	1515.631447	1515.634164	R	F	571	585
PSM	IRYESLTDPSKLDSGK	149	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3267.4	32.21735	3	1887.901271	1887.897924	K	E	54	70
PSM	NCQTVLAPCSPNPCENAAVCK	150	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3283.6	32.64028	3	2468.991971	2468.994638	K	E	829	850
PSM	LVQDVANNTNEEAGDGTTTATVLAR	151	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3367.6	34.81664	3	2639.205371	2639.207584	K	S	97	122
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	152	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2796.2	20.16103	5	3104.324118	3104.322430	K	S	145	174
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	153	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3103.5	27.9653	4	3365.452094	3365.451593	K	K	799	833
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	154	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3290.6	32.82198	3	3722.195171	3722.195067	K	A	158	190
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	155	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3543.5	39.34433	4	2833.347294	2833.352672	K	S	362	389
PSM	TPSSDVLVFDYTK	156	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3921.2	48.93293	2	1550.687047	1550.690557	K	H	144	157
PSM	SACGNCYLGDAFR	157	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3649.2	41.99873	2	1569.569847	1569.574164	K	C	272	285
PSM	EVAATEEDVTRLPSPTSPFSSLSQDQAATSK	158	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3959.2	49.75262	4	3408.494494	3408.501123	K	A	975	1006
PSM	EPSYPMPVQETQAPESPGENSEQALQTLSPR	159	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	16-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=1.1.3906.5	48.56283	4	3556.502494	3556.510642	K	A	137	168
PSM	NASTFEDVTQVSSAYQK	160	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3521.6	38.77893	2	1953.830447	1953.835718	K	T	320	337
PSM	KYEQGFITDPVVLSPKDR	161	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3529.2	38.97357	4	2171.062494	2171.066387	K	V	109	127
PSM	DNLTLWTSDMQGDGEEQNK	162	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3805.2	46.00883	3	2179.928471	2179.932792	R	E	226	245
PSM	DGYADIVDVLNSPLEGPDQK	163	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4720.2	60.52827	3	2223.990671	2223.993675	K	S	287	307
PSM	VPPAPVPCPPPSPGPSAVPSSPK	164	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3435.5	36.54852	3	2378.076371	2378.078288	K	S	366	389
PSM	DNLTLWTSDTQGDEAEAGEGGEN	165	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3892.4	48.19407	3	2407.983371	2407.988786	R	-	223	246
PSM	ERIQQFDDGGSDEEDIWEEK	166	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3686.3	42.9594	3	2503.996271	2504.001674	K	H	607	627
PSM	TDLNPDNLQGGDDLDPNYVLSSR	167	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3895.2	48.27815	3	2597.126471	2597.128271	K	V	108	131
PSM	DITDPLSLNTCTDEGHVVLASPLK	168	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.4081.2	52.59063	3	2674.253471	2674.256115	K	T	234	258
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	169	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	46.5045	4	2881.088494	2881.094982	K	T	701	725
PSM	HSVTAATPPPSPTSGESGDLLSNLLQSPSSAK	170	sp|Q96QU8|XPO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4319.3	56.17392	4	3292.482894	3292.490164	K	L	198	230
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	171	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3745.6	44.484	4	3385.513694	3385.515651	K	A	399	429
PSM	SNDSTEQNLSDGTPMPDSYPTTPSSTDAATSESK	172	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3428.3	36.37532	3	3597.446171	3597.446172	K	E	2726	2760
PSM	LYGSAGPPPTGEEDTAEKDEL	173	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3435.4	36.54519	3	2255.955371	2254.951870	K	-	634	655
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	174	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3893.4	48.21968	3	2749.2250	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	175	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4035.3	51.51602	3	2830.1952	2829.1962	-	Y	1	25
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDK	176	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3534.6	39.11682	4	4593.0982	4593.1142	M	K	2	53
PSM	AAEEAFVNDIDESSPGTEWER	177	sp|P09496-2|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3896.2	48.30383	3	2430.980171	2430.985295	R	V	163	184
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPK	178	sp|Q9H2V7|SPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=1.1.4187.2	54.32137	4	3356.4656	3356.4717	M	S	2	36
PSM	IRYESLTDPSKLDSGK	179	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3259.2	32.00898	3	1887.901271	1887.897924	K	E	54	70
PSM	IACKSPPPESVDTPTSTK	180	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2856.5	21.65035	3	2073.871571	2073.873106	K	Q	1127	1145
PSM	APVQPQQSPAAAPGGTDEKPSGK	181	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2768.5	19.50125	3	2297.069171	2297.068906	K	E	9	32
PSM	NNEESPTATVAEQGEDITSKK	182	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3242.5	31.58097	3	2327.016371	2327.016595	K	D	9	30
PSM	TRVSDPISTSESSEEEEEAEAETAKATPR	183	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3283.5	32.63695	4	3215.400894	3215.399086	K	L	76	105
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	184	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3187.6	30.14732	4	4245.542894	4245.543285	K	S	158	195
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	185	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3369.6	34.86828	5	4716.099118	4716.094806	K	A	530	573
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	186	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3800.3	45.88633	4	2644.234494	2644.238156	R	L	55	81
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	187	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3654.5	42.13223	4	2988.152894	2988.155727	K	E	144	170
PSM	EGEEAGPGDPLLEAVPKTGDEK	188	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3538.3	39.21082	3	2317.028171	2317.036268	K	D	353	375
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	189	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3474.4	37.54637	4	3159.347294	3159.347523	R	G	2037	2066
PSM	ELPAAEPVLSPLEGTK	190	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3768.2	45.06278	3	1729.853171	1729.853934	K	M	266	282
PSM	VLLPEYGGTKVVLDDK	191	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3647.3	41.95197	3	1824.930071	1824.927433	K	D	71	87
PSM	DNLTLWTSDQQDDDGGEGNN	192	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3818.4	46.33792	3	2192.867471	2192.873028	R	-	228	248
PSM	YLLSQSSPAPLTAAEEELR	193	sp|Q12792|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4509.2	58.52293	3	2233.985171	2233.990912	K	Q	137	156
PSM	VPADTEVVCAPPTAYIDFAR	194	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4096.3	52.86437	3	2271.025871	2271.028287	K	Q	71	91
PSM	AAVPSGASTGIYEALELRDNDK	195	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4027.2	51.3459	3	2436.054971	2436.061117	R	T	33	55
PSM	QSKPVTTPEEIAQVATISANGDK	196	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3541.6	39.29747	3	2543.145671	2543.155746	K	E	158	181
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	197	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3793.3	45.7115	3	2963.264171	2963.274343	R	T	88	114
PSM	APLATGEDDDDEVPDLVENFDEASKNEAN	198	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4544.2	58.84972	3	3198.293171	3198.303789	K	-	178	207
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	199	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3861.5	47.40738	4	3456.431694	3456.442334	R	-	207	238
PSM	ETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	200	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3846.5	47.02252	4	4312.798894	4312.819359	K	R	722	764
PSM	SAESPTSPVTSETGSTFKK	201	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3270.5	32.29795	3	2100.871271	2099.870128	K	F	280	299
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	202	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3684.6	42.91355	3	3442.3937	3442.4027	K	L	104	135
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	203	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3608.4	40.9781	3	2758.1429	2758.1503	M	D	2	33
PSM	AAPEASSPPASPLQHLLPGK	204	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3810.3	46.13727	3	2128.977971	2126.980288	K	A	686	706
PSM	ADDLDFETGDAGASATFPMQCSALRK	205	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.4185.2	54.28855	3	2895.2053	2895.2087	M	N	2	28
PSM	AAEEAFVNDIDESSPGTEWER	206	sp|P09496-2|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3888.4	48.09797	2	2430.975447	2430.985295	R	V	163	184
PSM	GHTDTEGRPPSPPPTSTPEK	207	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2766.2	19.4513	4	2246.928094	2246.924624	R	C	353	373
PSM	PCSEETPAISPSK	208	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2897.5	22.69318	2	1481.6089	1481.6104	M	R	2	15
PSM	VPSPLEGSEGDGDTD	209	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3285.5	32.68912	2	1553.575847	1553.577043	K	-	413	428
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	210	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3159.5	29.41495	5	4165.732118	4165.736558	K	D	522	558
PSM	ADLNQGIGEPQSPSRR	211	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2965.2	24.43793	3	1803.826571	1803.826490	R	V	63	79
PSM	SGKYDLDFKSPDDPSR	212	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3220.4	31.00388	3	1905.816371	1905.814588	R	Y	254	270
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	213	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3283.3	32.63028	4	2717.308894	2717.307830	R	R	31	56
PSM	KQEETAVLEEDSADWEK	214	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3354.5	34.475	3	2085.873971	2085.877977	K	E	302	319
PSM	PAETPVATSPTATDSTSGDSSR	215	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2895.4	22.639	3	2213.931971	2213.932531	K	S	152	174
PSM	RSEACPCQPDSGSPLPAEEEK	216	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2960.5	24.3217	3	2422.975571	2422.977056	R	R	492	513
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	217	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3219.5	30.98007	3	2742.063371	2742.064016	R	E	424	448
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	218	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3029.5	26.1032	4	3793.548094	3793.546038	K	R	142	179
PSM	EAAGGNDSSGATSPINPAVALE	219	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3781.4	45.39303	3	2106.906071	2106.910674	K	-	1236	1258
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	220	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3465.4	37.32096	4	3159.347294	3159.347523	R	G	2037	2066
PSM	DLADELALVDVIEDK	221	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.5337.2	65.42525	2	1656.837047	1656.845798	K	L	43	58
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	222	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3602.5	40.83208	4	3464.568894	3464.574823	K	E	218	249
PSM	CIPALDSLTPANEDQK	223	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3585.3	40.3807	3	1850.810171	1850.812146	R	I	447	463
PSM	SLSTSGESLYHVLGLDK	224	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4352.2	56.82943	3	1884.885371	1884.887025	R	N	8	25
PSM	DSGPLPTPPGVSLLGEPPK	225	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4246.2	55.08157	3	1936.952171	1936.954711	K	D	482	501
PSM	TIGGGDDSFNTFFSETGAGK	226	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4097.2	52.8898	3	2086.848671	2086.852096	K	H	41	61
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	227	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3716.6	43.74342	3	3014.180171	3014.188484	K	-	661	690
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	228	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3703.6	43.40892	3	3393.341171	3393.345713	K	F	86	114
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	229	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3473.5	37.52437	4	3562.492094	3562.491898	K	V	60	92
PSM	DDDIAALVVDNGSGMCK	230	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4533.2	58.75828	2	1900.7538	1900.7579	M	A	2	19
PSM	MDSAGQDINLNSPNK	231	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3228.3	31.20885	3	1740.7040	1740.7021	-	G	1	16
PSM	PENVAPRSGATAGAAGGR	232	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2718.3	18.4589	3	1717.7882	1717.7892	M	G	2	20
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	233	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3902.2	48.45958	4	2749.2252	2749.2301	-	Y	1	25
PSM	TEWETAAPAVAETPDIK	234	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3952.2	49.60785	3	1949.8612	1949.8654	M	L	2	19
PSM	AAQGVGPGPGSAAPPGLEAAR	235	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3537.3	39.18492	3	1951.9100	1951.9148	M	Q	2	23
PSM	VPPAPVPCPPPSPGPSAVPSSPK	236	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3415.3	36.05252	4	2378.082494	2378.078288	K	S	366	389
PSM	HVPDSGATATAYLCGVK	237	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3412.4	35.97793	3	1825.809071	1825.807001	K	G	110	127
PSM	PCSEETPAISPSK	238	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2889.5	22.48785	2	1481.6089	1481.6104	M	R	2	15
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	239	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3222.4	31.0558	4	2987.320094	2987.319929	R	-	684	712
PSM	DGARPDVTESESGSPEYR	240	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2956.5	24.21497	3	2030.821871	2030.821859	K	Q	425	443
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	241	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3329.6	33.83658	4	4118.434894	4118.435708	K	A	142	177
PSM	DYEEVGADSADGEDEGEEY	242	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3414.6	36.0369	2	2077.737447	2077.739614	K	-	431	450
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	243	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3153.4	29.25605	4	2612.325294	2612.322435	R	Q	24	52
PSM	SHSGVSENDSRPASPSAESDHESER	244	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2631.2	17.51742	4	2733.097694	2733.089988	R	G	1112	1137
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	245	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3385.3	35.26945	4	2853.392494	2853.390968	K	K	62	95
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	246	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2823.2	20.81588	5	3024.356118	3024.356099	K	S	145	174
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	247	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3417.6	36.11133	3	3185.432171	3185.436140	K	-	708	738
PSM	GALQNIIPASTGAAK	248	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3536.5	39.1656	2	1490.744847	1490.749409	R	A	201	216
PSM	DMSPLSETEMALGK	249	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3850.2	47.1251	2	1603.640647	1603.651077	K	D	505	519
PSM	NQLTSNPENTVFDAK	250	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	38.89882	3	1756.766771	1756.766910	K	R	82	97
PSM	CIPALDSLTPANEDQK	251	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3577.2	40.16865	3	1850.810171	1850.812146	R	I	447	463
PSM	NQYDNDVTVWSPQGR	252	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3522.3	38.79515	3	1857.766571	1857.768307	R	I	4	19
PSM	IEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSR	253	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3847.6	47.04858	4	3778.600494	3778.613586	K	A	17	52
PSM	AEELSPAALSPSLEPIR	254	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3983.3	50.28225	3	1938.872471	1938.874092	R	C	441	458
PSM	LDGLVETPTGYIESLPR	255	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4387.2	57.23822	3	1938.930371	1938.933975	R	V	56	73
PSM	LDNVPHTPSSYIETLPK	256	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3680.5	42.80648	3	1989.940271	1989.944874	R	A	45	62
PSM	GSLESPATDVFGSTEEGEK	257	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3710.3	43.58065	3	2018.833571	2018.835777	K	R	331	350
PSM	LSSSEETESTQCCPGSPVAQTESPCDLSSIVEEENTDR	258	sp|Q12802|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:4,13-UNIMOD:4,23-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=1.1.3841.6	46.89432	4	4294.714894	4294.734903	R	S	330	368
PSM	DGYADIVDVLNSPLEGPDQK	259	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4697.2	60.32538	3	2223.990671	2223.993675	K	S	287	307
PSM	QQPPEPEWIGDGESTSPSDK	260	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3512.6	38.54325	3	2262.928571	2262.931803	K	V	7	27
PSM	GFGDLKSPAGLQVLNDYLADK	261	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4636.2	59.80097	3	2300.1065	2300.1085	M	S	2	23
PSM	DNLTLWTSENQGDEGDAGEGEN	262	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3813.3	46.21233	3	2349.944471	2349.946922	R	-	225	247
PSM	VEEQEPELTSTPNFVVEVIK	263	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4281.2	55.59753	3	2366.123471	2366.129440	K	N	155	175
PSM	GRLTPSPDIIVLSDNEASSPR	264	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3821.2	46.39783	3	2383.075271	2383.082187	R	S	117	138
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	265	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.4021.3	51.19117	3	2763.123671	2763.129259	K	D	208	233
PSM	QREEYQPATPGLGMFVEVKDPEDK	266	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3763.5	44.93168	4	2842.286894	2842.288477	K	V	72	96
PSM	VTTEIQLPSQSPVEEQSPASLSSLR	267	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3996.2	50.60097	3	2842.294271	2842.303867	R	S	857	882
PSM	GGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSR	268	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	29-UNIMOD:21	ms_run[1]:scan=1.1.3458.4	37.14172	3	2953.092671	2953.096136	R	G	233	266
PSM	REPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEAR	269	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	15-UNIMOD:4,50-UNIMOD:21	ms_run[1]:scan=1.1.4061.2	52.10853	5	5712.5181	5712.5165	K	D	294	348
PSM	CIPALDSLTPANEDQK	270	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4684.2	60.20493	2	1833.7764	1833.7851	R	I	447	463
PSM	DDDIAALVVDNGSGMCK	271	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4020.2	51.1659	2	1836.7830	1836.7865	M	A	2	19
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	272	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3556.6	39.68117	3	2508.0703	2508.0760	M	R	2	32
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTK	273	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,29-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=1.1.3586.5	40.41345	4	3691.6059	3691.6092	M	S	2	41
PSM	SQEGESVTEDISFLESPNPENK	274	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4011.4	50.93362	3	2516.061371	2515.063940	K	D	81	103
PSM	RTEGVGPGVPGEVEMVK	275	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3351.3	34.39032	3	1819.851071	1819.853951	R	G	16	33
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	276	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3341.3	34.13633	4	2621.139694	2621.141158	K	I	50	74
PSM	PCSEETPAISPSK	277	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2880.5	22.26943	2	1481.6089	1481.6104	M	R	2	15
PSM	VPSPLEGSEGDGDTD	278	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3293.3	32.8902	2	1553.575847	1553.577043	K	-	413	428
PSM	APVQPQQSPAAAPGGTDEKPSGK	279	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2776.2	19.69202	4	2297.072894	2297.068906	K	E	9	32
PSM	SETSVANGSQSESSVSTPSASFEPNNTCENSQSR	280	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3230.6	31.27028	4	3641.470094	3641.469702	K	N	117	151
PSM	HVPDSGATATAYLCGVK	281	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3401.4	35.69052	3	1825.809071	1825.807001	K	G	110	127
PSM	SSGSPYGGGYGSGGGSGGYGSR	282	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3010.5	25.6156	3	1989.747071	1989.749028	R	R	355	377
PSM	EFQDAGEQVVSSPADVAEK	283	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3377.4	35.06536	3	2084.895071	2084.893961	K	A	77	96
PSM	QEEEAAQQGPVVVSPASDYK	284	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3239.4	31.49915	3	2210.974271	2210.973274	R	D	145	165
PSM	AGEEDEGEEDSDSDYEISAK	285	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3118.6	28.35882	3	2253.795071	2253.795823	R	A	463	483
PSM	SQSPAASDCSSSSSSASLPSSGR	286	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2866.6	21.90833	3	2278.896071	2278.900914	R	S	171	194
PSM	YRDVAECGPQQELDLNSPR	287	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3366.6	34.79025	3	2326.003571	2326.004926	K	N	102	121
PSM	QPATPTAAESSEGEGEEGDDGGETESR	288	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2887.3	22.44172	3	2772.048371	2772.051931	K	E	82	109
PSM	AQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSR	289	sp|Q9NRR5|UBQL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3160.6	29.44412	4	4489.954894	4489.963063	K	R	88	137
PSM	GALQNIIPASTGAAK	290	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3528.5	38.95758	2	1490.744847	1490.749409	R	A	201	216
PSM	LGGSAVISLEGKPL	291	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4072.3	52.37322	2	1499.698647	1499.703779	K	-	153	167
PSM	QQPPEPEWIGDGESTSPSDK	292	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3504.5	38.3313	3	2262.928571	2262.931803	K	V	7	27
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	293	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3456.5	37.09248	4	3265.400494	3265.402471	K	-	708	738
PSM	DISSDAFTALDPLGDK	294	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4520.2	58.63455	2	1743.755247	1743.760428	K	E	631	647
PSM	SESETESEASEITIPPSTPAVPQAPVQGEDYGK	295	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3677.5	42.72838	4	3509.554094	3509.561066	R	G	530	563
PSM	KYEQGFITDPVVLSPK	296	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3696.3	43.21665	3	1899.938471	1899.938332	K	D	109	125
PSM	PEIVDTCSLASPASVCR	297	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3538.2	39.20749	3	1940.8346	1940.8368	M	T	2	19
PSM	GLSLVDKENTPPALSGTR	298	sp|P31350|RIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3488.5	37.91543	3	2013.915671	2013.917353	K	V	24	42
PSM	SSSPAPADIAQTVQEDLR	299	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3785.3	45.49669	3	2043.849971	2043.855147	K	T	230	248
PSM	DQLIYNLLKEEQTPQNK	300	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3986.2	50.34982	3	2153.038271	2153.040566	K	I	6	23
PSM	IADPEHDHTGFLTEYVATR	301	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3455.2	37.0569	4	2250.997694	2250.994678	R	W	190	209
PSM	TLEAEFNSPSPPTPEPGEGPR	302	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3563.3	39.85375	3	2367.956471	2367.966154	K	K	525	546
PSM	QSKPVTTPEEIAQVATISANGDK	303	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3503.6	38.30845	3	2463.184871	2463.189415	K	E	158	181
PSM	DNLTLWTADNAGEEGGEAPQEPQS	304	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4107.2	53.0918	3	2608.053671	2608.060251	R	-	225	249
PSM	RPPEPTTPWQEDPEPEDENLYEK	305	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3494.6	38.07478	3	2875.218371	2875.222566	K	N	47	70
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	306	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3824.4	46.46302	3	2881.086671	2881.094982	K	T	701	725
PSM	MLAESDESGDEESVSQTDKTELQNTLR	307	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3551.6	39.55008	3	3091.307171	3091.317665	K	T	186	213
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	308	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4,20-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3686.4	42.96607	4	3544.533694	3544.541154	K	E	218	249
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	309	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:35,17-UNIMOD:21	ms_run[1]:scan=1.1.3746.5	44.50543	4	3552.394894	3552.403580	R	-	207	238
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	310	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3683.5	42.88458	4	3442.3944	3442.4027	K	L	104	135
PSM	EEEIAALVIDNGSGMCK	311	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5388.2	65.75643	3	1956.8153	1956.8205	M	A	2	19
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	312	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3582.6	40.31255	3	2508.0733	2508.0760	M	R	2	32
PSM	MDSAGQDINLNSPNK	313	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3528.6	38.96092	2	1724.7026	1724.7072	-	G	1	16
PSM	ADDLDFETGDAGASATFPMQCSALRK	314	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.4169.3	54.06655	3	2895.2053	2895.2087	M	N	2	28
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	315	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3705.6	43.46127	3	2882.1601	2882.1618	M	D	2	29
PSM	MEAAGSPAATETGK	316	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3067.2	27.05753	2	1441.5761	1441.5791	-	Y	1	15
PSM	VPPAPVPCPPPSPGPSAVPSSPK	317	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3401.3	35.68718	4	2378.082494	2378.078288	K	S	366	389
PSM	HQGVMVGMGQKDSYVGDEAQSK	318	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3129.2	28.62762	4	2430.040494	2430.034511	R	R	42	64
PSM	SQDATFSPGSEQAEKSPGPIVSR	319	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3194.4	30.32377	4	2454.112494	2454.106414	R	T	329	352
PSM	SFEAPATINSASLHPEK	320	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3392.5	35.45882	3	1877.856671	1877.856059	K	E	219	236
PSM	SSSSVTTSETQPCTPSSSDYSDLQR	321	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3221.6	31.03593	4	2786.125294	2786.122594	K	V	322	347
PSM	GVQVETISPGDGR	322	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3117.4	28.32652	2	1393.6223	1393.6233	M	T	2	15
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	323	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3029.3	26.09653	4	2968.359694	2968.358028	R	L	420	447
PSM	DMESPTKLDVTLAK	324	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	33.53718	3	1642.751471	1642.752506	K	D	277	291
PSM	GEPAAAAAPEAGASPVEK	325	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2936.4	23.69295	3	1701.763571	1701.761096	K	E	88	106
PSM	MDATANDVPSPYEVR	326	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	34.75152	3	1743.717071	1743.717517	K	G	434	449
PSM	LSESSALKQPATPTAAESSEGEGEEGDDGGETESR	327	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3124.6	28.51407	4	3587.497294	3587.490814	R	E	74	109
PSM	RADLNQGIGEPQSPSR	328	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2957.5	24.24073	3	1803.825971	1803.826490	R	R	62	78
PSM	SGKYDLDFKSPDDPSR	329	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3228.2	31.20552	4	1905.816894	1905.814588	R	Y	254	270
PSM	NHSDSSTSESEVSSVSPLK	330	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3005.4	25.48177	3	2055.862871	2055.863389	K	N	211	230
PSM	PAEKPAETPVATSPTATDSTSGDSSR	331	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2876.6	22.16643	3	2639.154671	2639.159965	K	S	148	174
PSM	PAEKPAETPVATSPTATDSTSGDSSR	332	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2836.6	21.1474	3	2719.122371	2719.126296	K	S	148	174
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	333	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	20-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3352.6	34.42624	3	2991.321971	2991.328110	R	V	221	251
PSM	TRVSDPISTSESSEEEEEAEAETAKATPR	334	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3275.5	32.42828	4	3215.400894	3215.399086	K	L	76	105
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	335	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3360.5	34.6319	4	3223.225694	3223.230486	K	-	122	148
PSM	DKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQR	336	sp|Q8N7H5|PAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3102.5	27.93883	5	4505.730618	4505.722755	R	S	449	493
PSM	GPPQSPVFEGVYNNSR	337	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3507.2	38.41253	3	1826.797571	1826.798879	K	M	107	123
PSM	DATNVGDEGGFAPNILENK	338	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3729.6	44.08275	3	1959.916271	1959.917400	K	E	203	222
PSM	SAGVQCFGPTAEAAQLESSK	339	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3664.3	42.38448	3	2116.910171	2116.913651	R	R	88	108
PSM	VEEQEPELTSTPNFVVEVIKNDDGKK	340	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3963.3	49.8564	4	3023.438494	3023.437644	K	A	155	181
PSM	IADPEHDHTGFLTEYVATR	341	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3577.6	40.18198	3	2330.955671	2330.961009	R	W	190	209
PSM	ISMQDVDLSLGSPK	342	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3871.4	47.6685	2	1568.711447	1568.715726	K	L	500	514
PSM	DMSPLSETEMALGK	343	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4060.3	52.07612	2	1587.653247	1587.656162	K	D	505	519
PSM	VGIDTPDIDIHGPEGK	344	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3460.3	37.19003	3	1741.792571	1741.792396	K	L	4560	4576
PSM	ASLGSLEGEAEAEASSPK	345	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3617.2	41.19627	2	1811.773447	1811.782620	K	G	5748	5766
PSM	QGAIVAVTGDGVNDSPALK	346	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3477.3	37.62043	3	1890.908471	1890.908823	R	K	708	727
PSM	LDNVPHTPSSYIETLPK	347	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3688.3	43.0084	3	1989.940271	1989.944874	R	A	45	62
PSM	SSSPAPADIAQTVQEDLR	348	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3777.3	45.2897	3	2043.849971	2043.855147	K	T	230	248
PSM	FSGWYDADLSPAGHEEAK	349	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3640.3	41.7707	3	2058.837071	2058.836052	R	R	22	40
PSM	DNLTLWTSDQQDDDGGEGNN	350	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3845.4	46.99068	3	2192.864171	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	351	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3837.3	46.7912	3	2192.864171	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	352	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3853.3	47.20298	3	2192.864171	2192.873028	R	-	228	248
PSM	TDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEAR	353	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:4,38-UNIMOD:21	ms_run[1]:scan=1.1.4494.3	58.33052	4	4390.902894	4390.915962	R	D	307	349
PSM	SCEGQNPELLPKTPISPLK	354	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3635.4	41.64393	3	2267.026571	2267.031003	K	T	308	327
PSM	GFFICDQPYEPVSPYSCK	355	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4041.2	51.65313	3	2272.916471	2272.921045	R	E	676	694
PSM	SGSSSPDSEITELKFPSINHD	356	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3900.4	48.40105	3	2325.994271	2326.000217	R	-	571	592
PSM	DSGSDEDFLMEDDDDSDYGSSK	357	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3481.6	37.73553	3	2443.856471	2443.860534	K	K	129	151
PSM	QSKPVTTPEEIAQVATISANGDK	358	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3511.5	38.51372	3	2463.184871	2463.189415	K	E	158	181
PSM	DAEAHPWLSDYDDLTSATYDK	359	sp|P50542|PEX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3991.4	50.46538	3	2492.001371	2492.005696	R	G	302	323
PSM	GAAAAATGQPGTAPAGTPGAPPLAGMAIVK	360	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3966.4	49.93375	3	2731.274471	2731.280569	R	E	525	555
PSM	DSSEESDSSEESDIDSEASSALFMAK	361	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3994.3	50.5496	3	2832.062471	2832.069221	K	K	340	366
PSM	RPPEPTTPWQEDPEPEDENLYEK	362	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3486.6	37.86628	3	2875.218371	2875.222566	K	N	47	70
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	363	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3708.6	43.53937	3	3014.180171	3014.188484	K	-	661	690
PSM	FSDCWNTEGSYDCVCSPGYEPVSGAK	364	sp|Q9UHX3|AGRE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3761.6	44.88397	3	3051.131171	3051.139841	K	T	82	108
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	365	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3464.4	37.29635	4	3562.492094	3562.491898	K	V	60	92
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	366	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4285.3	55.67933	4	3681.629294	3681.639334	K	K	213	250
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	367	sp|Q12906-4|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3753.6	44.68145	4	4535.102894	4535.111625	R	Q	475	520
PSM	DKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	368	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3756.6	44.7587	4	4555.938894	4555.941265	K	R	720	764
PSM	CIPALDSLTPANEDQK	369	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4707.2	60.40832	2	1833.7764	1833.7851	R	I	447	463
PSM	EEEIAALVIDNGSGMCK	370	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4902.2	62.25487	3	1972.8119	1972.8154	M	A	2	19
PSM	GGNFGGRSSGPYGGGGQYFAK	371	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3318.5	33.54718	3	2099.883071	2099.885068	K	P	278	299
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	372	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3536.3	39.15893	4	2508.0735	2508.0760	M	R	2	32
PSM	AAPEASSPPASPLQHLLPGK	373	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	46.5773	3	2128.978571	2126.980288	K	A	686	706
PSM	ASGVAVSDGVIK	374	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3548.3	39.46315	2	1223.5750	1223.5794	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	375	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3954.5	49.66023	3	2750.2202	2749.2302	-	Y	1	25
PSM	AGAGSAAVSGAGTPVAGPTGR	376	sp|O95295|SNAPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3162.3	29.48547	3	1832.8427	1832.8413	M	D	2	23
PSM	FSISPDEDSSSYSSNSDFNYSYPTK	377	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3843.5	46.9461	3	2903.121671	2903.133476	R	Q	9	34
PSM	SGPDVETPSAIQICR	378	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3674.5	42.65	2	1750.7531	1750.7592	M	I	2	17
PSM	ADEDLIFRLEGVDGGQSPR	379	sp|O00418|EF2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.4792.2	61.27538	3	2194.9883	2194.9891	M	A	2	21
PSM	GHTDTEGRPPSPPPTSTPEK	380	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2758.2	19.25127	4	2246.928094	2246.924624	R	C	353	373
PSM	MDATANDVPSPYEVR	381	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3365.3	34.75485	3	1743.717071	1743.717517	K	G	434	449
PSM	EALQDVEDENQ	382	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3093.5	27.70448	2	1288.540047	1288.541905	K	-	245	256
PSM	GVQVETISPGDGR	383	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3109.6	28.12538	2	1393.6223	1393.6233	M	T	2	15
PSM	GILAADESTGSIAK	384	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3241.4	31.5514	2	1411.658247	1411.659591	K	R	29	43
PSM	SSGPYGGGGQYFAK	385	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3292.3	32.86428	2	1454.585247	1454.586761	R	P	285	299
PSM	KLEDVKNSPTFK	386	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2898.3	22.71247	3	1484.727671	1484.727611	K	S	164	176
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	387	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3317.4	33.51805	4	2994.258094	2994.261530	K	A	106	138
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	388	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3372.4	34.93817	6	4716.098541	4716.094806	K	A	530	573
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	389	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3277.6	32.48367	4	3173.246094	3173.243468	R	-	738	768
PSM	KAEAGAGSATEFQFR	390	sp|Q9NQ39|RS10L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3247.2	31.70122	3	1648.728371	1648.724651	K	G	150	165
PSM	TPKTPKGPSSVEDIK	391	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2907.3	22.94403	3	1662.822371	1662.822968	K	A	234	249
PSM	MDATANDVPSPYEVR	392	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3357.3	34.54673	3	1743.717071	1743.717517	K	G	434	449
PSM	SGKYDLDFKSPDDPSR	393	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3215.2	30.86593	4	1905.816894	1905.814588	R	Y	254	270
PSM	NIGRDTPTSAGPNSFNK	394	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3045.3	26.49878	3	1934.791271	1934.792487	K	G	134	151
PSM	NVSSFPDDATSPLQENR	395	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3424.5	36.27588	3	1955.827871	1955.826216	R	N	52	69
PSM	VKLESPTVSTLTPSSPGK	396	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3364.4	34.73269	3	1986.929171	1986.931606	R	L	290	308
PSM	VTAEADSSSPTGILATSESK	397	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3364.5	34.73602	3	2029.906871	2029.909277	K	S	486	506
PSM	IACKSPPPESVDTPTSTK	398	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2848.3	21.44083	3	2073.871571	2073.873106	K	Q	1127	1145
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	399	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3220.6	31.01055	4	4431.610894	4431.610713	K	A	139	177
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	400	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3408.6	35.88025	3	2574.222371	2574.222781	K	K	453	479
PSM	NGSLDSPGKQDTEEDEEEDEKDK	401	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2812.6	20.54505	3	2673.039971	2673.045055	K	G	134	157
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	402	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,24-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=1.1.3328.6	33.81102	3	3120.086171	3120.091253	R	E	92	118
PSM	NPDDITQEEYGEFYK	403	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3582.2	40.29922	3	1846.789571	1846.789740	R	S	292	307
PSM	KYEQGFITDPVVLSPK	404	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3688.2	43.00507	3	1899.938471	1899.938332	K	D	109	125
PSM	ERPTPSLNNNCTTSEDSLVLYNR	405	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3503.3	38.29845	4	2759.218094	2759.222189	K	V	734	757
PSM	SATLSSTESTASEMQEEMK	406	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3613.4	41.10118	3	2125.846871	2125.843247	K	G	640	659
PSM	GYISPYFINTSK	407	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3852.4	47.1704	2	1468.658847	1468.663948	R	G	222	234
PSM	GYISPYFINTSK	408	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3868.3	47.58405	2	1468.658847	1468.663948	R	G	222	234
PSM	AEAGAGSATEFQFR	409	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3454.4	37.03757	2	1520.626847	1520.629688	K	G	151	165
PSM	GYISPYFINTSK	410	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4005.3	50.77112	2	1548.626847	1548.630279	R	G	222	234
PSM	GYISPYFINTSK	411	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4013.2	50.97515	2	1548.628247	1548.630279	R	G	222	234
PSM	EAAFGGGLLSPGPEAT	412	sp|Q01201|RELB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4065.3	52.20658	2	1552.679247	1552.681055	R	-	564	580
PSM	DSPESPFEVIIDK	413	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4118.2	53.31922	2	1554.682247	1554.685472	K	A	242	255
PSM	IFVGGLSPDTPEEK	414	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3530.6	39.0128	2	1567.709847	1567.717106	K	I	184	198
PSM	DDGLFSGDPNWFPK	415	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4847.2	61.7361	2	1673.671847	1673.676304	R	K	140	154
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	416	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,29-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3885.5	48.02365	4	3717.595294	3717.611813	R	V	592	630
PSM	WLDDLLASPPPSGGGAR	417	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4632.2	59.72798	3	1867.789871	1867.790696	R	R	684	701
PSM	EKEPSYPMPVQETQAPESPGENSEQALQTLSPR	418	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	23-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3734.6	44.21202	4	3813.640094	3813.648198	R	A	135	168
PSM	TIGGGDDSFNTFFSETGAGK	419	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4059.2	52.05725	3	2086.853171	2086.852096	K	H	41	61
PSM	QEQINTEPLEDTVLSPTK	420	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3710.4	43.58398	3	2120.986271	2120.987861	K	K	271	289
PSM	LYGPSSVSFADDFVRSSK	421	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3978.2	50.171	3	2120.883371	2120.885719	R	Q	134	152
PSM	DLLLTSSYLSDSGSTGEHTK	422	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3772.3	45.15988	3	2189.971271	2189.972940	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	423	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3828.3	46.55623	3	2192.867471	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	424	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3561.3	39.79582	3	2195.923571	2195.927707	R	E	226	245
PSM	EINAREESLVEELSPASEK	425	sp|Q9BXK5|B2L13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3523.4	38.82393	3	2209.010471	2209.015139	K	K	413	432
PSM	VPPAPVPCPPPSPGPSAVPSSPK	426	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3451.6	36.96589	3	2378.076371	2378.078288	K	S	366	389
PSM	DYEIESQNPLASPTNTLLGSAK	427	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4136.3	53.56977	3	2427.113771	2427.120667	K	E	618	640
PSM	AIVDALPPPCESACTVPTDVDK	428	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3672.6	42.6016	3	2434.075271	2434.079730	R	W	261	283
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	429	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4091.4	52.73657	3	2540.084471	2540.089049	K	S	180	204
PSM	TEELIESPKLESSEGEIIQTVDR	430	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3938.5	49.30013	3	2681.270471	2681.268453	K	Q	602	625
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	431	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	18-UNIMOD:21,21-UNIMOD:35	ms_run[1]:scan=1.1.3539.5	39.24327	3	2851.258271	2851.269533	R	T	350	376
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	432	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3833.5	46.68963	3	2881.086671	2881.094982	K	T	701	725
PSM	VSTTTDSPVSPAQAASPFIPLDELSSK	433	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4634.3	59.76948	3	2904.299771	2904.308283	K	-	261	288
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	434	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3580.6	40.26052	4	3199.392094	3199.394275	K	N	213	241
PSM	TASTPTPPQTGGGLEPQANGETPQVAVIVRPDDR	435	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3606.2	40.93585	4	3535.693694	3535.694421	R	S	202	236
PSM	IEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSR	436	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3736.6	44.26257	4	3698.642894	3698.647255	K	A	17	52
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	437	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3594.4	40.61937	3	2588.0387	2588.0424	M	R	2	32
PSM	MDSAGQDINLNSPNK	438	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3236.5	31.42395	2	1740.6998	1740.7021	-	G	1	16
PSM	AESSESFTMASSPAQR	439	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3204.6	30.59103	2	1822.7088	1822.7076	M	R	2	18
PSM	MEGPLSVFGDR	440	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5164.2	64.30233	2	1328.5433	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	441	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5105.2	63.87867	2	1328.5433	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	442	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5134.2	64.07874	2	1328.5433	1328.5467	-	S	1	12
PSM	YLLSQSSPAPLTAAEEELR	443	sp|Q12792|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4176.2	54.15199	3	2154.020771	2154.024581	K	Q	137	156
PSM	SDEFSLADALPEHSPAK	444	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3998.2	50.6431	3	1934.8307	1934.8294	M	T	2	19
PSM	STGCDFAVSPK	445	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	27.8774	2	1247.488847	1247.489355	K	L	501	512
PSM	TFDQLTPEESK	446	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3138.4	28.86645	2	1373.574847	1373.575193	K	E	60	71
PSM	MDSTANEVEAVK	447	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.2885.3	22.39287	2	1388.554647	1388.553078	K	V	425	437
PSM	DQMEGSPNSSESFEHIAR	448	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3195.4	30.34947	3	2115.821771	2115.820479	R	S	774	792
PSM	NQSPVDQGATGASQGLLDRK	449	sp|P18827|SDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3188.3	30.16303	3	2120.985371	2120.985176	R	E	231	251
PSM	AQAAAPASVPAQAPK	450	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2903.2	22.83773	3	1456.707971	1456.707544	K	R	135	150
PSM	GEATVSFDDPPSAK	451	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3217.6	30.93138	2	1499.617647	1499.618120	K	A	335	349
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	452	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3389.6	35.38397	4	3044.155294	3044.151982	K	L	595	622
PSM	ELAQRQEEEAAQQGPVVVSPASDYKDK	453	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3189.4	30.19262	4	3051.422094	3051.418640	K	Y	140	167
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	454	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3368.5	34.83865	4	3223.225694	3223.230486	K	-	122	148
PSM	TRVSDPISTSESSEEEEEAEAETAKATPR	455	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	23-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.3197.6	30.40813	4	3295.366894	3295.365417	K	L	76	105
PSM	KAEAGAGSATEFQFR	456	sp|Q9NQ39|RS10L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3255.2	31.90607	3	1648.728371	1648.724651	K	G	150	165
PSM	GQAAVQQLQAEGLSPR	457	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3346.3	34.26152	3	1731.829571	1731.830513	R	F	43	59
PSM	SADGSAPAGEGEGVTLQR	458	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3096.4	27.77902	3	1780.765571	1780.762887	K	N	31	49
PSM	EVNVSPCPTQPCQLSK	459	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3148.2	29.12047	3	1922.829371	1922.826750	K	G	36	52
PSM	DSENLASPSEYPENGER	460	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3201.4	30.5062	3	1972.770071	1972.768760	R	F	617	634
PSM	GNSRPGTPSAEGGSTSSTLR	461	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2806.3	20.39227	3	1997.876771	1997.880377	R	A	383	403
PSM	TPSPKEEDEEPESPPEK	462	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2808.3	20.43637	3	2003.821871	2003.824878	K	K	202	219
PSM	SQSLPNSLDYTQTSDPGR	463	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3417.3	36.10133	3	2044.875671	2044.873894	R	H	44	62
PSM	NQKPSQVNGAPGSPTEPAGQK	464	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2745.2	18.93578	3	2170.999871	2171.000826	K	Q	1255	1276
PSM	YNLQEVVKSPKDPSQLNSK	465	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3308.2	33.27568	4	2253.105694	2253.104229	K	Q	262	281
PSM	IVRGDQPAASGDSDDDEPPPLPR	466	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3179.4	29.9315	3	2483.090771	2483.096577	K	L	45	68
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	467	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3295.6	32.9523	3	2494.091471	2494.089063	R	L	815	839
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	468	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3341.6	34.14633	3	2621.136671	2621.141158	K	I	50	74
PSM	KAEGAATEEEGTPKESEPQAAAEPAEAK	469	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2836.5	21.14407	4	2905.288094	2905.286622	K	E	25	53
PSM	AEKQEDSESSEEESDSEEAAASPAQVK	470	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2864.5	21.85652	3	2946.175871	2946.177526	K	T	756	783
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	471	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2825.2	20.86225	5	3024.356118	3024.356099	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	472	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2793.2	20.0755	5	3104.324118	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	473	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2791.5	20.03708	5	3104.324118	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	474	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2795.2	20.12367	5	3104.324118	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	475	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2792.3	20.05462	5	3104.324118	3104.322430	K	S	145	174
PSM	EVYELLDSPGK	476	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3566.3	39.89705	2	1328.585647	1328.590115	K	V	20	31
PSM	DSGFTIVSPLDI	477	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5816.2	68.8	2	1342.599047	1342.605765	K	-	784	796
PSM	SILSPGGSCGPIK	478	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3475.4	37.57225	2	1351.618447	1351.620704	R	V	207	220
PSM	LDIDSPPITAR	479	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3534.3	39.10682	2	1356.568447	1356.572764	R	N	33	44
PSM	ILATPPQEDAPSVDIANIR	480	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3962.4	49.83098	3	2178.991271	2178.996332	K	M	284	303
PSM	GYISPYFINTSK	481	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3860.3	47.37483	2	1468.658847	1468.663948	R	G	222	234
PSM	GASSPLITVFTDDK	482	sp|Q15155|NOMO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3997.3	50.62722	2	1529.697447	1529.701456	K	G	822	836
PSM	GYISPYFINTSK	483	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3995.2	50.56497	2	1548.626847	1548.630279	R	G	222	234
PSM	MLAESDESGDEESVSQTDKTELQNTLR	484	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3689.5	43.04087	4	3171.279294	3171.283996	K	T	186	213
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQRK	485	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3810.4	46.1406	4	3199.444494	3199.444580	K	F	139	167
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	486	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3585.6	40.3907	4	3246.382894	3246.383770	K	V	233	262
PSM	APSEEDSLSSVPISPYKDEPWK	487	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3770.6	45.1155	3	2540.130371	2540.135982	K	Y	36	58
PSM	VTNGAFTGEISPGMIK	488	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3759.6	44.83413	2	1700.780847	1700.784474	K	D	107	123
PSM	VTNGAFTGEISPGMIK	489	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3866.6	47.53922	2	1780.744647	1780.750805	K	D	107	123
PSM	SASYKYSEEANNLIEECEQAER	490	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3752.4	44.64987	3	2699.102771	2699.105821	K	L	115	137
PSM	SESVPPVTDWAWYK	491	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4487.2	58.24608	3	1823.716571	1823.720885	K	I	244	258
PSM	SATSSSPGSPLHSLETSL	492	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3973.5	50.07805	2	1836.810247	1836.814254	K	-	1203	1221
PSM	NQYDNDVTVWSPQGR	493	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3514.2	38.58257	3	1857.766571	1857.768307	R	I	4	19
PSM	FSGWYDADLSPAGHEEAK	494	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3632.2	41.56218	3	2058.837071	2058.836052	R	R	22	40
PSM	SSVSRVPCNVEGISPELEK	495	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3443.4	36.75178	3	2166.000071	2166.002800	K	V	290	309
PSM	SGEEDFESLASQFSDCSSAK	496	sp|Q13526|PIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.4134.3	53.51855	3	2259.847871	2259.851504	K	A	98	118
PSM	DLYANTVLSGGTTMYPGIADR	497	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4135.2	53.54067	3	2294.025971	2294.029015	K	M	292	313
PSM	SPWSNKYDPPLEDGAMPSAR	498	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3585.4	40.38403	3	2296.980671	2296.982399	R	L	73	93
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	499	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3715.4	43.71102	3	2556.078071	2556.083964	K	S	180	204
PSM	SSSSESEDEDVIPATQCLTPGIR	500	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3665.5	42.41656	3	2557.082771	2557.089109	R	T	996	1019
PSM	SSSSESEDEDVIPATQCLTPGIR	501	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3673.6	42.62718	3	2557.082771	2557.089109	R	T	996	1019
PSM	ASYHFSPEELDENTSPLLGDAR	502	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4031.2	51.40273	3	2607.055571	2607.056760	K	F	262	284
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	503	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3689.6	43.0442	3	2835.269171	2835.274618	R	T	350	376
PSM	PVQETQAPESPGENSEQALQTLSPR	504	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3519.6	38.72662	3	2852.2162	2852.2262	M	A	2	27
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	505	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3569.5	39.97947	3	2964.312371	2964.313840	K	-	178	207
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	506	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4259.3	55.26575	4	3681.629294	3681.639334	K	K	213	250
PSM	VQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVK	507	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3624.6	41.37865	4	3939.724094	3939.727022	K	D	2008	2043
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	508	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3561.6	39.80582	4	4267.646894	4267.667337	K	L	164	202
PSM	LYGSAGPPPTGEEDTAEKDEL	509	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3443.5	36.75512	3	2255.955371	2254.951870	K	-	634	655
PSM	MQESPKLPQQSYNFDPDTCDESVDPFK	510	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3916.3	48.79732	4	3281.348894	3281.357027	K	T	2356	2383
PSM	AESSESFTMASSPAQR	511	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3462.2	37.23927	3	1806.7123	1806.7126	M	R	2	18
PSM	MEGPLSVFGDR	512	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4265.2	55.38945	2	1344.5367	1344.5416	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	513	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3903.3	48.4855	4	2749.2252	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	514	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3899.2	48.37125	4	2749.2252	2749.2301	-	Y	1	25
PSM	AMSTTSISSPQPGK	515	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.2748.2	19.02068	2	1486.635447	1486.637476	R	L	267	281
PSM	SQEGESVTEDISFLESPNPENK	516	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4001.2	50.71773	3	2516.061371	2515.063940	K	D	81	103
PSM	TFDQLTPDESK	517	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3126.5	28.56243	2	1359.559447	1359.559543	K	E	71	82
PSM	GGNFGGRSSGPYGGGGQYFAK	518	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3311.3	33.35795	4	2099.887294	2099.885068	K	P	278	299
PSM	DKVDKSAVGFEYQGK	519	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3056.3	26.7833	3	1749.795971	1749.797482	K	T	204	219
PSM	SADGSAPAGEGEGVTLQR	520	sp|Q01650|LAT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3104.2	27.98127	3	1780.765571	1780.762887	K	N	31	49
PSM	TREAQQALGSAAADATEAK	521	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3191.3	30.24192	3	1967.889971	1967.894964	K	N	1405	1424
PSM	TPKGPSSVEDIK	522	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2951.2	24.07515	3	1336.628771	1336.627563	K	A	237	249
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	523	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3161.4	29.46297	4	2712.264494	2712.264371	K	T	139	165
PSM	EVDEQMLNVQNK	524	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3187.3	30.13732	2	1445.681247	1445.682044	K	N	325	337
PSM	SISQSSTDSYSSAASYTDSSDDEVSPREK	525	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3203.4	30.55818	4	3165.284094	3165.278302	R	Q	66	95
PSM	LTFDSSFSPNTGKK	526	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3369.2	34.85495	3	1607.722271	1607.723254	K	N	97	111
PSM	RTEGYAAFQEDSSGDEAESPSK	527	sp|Q15311|RBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3142.6	28.97705	3	2439.972971	2439.970374	K	M	81	103
PSM	AAGSPSSSDQDEKLPGQDESTAGTSEQNDILK	528	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3344.5	34.21785	4	3341.443294	3341.442014	K	V	184	216
PSM	IGRIEDVTPIPSDSTR	529	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3314.5	33.44307	3	1914.847271	1914.848939	K	R	126	142
PSM	GPSTPKSPGASNFSTLPK	530	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3280.3	32.55187	3	1931.841971	1931.843126	R	I	223	241
PSM	NIGRDTPTSAGPNSFNK	531	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3053.4	26.70812	3	1934.791271	1934.792487	K	G	134	151
PSM	ADSGPTQPPLSLSPAPETK	532	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3419.5	36.1566	3	1971.922571	1971.919054	R	R	2071	2090
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	533	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	34-UNIMOD:35	ms_run[1]:scan=1.1.3120.6	28.4103	4	4134.430894	4134.430623	K	A	142	177
PSM	TVGTPIASVPGSTNTGTVPGSEK	534	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3316.6	33.49873	3	2236.060571	2236.062423	R	D	270	293
PSM	GSLAEAVGSPPPAATPTPTPPTR	535	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3401.6	35.69718	3	2331.051071	2331.054910	R	K	446	469
PSM	SSSNDSVDEETAESDTSPVLEK	536	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3210.5	30.74558	3	2404.966571	2404.964285	K	E	400	422
PSM	SVTSNQSDGTQESCESPDVLDR	537	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3158.5	29.38868	3	2489.981171	2489.985372	R	H	346	368
PSM	HTPNTSDNEGSDTEVCGPNSPSK	538	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.2763.3	19.37628	3	2508.969971	2508.970056	K	R	970	993
PSM	EEGSSDEISSGVGDSESEGLNSPVK	539	sp|P52701|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3299.5	33.05283	3	2574.055271	2574.049412	K	V	271	296
PSM	HARPPDPPASAPPDSSSNSASQDTK	540	sp|Q15642|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2750.2	19.0604	4	2596.118094	2596.119103	R	E	486	511
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	541	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3095.6	27.76013	4	3365.452094	3365.451593	K	K	799	833
PSM	AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK	542	sp|Q9UNF1|MAGD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2992.6	25.1518	4	3657.570094	3657.570402	K	V	138	172
PSM	AIVDALPPPCESACTVPTDVDK	543	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3656.2	42.17253	4	2434.077694	2434.079730	R	W	261	283
PSM	YFEADPPGQVAASPDPTT	544	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3517.4	38.6677	3	1941.806771	1941.803355	R	-	157	175
PSM	EVYELLDSPGK	545	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3557.3	39.69707	2	1328.585647	1328.590115	K	V	20	31
PSM	DSGFTIVSPLDI	546	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5785.2	68.59418	2	1342.599047	1342.605765	K	-	784	796
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	547	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3578.4	40.2015	4	2756.196894	2756.199676	K	E	296	321
PSM	DNALLSAIEESR	548	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4266.2	55.42495	2	1396.621447	1396.623540	K	K	107	119
PSM	GSMSDGSYSPDYSLAAVDLK	549	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3915.2	48.76822	3	2141.884271	2141.886433	K	S	479	499
PSM	DVSPDLSCADEISECYHK	550	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3531.3	39.02905	3	2203.838471	2203.843917	K	L	53	71
PSM	GNPTVEVDLFTSK	551	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3766.6	45.01212	2	1485.671447	1485.675241	R	G	16	29
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	552	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3667.3	42.46245	4	2972.320494	2972.324602	K	Q	178	204
PSM	DMSPLSETEMALGK	553	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4069.4	52.29777	2	1587.653247	1587.656162	K	D	505	519
PSM	LTESPCALVASQYGWSGNMER	554	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.4019.2	51.13992	3	2435.032271	2435.028697	R	I	640	661
PSM	RASGQAFELILSPR	555	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3729.2	44.06942	3	1623.812471	1623.813407	K	S	14	28
PSM	QSKPVTTPEEIAQVATISANGDK	556	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3601.6	40.80967	3	2463.186071	2463.189415	K	E	158	181
PSM	IFVGGLSPDTPEEK	557	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3700.4	43.32458	2	1647.681047	1647.683437	K	I	184	198
PSM	NQLTSNPENTVFDAK	558	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3518.3	38.68997	3	1756.766771	1756.766910	K	R	82	97
PSM	KIFVGGLSPDTPEEK	559	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3549.2	39.48517	3	1775.773871	1775.778400	K	I	183	198
PSM	GPPQSPVFEGVYNNSR	560	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3523.2	38.81727	3	1826.799971	1826.798879	K	M	107	123
PSM	WLDDLLASPPPSGGGAR	561	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4679.2	60.15463	3	1867.789871	1867.790696	R	R	684	701
PSM	NSDVLQSPLDSAARDEL	562	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3873.2	47.70702	3	1908.845471	1908.846617	K	-	606	623
PSM	DTMSDQALEALSASLGTR	563	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4355.2	56.8583	3	1944.849671	1944.849988	K	Q	284	302
PSM	VEIIANDQGNRTTPSYVAFTDTER	564	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3642.4	41.82615	4	2776.263294	2776.270519	K	L	26	50
PSM	LGLQEGSNNSSPVDFVNNK	565	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3618.2	41.21737	3	2097.933671	2097.936829	K	R	56	75
PSM	ILATPPQEDAPSVDIANIR	566	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3837.2	46.7812	3	2099.024171	2099.030001	K	M	284	303
PSM	EYIPTVFDNYSAQSAVDGR	567	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4014.2	51.00105	3	2210.950271	2210.952145	K	T	31	50
PSM	GSPLNAAPYGIESMSQDTEVR	568	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3811.3	46.16252	3	2300.996771	2300.998443	K	S	351	372
PSM	QVEEQSAAANEEVLFPFCR	569	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4261.2	55.31645	3	2302.989071	2302.992964	K	E	218	237
PSM	DNLTLWTSENQGDEGDAGEGEN	570	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3822.2	46.42182	3	2349.944471	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	571	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3658.3	42.22825	3	2427.858671	2427.865619	K	K	129	151
PSM	DSGSDEDFLMEDDDDSDYGSSK	572	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3666.3	42.43633	3	2427.858671	2427.865619	K	K	129	151
PSM	QREEYQPATPGLGMFVEVKDPEDK	573	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3592.4	40.56715	4	2858.279294	2858.283392	K	V	72	96
PSM	QEEEQDLDGEKGPSSEGPEEEDGEGFSFK	574	sp|P84157|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3539.3	39.2366	4	3264.272494	3264.277968	R	Y	114	143
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	575	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3754.5	44.70393	4	3385.512094	3385.515651	K	A	399	429
PSM	QSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN	576	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4160.3	53.96605	4	3812.599294	3812.606179	K	-	172	207
PSM	VQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVK	577	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3619.3	41.2452	5	3939.733618	3939.727022	K	D	2008	2043
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	578	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3907.2	48.57907	4	2896.361694	2896.363082	K	A	2621	2646
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	579	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3241.6	31.55807	4	3705.520894	3704.512278	K	-	158	196
PSM	MEGPLSVFGDR	580	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4255.2	55.18263	2	1344.5367	1344.5416	-	S	1	12
PSM	MEGPLSVFGDR	581	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5191.2	64.50745	2	1328.5433	1328.5467	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	582	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4009.4	50.8751	3	2829.1942	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	583	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3901.6	48.43375	3	2749.2250	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	584	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3944.3	49.43777	3	2750.2202	2749.2302	-	Y	1	25
PSM	AGAGSAAVSGAGTPVAGPTGR	585	sp|O95295|SNAPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3154.4	29.28195	3	1832.8427	1832.8413	M	D	2	23
PSM	SHSPSSPDPDTPSPVGDSR	586	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2867.6	21.93388	3	2080.775771	2080.777625	R	A	616	635
PSM	QREEYQPATPGLGMFVEVKDPEDK	587	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3965.3	49.90128	4	2825.2596	2825.2614	K	V	72	96
PSM	SCINLPTVLPGSPSK	588	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4158.2	53.91528	3	1690.7950	1690.7996	M	T	2	17
PSM	CNTPTYCDLGK	589	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3339.4	34.08905	2	1449.5273	1449.5300	M	A	2	13
PSM	DLHQPSLSPASPHSQGFER	590	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3306.3	33.22747	4	2248.934494	2248.930378	K	G	58	77
PSM	GASLKSPLPSQ	591	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3115.3	28.27128	2	1163.558247	1163.558755	K	-	113	124
PSM	MDATANDVPSPYEVR	592	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3357.4	34.55007	3	1743.717071	1743.717517	K	G	434	449
PSM	GSTIETEQKEDKGEDSEPVTSK	593	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2761.2	19.32632	4	2473.075694	2473.074504	K	A	462	484
PSM	HGEVCPAGWKPGSDTIKPDVQK	594	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3135.4	28.78755	4	2485.149294	2485.146110	K	S	169	191
PSM	DSENLASPSEYPENGER	595	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	30.71158	3	1972.770071	1972.768760	R	F	617	634
PSM	SAESPTSPVTSETGSTFKK	596	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3094.4	27.72773	3	2019.904271	2019.903797	K	F	280	299
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	597	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3346.5	34.26818	4	2717.305694	2717.307830	R	R	31	56
PSM	MDSTANEVEAVK	598	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2980.4	24.83357	2	1372.559647	1372.558163	K	V	425	437
PSM	VLQATVVAVGSGSK	599	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3211.4	30.76823	2	1394.718847	1394.717047	K	G	41	55
PSM	TPAAAAAMNLASPR	600	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3307.4	33.25706	2	1420.650847	1420.653400	R	T	2261	2275
PSM	AQAAAPASVPAQAPK	601	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2895.3	22.63567	2	1456.705247	1456.707544	K	R	135	150
PSM	YADEEIPRSPFK	602	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3327.2	33.77165	3	1530.673271	1530.675576	K	V	1497	1509
PSM	FQRPGDPQSAQDK	603	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2811.2	20.50955	3	1552.667171	1552.667136	K	A	294	307
PSM	ACKVDSPTVTTTLK	604	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3000.2	25.34525	3	1599.757571	1599.757925	K	N	455	469
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	605	sp|A0FGR8|ESYT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3116.5	28.30382	4	3212.324094	3212.319276	K	A	688	720
PSM	GGKPEPPAMPQPVPTA	606	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3292.6	32.87428	2	1652.762247	1652.763345	K	-	228	244
PSM	GGRGDVGSADIQDLEK	607	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3227.4	31.18553	3	1695.746771	1695.746509	K	W	250	266
PSM	GEPAAAAAPEAGASPVEK	608	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2920.6	23.29173	2	1701.759047	1701.761096	K	E	88	106
PSM	MDATANDVPSPYEVR	609	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3263.2	32.10743	3	1759.713371	1759.712432	K	G	434	449
PSM	MDATANDVPSPYEVR	610	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3247.6	31.71457	2	1759.711847	1759.712432	K	G	434	449
PSM	TDSVIIADQTPTPTR	611	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3273.3	32.36952	3	1773.758471	1773.758727	R	F	42	57
PSM	SETSVANGSQSESSVSTPSASFEPNNTCENSQSR	612	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	17-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3222.5	31.05913	4	3641.470094	3641.469702	K	N	117	151
PSM	DGQVINETSQHHDDLE	613	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2977.4	24.7557	3	1835.792771	1835.792199	R	-	451	467
PSM	LENVSQLSLDKSPTEK	614	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3288.3	32.75997	3	1866.897371	1866.897590	K	S	126	142
PSM	EQPPTEPGPQSASEVEK	615	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2975.5	24.71058	3	1888.809371	1888.809169	R	I	393	410
PSM	SAESPTSPVTSETGSTFK	616	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3254.3	31.88465	3	1891.811471	1891.808834	K	K	280	298
PSM	KPVTVSPTTPTSPTEGEAS	617	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3033.4	26.1989	3	2044.864271	2044.864315	R	-	505	524
PSM	EFQDAGEQVVSSPADVAEK	618	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3369.4	34.86162	3	2084.895071	2084.893961	K	A	77	96
PSM	NPQSILKPHSPTYNDEGL	619	sp|Q9NVA1|UQCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3404.3	35.76588	3	2088.952271	2088.951751	K	-	282	300
PSM	WVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPK	620	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,30-UNIMOD:4	ms_run[1]:scan=1.1.3388.6	35.35792	4	4316.566894	4316.565632	K	K	1026	1063
PSM	TVGTPIASVPGSTNTGTVPGSEK	621	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3324.6	33.70617	3	2236.060571	2236.062423	R	D	270	293
PSM	YRDVAECGPQQELDLNSPR	622	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3374.6	34.99525	3	2326.003571	2326.004926	K	N	102	121
PSM	EHYPVSSPSSPSPPAQPGGVSR	623	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3120.5	28.40697	3	2378.992871	2378.993372	K	N	2036	2058
PSM	EHYPVSSPSSPSPPAQPGGVSR	624	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3112.6	28.20307	3	2378.992871	2378.993372	K	N	2036	2058
PSM	ELEREESGAAESPALVTPDSEK	625	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3137.6	28.84685	3	2423.072771	2423.074110	K	S	173	195
PSM	LEAIEDDSVKETDSSSASAATPSK	626	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3066.6	27.0469	3	2517.101471	2517.100719	K	K	215	239
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	627	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3275.4	32.42495	4	2717.308894	2717.307830	R	R	31	56
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	628	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2823.3	20.82588	5	3503.284118	3503.284224	R	A	81	114
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	629	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3303.5	33.15555	3	2994.258971	2994.261530	K	A	106	138
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	630	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.2794.3	20.10292	5	3104.324118	3104.322430	K	S	145	174
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	631	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3072.4	27.17262	4	3445.418494	3445.417924	K	K	799	833
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	632	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3021.6	25.90547	4	3793.548094	3793.546038	K	R	142	179
PSM	RASGQAFELILSPR	633	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3713.2	43.6536	3	1623.812471	1623.813407	K	S	14	28
PSM	SADTLWGIQK	634	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3668.2	42.48502	2	1197.539247	1197.543105	K	E	319	329
PSM	GPPQSPVFEGVYNNSR	635	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3515.4	38.61563	3	1826.798171	1826.798879	K	M	107	123
PSM	QLFHPEQLITGKEDAANNYAR	636	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3556.4	39.6745	4	2494.158494	2494.164203	R	G	85	106
PSM	SADTLWDIQK	637	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3737.4	44.28072	2	1255.545247	1255.548584	K	D	320	330
PSM	LDIDSPPITAR	638	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3542.2	39.30938	2	1356.568447	1356.572764	R	N	33	44
PSM	CLELFSELAEDK	639	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4034.2	51.48005	2	1452.676247	1452.680647	K	E	412	424
PSM	DVNSSSPVMLAFK	640	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3851.4	47.14437	2	1473.648647	1473.657483	K	S	28	41
PSM	QASPNIVIALAGNK	641	sp|P51148|RAB5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3788.5	45.57793	2	1474.750647	1474.754495	R	A	122	136
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	642	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3675.4	42.67882	4	2972.321694	2972.324602	K	Q	178	204
PSM	LRELDPSLVSANDSPSGMQTR	643	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3465.3	37.31763	3	2352.069071	2352.078090	K	C	2148	2169
PSM	GALQNIIPASTGAAK	644	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3669.5	42.52057	2	1570.709647	1570.715740	R	A	201	216
PSM	DWALSSAAAVMEER	645	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4177.3	54.17815	2	1614.668447	1614.674924	K	K	547	561
PSM	RASGQAFELILSPR	646	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3721.2	43.86045	3	1623.812471	1623.813407	K	S	14	28
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	647	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3435.6	36.55185	4	3291.358894	3291.357615	R	S	1160	1192
PSM	DDGLFSGDPNWFPK	648	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4821.2	61.53327	2	1673.671847	1673.676304	R	K	140	154
PSM	DDGLFSGDPNWFPK	649	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4867.2	61.93805	2	1673.671847	1673.676304	R	K	140	154
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	650	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3762.5	44.90602	4	3385.512094	3385.515651	K	A	399	429
PSM	DASDDLDDLNFFNQK	651	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4257.2	55.21442	3	1755.759071	1755.758774	K	K	65	80
PSM	DVAEAKPELSLLGDGDH	652	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3580.4	40.25385	3	1764.851471	1764.853008	R	-	232	249
PSM	EAKPGAAEPEVGVPSSLSPSSPSSSWTETDVEER	653	sp|Q6L8Q7|PDE12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3699.6	43.30528	4	3578.592494	3578.593763	K	V	200	234
PSM	VSHVSTGGGASLELLEGK	654	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3513.3	38.55987	3	1819.872671	1819.871709	K	V	389	407
PSM	MDATANDVPSPYEVR	655	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3453.6	37.01805	2	1823.681647	1823.683848	K	G	434	449
PSM	NQLTSNPENTVFDAK	656	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3500.2	38.2164	3	1836.735071	1836.733241	K	R	82	97
PSM	CIPALDSLTPANEDQK	657	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3568.3	39.94535	3	1850.810171	1850.812146	R	I	447	463
PSM	WLDDLLASPPPSGGGAR	658	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4655.2	59.934	3	1867.789871	1867.790696	R	R	684	701
PSM	YFQINQDEEEEEDED	659	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3465.6	37.32763	2	1930.716247	1930.722842	R	-	114	129
PSM	YVASYLLAALGGNSSPSAK	660	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4599.2	59.35588	3	1947.928571	1947.934310	R	D	3	22
PSM	FDRGYISPYFINTSK	661	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3871.2	47.65517	3	1966.824971	1966.826747	K	G	219	234
PSM	GGLNTPLHESDFSGVTPQR	662	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3454.2	37.0309	3	2090.937671	2090.942249	K	Q	381	400
PSM	DTPENNPDTPFDFTPENYK	663	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3890.4	48.14887	3	2319.914471	2319.920904	R	R	43	62
PSM	DNLTLWTSDTQGDEAEAGEGGEN	664	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3875.5	47.76883	3	2407.983371	2407.988786	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	665	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3900.5	48.40438	3	2407.983371	2407.988786	R	-	223	246
PSM	NALFPEVFSPTPDENSDQNSR	666	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4219.3	54.71133	3	2443.030271	2443.032914	R	S	567	588
PSM	VLENAEGARTTPSVVAFTADGER	667	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3508.5	38.4359	3	2549.116571	2549.120029	K	L	77	100
PSM	FNEEHIPDSPFVVPVASPSGDAR	668	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3909.4	48.63398	3	2626.106771	2626.114215	K	R	2311	2334
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	669	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3807.5	46.06861	3	2644.234271	2644.238156	R	L	55	81
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	670	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.5163.2	64.26732	3	2952.323471	2952.330281	R	S	59	86
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	671	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:21	ms_run[1]:scan=1.1.4868.3	61.96383	3	2968.315271	2968.325196	R	S	59	86
PSM	NSHELGPCPEDGSDAPLEDSTADAAASPGP	672	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.3483.5	37.78354	3	3043.199171	3043.202635	R	-	1493	1523
PSM	CIPALDSLTPANEDQK	673	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4730.2	60.61258	3	1833.7805	1833.7851	R	I	447	463
PSM	EEEIAALVIDNGSGMCK	674	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4876.2	62.05197	3	1972.8119	1972.8154	M	A	2	19
PSM	SPAVATSTAAPPPPSSPLPSK	675	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3126.5	28.56243	3	2038.997771	2038.997638	K	S	439	460
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	676	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2978.5	24.78482	5	3566.437118	3565.448950	K	D	124	155
PSM	NGSLDSPGKQDTEEDEEEDEK	677	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2812.5	20.54172	3	2429.918471	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEK	678	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2854.5	21.59922	3	2429.922071	2429.923149	K	D	134	155
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	679	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4025.6	51.29432	3	2830.1902	2829.1962	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	680	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4052.3	51.9156	3	2830.1952	2829.1962	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	681	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3909.5	48.64065	3	2749.2250	2749.2301	-	Y	1	25
PSM	ASGADSKGDDLSTAILK	682	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3751.2	44.61817	3	1849.7707	1849.7742	M	Q	2	19
PSM	MTEWETAAPAVAETPDIK	683	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4348.2	56.73701	3	2080.8997	2080.9059	-	L	1	19
PSM	MEAAGSPAATETGK	684	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2760.6	19.30132	2	1457.5701	1457.5740	-	Y	1	15
PSM	QQPPEPEWIGDGESTSPSDK	685	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.3834.3	46.7148	3	2245.8985	2245.9047	K	V	7	27
PSM	MNPVYSPGSSGVPYANAK	686	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3811.2	46.15918	3	1959.8444	1959.8433	-	G	1	19
PSM	SDEFSLADALPEHSPAK	687	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4008.4	50.84983	3	1935.8292	1934.8292	M	T	2	19
PSM	CNTPTYCDLGK	688	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3347.4	34.29003	2	1449.5273	1449.5300	M	A	2	13
PSM	CGNTIPDDDNQVVSLSPGSR	689	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3426.2	36.31377	3	2209.923371	2209.931092	R	Y	643	663
PSM	GHTDTEGRPPSPPPTSTPEK	690	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2787.2	19.93937	4	2166.964494	2166.958293	R	C	353	373
PSM	ADLNQGIGEPQSPSR	691	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3058.2	26.83188	3	1647.726371	1647.725379	R	R	63	78
PSM	SSTPLPTISSSAENTR	692	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3213.3	30.81695	3	1726.778771	1726.777475	R	Q	158	174
PSM	VQHASPAGTYAHTVNR	693	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2841.2	21.26977	3	1787.794271	1787.810446	R	N	173	189
PSM	LGAGGGSPEKSPSAQELK	694	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2934.3	23.63945	3	1791.841571	1791.840409	R	E	13	31
PSM	NGLAAELGPASPR	695	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3323.4	33.67344	2	1331.621647	1331.623480	R	R	91	104
PSM	TPKGPSSVEDIK	696	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2943.3	23.871	2	1336.625647	1336.627563	K	A	237	249
PSM	HSPNLSFEPNFCQDNPRSPTSSK	697	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3406.2	35.81455	4	2725.159294	2725.159194	K	E	107	130
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	698	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3230.5	31.26695	4	2987.320094	2987.319929	R	-	684	712
PSM	GEATVSFDDPPSAK	699	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3225.6	31.14003	2	1499.617647	1499.618120	K	A	335	349
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	700	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3224.4	31.10757	4	3093.276894	3093.277137	R	-	738	768
PSM	GRTVIIEQSWGSPK	701	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3347.2	34.28337	3	1636.796171	1636.797422	K	V	59	73
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	702	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3139.5	28.89505	4	3290.600894	3290.597273	K	E	178	210
PSM	ENVNATENCISAVGK	703	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3147.5	29.10457	2	1684.709047	1684.712766	K	I	964	979
PSM	ALSRQEMQEVQSSR	704	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2735.3	18.71448	3	1743.759071	1743.761113	K	S	187	201
PSM	HTGPNSPDTANDGFVR	705	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2984.4	24.93638	3	1763.728871	1763.726442	K	L	99	115
PSM	SSDEENGPPSSPDLDR	706	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2958.4	24.26327	3	1780.679171	1780.678883	R	I	202	218
PSM	RADLNQGIGEPQSPSR	707	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2949.4	24.0299	3	1803.825971	1803.826490	R	R	62	78
PSM	GVQVETISPGDGRTFPK	708	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3342.4	34.1647	3	1866.8858	1866.8872	M	R	2	19
PSM	SGKYDLDFKSPDDPSR	709	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3228.5	31.21552	3	1905.816371	1905.814588	R	Y	254	270
PSM	RADLNQGIGEPQSPSRR	710	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2883.3	22.33413	4	1959.934094	1959.927602	R	V	62	79
PSM	ATAQDNPKSATEQSGTGIR	711	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2788.4	19.95747	3	2010.896171	2010.900778	K	S	511	530
PSM	VTAEADSSSPTGILATSESK	712	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3372.3	34.93483	3	2029.906871	2029.909277	K	S	486	506
PSM	GPSPSSPTPPAAAAPAEQAPR	713	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3044.4	26.47648	3	2035.935971	2035.936435	R	A	103	124
PSM	AMHQAQTMEGCSSPMVVK	714	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3072.3	27.16595	3	2070.837671	2070.839640	K	F	167	185
PSM	SHSPSSPDPDTPSPVGDSR	715	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2875.6	22.14048	3	2080.775771	2080.777625	R	A	616	635
PSM	NSLDASRPAGLSPTLTPGER	716	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3365.5	34.76152	3	2118.009371	2118.010663	K	Q	138	158
PSM	TPSPKEEDEEPESPPEKK	717	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2731.2	18.61463	3	2131.920371	2131.919841	K	T	202	220
PSM	SQGDEAGGHGEDRPEPLSPK	718	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2826.2	20.8898	4	2141.902494	2141.901506	R	E	361	381
PSM	STTPPPAEPVSLPQEPPKPR	719	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3266.5	32.19478	3	2204.086871	2204.087850	K	V	225	245
PSM	LYGSAGPPPTGEEDTAEKDEL	720	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3426.6	36.3271	2	2254.951447	2254.951870	K	-	634	655
PSM	SPEKLPQSSSSESSPPSPQPTK	721	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2853.4	21.56733	3	2361.074771	2361.073716	K	V	408	430
PSM	ELEREESGAAESPALVTPDSEK	722	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3135.6	28.79422	3	2503.039571	2503.040441	K	S	173	195
PSM	NNDQPQSANANEPQDSTVNLQSPLK	723	sp|P37275|ZEB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3387.6	35.33165	3	2788.228871	2788.230111	K	M	658	683
PSM	TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	724	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3303.6	33.15888	3	3340.217171	3340.220589	R	G	294	325
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	725	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3081.6	27.39735	4	3445.418494	3445.417924	K	K	799	833
PSM	VPADTEVVCAPPTAYIDFAR	726	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4091.2	52.72323	4	2271.026494	2271.028287	K	Q	71	91
PSM	VVVAENFDEIVNNENK	727	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3659.2	42.25097	3	1831.891271	1831.895208	K	D	380	396
PSM	DAGQISGLNVLR	728	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3763.4	44.92835	2	1321.636847	1321.639131	K	V	207	219
PSM	EGLELLKTAIGK	729	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3624.3	41.36865	2	1350.714647	1350.715984	K	A	222	234
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	730	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3597.3	40.69478	5	3464.573118	3464.574823	K	E	218	249
PSM	ISEEQQQLQQALAPAQASSNSSTPTR	731	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3590.4	40.51442	4	2849.318494	2849.319260	K	M	9	35
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	732	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3723.6	43.926	4	2908.397694	2908.396782	R	S	67	92
PSM	GYISPYFINTSK	733	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3986.3	50.35982	2	1548.626847	1548.630279	R	G	222	234
PSM	NLNNSNLFSPVNR	734	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3599.5	40.75658	2	1567.708047	1567.714421	K	D	604	617
PSM	ANTTAFLTPLEIK	735	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4113.3	53.24597	2	1577.710847	1577.714343	K	A	558	571
PSM	DMSPLSETEMALGK	736	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3842.3	46.92033	2	1603.640647	1603.651077	K	D	505	519
PSM	IFVGGLSPDTPEEK	737	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3708.5	43.53603	2	1647.681047	1647.683437	K	I	184	198
PSM	AQQATPGGAAPTIFSR	738	sp|Q9BX68|HINT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3433.3	36.48952	3	1651.776071	1651.771936	K	I	43	59
PSM	RASGQAFELILSPR	739	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3942.2	49.37583	3	1703.778071	1703.779738	K	S	14	28
PSM	AEEYEFLTPVEEAPK	740	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3783.2	45.43775	3	1830.792971	1830.796479	R	G	153	168
PSM	SYELPDGQVITIGNER	741	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4071.2	52.34097	3	1869.847271	1869.850974	K	F	241	257
PSM	HSGGFLSSPADFSQENK	742	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3497.4	38.14502	3	1886.787971	1886.783623	R	A	772	789
PSM	VVESPDFSKDEDYLGK	743	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3456.3	37.08582	3	1906.821971	1906.823756	K	V	923	939
PSM	YGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAK	744	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3874.6	47.74635	4	4103.578894	4103.581205	K	R	79	117
PSM	VSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENR	745	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.3554.6	39.62863	4	4163.746894	4163.759416	K	G	372	413
PSM	DQLIYNLLKEEQTPQNK	746	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3977.2	50.14538	3	2153.038271	2153.040566	K	I	6	23
PSM	DYEEVGADSADGEDEGEEY	747	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3483.6	37.78687	2	2157.699447	2157.705945	K	-	431	450
PSM	ATESGAQSAPLPMEGVDISPK	748	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3687.4	42.98563	3	2163.969371	2163.975917	K	Q	8	29
PSM	QTRLEFQQQLGEAPSDASP	749	sp|Q9BUW7|CI016_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3570.2	39.99055	3	2180.967371	2180.973943	R	-	65	84
PSM	KGEQTSSGTLSAFASYFNSK	750	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4058.4	52.03173	3	2188.967171	2188.967795	R	V	670	690
PSM	DLLLTSSYLSDSGSTGEHTK	751	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3764.2	44.94662	3	2189.971271	2189.972940	K	S	397	417
PSM	QHPQPYIFPDSPGGTSYER	752	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3504.4	38.32796	3	2254.967471	2254.968463	R	Y	75	94
PSM	VPADTEVVCAPPTAYIDFAR	753	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4083.3	52.62285	2	2271.023447	2271.028287	K	Q	71	91
PSM	DTPENNPDTPFDFTPENYK	754	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3881.4	47.91955	3	2319.914471	2319.920904	R	R	43	62
PSM	SGSSSPDSEITELKFPSINHD	755	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3892.3	48.19073	3	2325.994271	2326.000217	R	-	571	592
PSM	DLGLSESGEDVNAAILDESGKK	756	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3724.2	43.9385	3	2326.053371	2326.057732	K	F	464	486
PSM	SASSYSDIEEIATPDSSAPSSPK	757	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3607.6	40.96027	3	2405.009771	2405.015927	K	L	1233	1256
PSM	TLEEVVMAEEEDEGTDRPGSPA	758	sp|A6NKF1|SAC31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3908.5	48.61153	3	2439.990971	2439.998897	R	-	383	405
PSM	DNLTLWTADNAGEEGGEAPQEPQS	759	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3889.5	48.11977	3	2528.086871	2528.093920	R	-	225	249
PSM	DNLTLWTADNAGEEGGEAPQEPQS	760	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4117.4	53.29265	3	2608.053671	2608.060251	R	-	225	249
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	761	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3872.2	47.68412	4	3465.474894	3465.481982	K	A	399	429
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	762	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3866.5	47.53588	4	3522.466094	3522.472617	K	F	604	634
PSM	TPAAAAAMNLASPR	763	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3299.4	33.0495	2	1421.649047	1420.653400	R	T	2261	2275
PSM	SSGSEGSSPNWLQALK	764	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3951.2	49.58263	3	1728.759671	1726.756345	K	L	1708	1724
PSM	TPKTPKGPSSVEDIK	765	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2910.2	23.01815	4	1663.824094	1662.822968	K	A	234	249
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	766	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.2925.5	23.4177	4	3007.3287	3007.3290	K	S	145	174
PSM	ATGANATPLDFPSK	767	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3603.6	40.8614	2	1510.6662	1510.6700	M	K	2	16
PSM	ASGVAVSDGVIK	768	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3540.3	39.26207	2	1223.5750	1223.5794	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	769	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4017.5	51.08503	3	2829.1942	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	770	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3620.3	41.27313	3	2765.2213	2765.2250	-	Y	1	25
PSM	TDSVIIADQTPTPTR	771	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3281.4	32.58072	3	1773.758471	1773.758727	R	F	42	57
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	772	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3713.6	43.66693	3	2882.1601	2882.1618	M	D	2	29
PSM	MEAAGSPAATETGK	773	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3059.6	26.87188	2	1441.5761	1441.5791	-	Y	1	15
PSM	AEAEGVPTTPGPASGSTFR	774	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3517.5	38.67103	3	1952.8523	1952.8512	M	G	2	21
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	775	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3671.5	42.57263	3	2574.976571	2573.998594	R	G	239	267
PSM	QCLEDSDAGASNEYDSSPAAWNK	776	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3422.4	36.23153	3	2593.989071	2593.990457	K	E	48	71
PSM	AQKLPDLSPVENK	777	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3261.2	32.05648	3	1517.753771	1517.749075	K	E	2098	2111
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	778	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3155.2	29.30125	5	2612.326118	2612.322435	R	Q	24	52
PSM	GASLKSPLPSQ	779	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3107.4	28.06655	2	1163.558247	1163.558755	K	-	113	124
PSM	VPPAPVPCPPPSPGPSAVPSSPK	780	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3425.4	36.29645	4	2378.083694	2378.078288	K	S	366	389
PSM	DVQDSLTVSNEAQTAK	781	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3158.2	29.37868	3	1784.784671	1784.782954	K	E	211	227
PSM	SQDATFSPGSEQAEKSPGPIVSR	782	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3275.3	32.42162	4	2534.073694	2534.072745	R	T	329	352
PSM	NGNGGPGPYVGQAGTATLPR	783	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3327.4	33.77832	3	1962.893171	1962.894904	K	N	185	205
PSM	DQVANSAFVER	784	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3128.5	28.6126	2	1314.560447	1314.560546	K	L	500	511
PSM	TFDQLTPDESK	785	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3134.5	28.76522	2	1359.559447	1359.559543	K	E	71	82
PSM	TFDQLTPEESK	786	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3130.3	28.656	2	1373.574847	1373.575193	K	E	60	71
PSM	NGEVVHTPETSV	787	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3071.3	27.14167	2	1427.534447	1427.537107	K	-	454	466
PSM	DRVHHEPQLSDK	788	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2630.2	17.4923	3	1459.717571	1459.716790	K	V	26	38
PSM	RVEPGSPAEAAALR	789	sp|Q15599|NHRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3046.2	26.52085	3	1502.722871	1502.724257	R	A	38	52
PSM	AIEINPDSAQPYK	790	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3337.4	34.03757	2	1524.683047	1524.686140	R	W	174	187
PSM	LAVDEEENADNNTK	791	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2839.4	21.2145	2	1560.686047	1560.690360	K	A	40	54
PSM	DGSLASNPYSGDLTK	792	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3387.5	35.32832	2	1603.676847	1603.676698	R	F	850	865
PSM	HSGPNSADSANDGFVR	793	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2922.3	23.33343	3	1709.679971	1709.679492	K	L	99	115
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	794	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3334.5	33.96402	4	3431.358894	3431.367542	R	A	108	139
PSM	NLDIERPTYTNLNR	795	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3314.2	33.43307	3	1717.871771	1717.874747	R	L	216	230
PSM	LKGEATVSFDDPPSAK	796	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3174.3	29.79728	3	1740.796571	1740.797147	K	A	333	349
PSM	FSEGVLQSPSQDQEK	797	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3234.3	31.36543	3	1757.753471	1757.750926	R	L	428	443
PSM	HTGPNSPDTANDGFVR	798	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2976.3	24.72638	3	1763.728871	1763.726442	K	L	99	115
PSM	ATEPPSPDAGELSLASR	799	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3397.3	35.58322	3	1776.792671	1776.793125	K	L	720	737
PSM	ALVSGKPAESSAVAATEK	800	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3072.2	27.15928	3	1794.873071	1794.876460	K	K	75	93
PSM	NIGRDTPTSAGPNSFNK	801	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3037.3	26.2939	3	1934.791271	1934.792487	K	G	134	151
PSM	NGNGGPGPYVGQAGTATLPR	802	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3319.5	33.57308	3	1962.893171	1962.894904	K	N	185	205
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	803	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3206.5	30.64017	4	3927.670894	3927.670193	R	Q	329	367
PSM	FIHQQPQSSSPVYGSSAK	804	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2953.6	24.14028	3	2026.912571	2026.914971	R	T	76	94
PSM	TVEVAEGEAVRTPQSVTAK	805	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3172.5	29.75207	3	2130.958271	2130.959947	R	Q	132	151
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	806	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3315.6	33.47295	4	2898.287694	2898.290225	K	L	281	308
PSM	DGLNQTTIPVSPPSTTKPSR	807	sp|Q71RC2|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3331.4	33.88265	3	2175.054671	2175.057278	K	A	573	593
PSM	DTSSITSCGDGNVVKQEQLSPK	808	sp|Q9Y6Q9|NCOA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3203.5	30.56152	3	2429.079071	2429.078150	K	K	709	731
PSM	SQDATFSPGSEQAEKSPGPIVSR	809	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3201.6	30.51287	3	2454.106571	2454.106414	R	T	329	352
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	810	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3333.5	33.93767	3	2621.136671	2621.141158	K	I	50	74
PSM	AGDNIPEEQPVASTPTTVSDGENKK	811	sp|Q9Y320|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3087.6	27.55292	3	2663.193071	2663.196351	K	D	270	295
PSM	ASSDLDQASVSPSEEENSESSSESEK	812	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3052.6	26.68918	3	2794.079771	2794.082562	K	T	173	199
PSM	NQIHVKSPPREGSQGELTPANSQSR	813	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2918.6	23.2399	4	2796.327294	2796.330434	R	M	462	487
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	814	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3349.6	34.34807	4	2994.258094	2994.261530	K	A	106	138
PSM	SSERTPGAATASASGAAEDGACGCLPNPGTFEECHRK	815	sp|O96008|TOM40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,22-UNIMOD:4,24-UNIMOD:4,34-UNIMOD:4	ms_run[1]:scan=1.1.3342.6	34.17137	5	3885.614118	3885.614215	R	C	53	90
PSM	IADPEHDHTGFLTEYVATR	816	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3583.2	40.32537	4	2330.960094	2330.961009	R	W	190	209
PSM	RIDFTPVSPAPSPTR	817	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3441.2	36.69304	3	1799.802071	1799.800867	K	G	108	123
PSM	LDIDSPPITAR	818	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3499.3	38.19388	2	1276.606847	1276.606433	R	N	33	44
PSM	DGLLSPGAWNGEPSGEGSR	819	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3987.3	50.386	3	1964.825471	1964.826550	K	S	504	523
PSM	GHVTQDAPIPGSPLYTIK	820	sp|Q15029|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3543.3	39.33767	3	1972.959071	1972.965944	R	A	855	873
PSM	VWSPLVTEEGK	821	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3671.3	42.56597	2	1323.607447	1323.611184	K	R	88	99
PSM	TAFQEALDAAGDK	822	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3518.4	38.6933	2	1335.628447	1335.630660	K	L	9	22
PSM	ADIDVSGPKVDIDTPDIDIHGPEGK	823	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3679.3	42.77355	4	2682.238094	2682.242573	K	L	4087	4112
PSM	SASYKYSEEANNLIEECEQAER	824	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3753.4	44.67478	4	2699.107694	2699.105821	K	L	115	137
PSM	SILSPGGSCGPIK	825	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3467.2	37.36388	2	1351.618447	1351.620704	R	V	207	220
PSM	IMNTFSVVPSPK	826	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3679.4	42.77688	2	1398.657447	1398.661840	R	V	163	175
PSM	IMNTFSVVPSPK	827	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3687.3	42.9823	2	1398.657447	1398.661840	R	V	163	175
PSM	ESVPEFPLSPPK	828	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3791.3	45.64942	2	1405.651647	1405.653049	K	K	30	42
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	829	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3598.5	40.72737	4	2897.087694	2897.089897	K	T	701	725
PSM	IVSAQSLAEDDVE	830	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3639.4	41.74795	2	1454.617447	1454.617786	R	-	133	146
PSM	DLGTQNHTSELILSSPPGQK	831	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3458.2	37.13505	3	2201.037971	2201.036543	K	V	385	405
PSM	DVNSSSPVMLAFK	832	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3841.3	46.88432	2	1473.648647	1473.657483	K	S	28	41
PSM	DTTSPMELAALEK	833	sp|Q6VY07|PACS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3722.3	43.89308	2	1484.644847	1484.646978	K	I	427	440
PSM	NSSTPGLQVPVSPTVPIQNQK	834	sp|Q03164|KMT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3610.2	41.0237	3	2270.124671	2270.130778	R	Y	3025	3046
PSM	TTPSVVAFTADGER	835	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3527.4	38.92807	2	1529.670647	1529.676304	R	L	86	100
PSM	ILTFDQLALDSPK	836	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4109.3	53.14325	2	1539.749647	1539.758577	K	G	120	133
PSM	DEILPTTPISEQK	837	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3448.4	36.88087	2	1549.725447	1549.727671	K	G	215	228
PSM	MLAESDESGDEESVSQTDKTELQNTLR	838	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3470.5	37.44912	4	3107.309694	3107.312580	K	T	186	213
PSM	TKEVYELLDSPGK	839	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3483.2	37.77353	3	1557.733871	1557.732756	K	V	18	31
PSM	VEEPSGAVTTPAGVIAAAGPQGPGTGE	840	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3785.4	45.50335	3	2499.148871	2499.153029	R	-	707	734
PSM	KAPLNIPGTPVLEDFPQNDDEK	841	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3863.4	47.45545	3	2516.181671	2516.183601	R	E	41	63
PSM	SPAGLQVLNDYLADK	842	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4347.2	56.70793	3	1682.789471	1682.791668	K	S	8	23
PSM	SESVPPVTDWAWYK	843	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4243.2	55.0335	3	1743.752171	1743.754554	K	I	244	258
PSM	VTNGAFTGEISPGMIK	844	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3858.4	47.33275	2	1780.744647	1780.750805	K	D	107	123
PSM	DDGLFSGDPNWFPKK	845	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4056.2	51.97938	3	1801.772171	1801.771267	R	S	140	155
PSM	ESHSPFGLDSFNSTAK	846	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3551.2	39.53675	3	1802.750471	1802.751260	K	V	1250	1266
PSM	RIDFIPVSPAPSPTR	847	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3809.2	46.10887	3	1811.836571	1811.837252	K	G	136	151
PSM	AQSPGAVEEILDRENK	848	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3567.2	39.9179	3	1834.845971	1834.846223	R	R	7	23
PSM	NQLTSNPENTVFDAK	849	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3492.6	38.0229	2	1836.731847	1836.733241	K	R	82	97
PSM	KYEQGFITDPVVLSPK	850	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3680.2	42.79648	3	1899.938471	1899.938332	K	D	109	125
PSM	NSDVLQSPLDSAARDEL	851	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3865.2	47.50062	3	1908.845471	1908.846617	K	-	606	623
PSM	DFAARSPSASITDEDSNV	852	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3455.5	37.0669	3	1960.805471	1960.805146	K	-	994	1012
PSM	DALGDSLQVPVSPSSTTSSR	853	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3633.4	41.59357	3	2082.941771	2082.947059	R	C	141	161
PSM	DRYMSPMEAQEFGILDK	854	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3927.2	49.05593	3	2108.892371	2108.894829	R	V	227	244
PSM	SRDYNPYNYSDSISPFNK	855	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3599.4	40.74992	3	2245.931471	2245.931744	R	S	1016	1034
PSM	IADPEHDHTGFLTEYVATR	856	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3447.4	36.8549	3	2250.991871	2250.994678	R	W	190	209
PSM	KGEQTSSGTLSAFASYFNSK	857	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4332.2	56.41083	3	2268.924971	2268.934126	R	V	670	690
PSM	DTPENNPDTPFDFTPENYK	858	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3898.3	48.34878	3	2319.914471	2319.920904	R	R	43	62
PSM	AIVDALPPPCESACTVPTDVDK	859	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3680.6	42.80982	3	2434.075271	2434.079730	R	W	261	283
PSM	GGPGSAVSPYPTFNPSSDVAALHK	860	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3827.2	46.52863	3	2515.073771	2515.082187	K	A	30	54
PSM	DNLTLWTADNAGEEGGEAPQEPQS	861	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3897.3	48.3299	3	2528.086871	2528.093920	R	-	225	249
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	862	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4078.4	52.52668	3	2540.084471	2540.089049	K	S	180	204
PSM	APSEEDSLSSVPISPYKDEPWK	863	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3848.3	47.06747	3	2620.091771	2620.102313	K	Y	36	58
PSM	FNEEHIPDSPFVVPVASPSGDAR	864	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3901.4	48.42708	3	2626.106771	2626.114215	K	R	2311	2334
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	865	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4327.2	56.31278	3	2754.226571	2754.234331	R	Y	147	174
PSM	ERPTPSLNNNCTTSEDSLVLYNR	866	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3614.5	41.1296	3	2839.187471	2839.188520	K	V	734	757
PSM	TDVIQGDDVADATSEVEVSSTSETTPK	867	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3641.4	41.79967	3	2860.230971	2860.238669	R	A	2480	2507
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	868	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3658.2	42.22492	4	2972.322094	2972.324602	K	Q	178	204
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	869	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3528.3	38.95092	5	2989.538618	2989.541321	K	G	202	228
PSM	EANPTPLTPGASSLSQLGAYLDSDDSNGSN	870	sp|Q9BW85|YJU2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5163.3	64.27731	3	3057.299171	3057.308814	K	-	294	324
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQRK	871	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3809.6	46.1222	3	3199.439171	3199.444580	K	F	139	167
PSM	VGPATPSAQVGKWEEDSESSSEESSDSSDGEVPTAVAPAQEK	872	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3605.5	40.90825	4	4340.854894	4340.860555	K	S	529	571
PSM	TPKTPKGPSSVEDIK	873	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2963.4	24.39352	3	1743.790871	1742.789299	K	A	234	249
PSM	DDDIAALVVDNGSGMCK	874	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4479.2	58.14508	2	1900.7538	1900.7579	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	875	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4177.2	54.16815	3	1916.7485	1916.7528	M	A	2	19
PSM	VLLPEYGGTKVVLDDK	876	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3656.2	42.17253	3	1824.930071	1824.927433	K	D	71	87
PSM	MDSAGQDINLNSPNK	877	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3544.5	39.36925	2	1724.7026	1724.7072	-	G	1	16
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	878	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2992.5	25.14847	5	3566.438118	3565.448950	K	D	124	155
PSM	AESSESFTMASSPAQR	879	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3467.6	37.37722	2	1806.7115	1806.7126	M	R	2	18
PSM	AESSESFTMASSPAQR	880	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3196.6	30.38205	2	1822.7088	1822.7076	M	R	2	18
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	881	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3600.6	40.78316	3	2758.1429	2758.1503	M	D	2	33
PSM	MEGPLSVFGDR	882	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5075.2	63.67383	2	1328.5433	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	883	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4298.2	55.82547	2	1344.5369	1344.5416	-	S	1	12
PSM	MEGPLSVFGDR	884	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4282.2	55.6128	2	1344.5367	1344.5416	-	S	1	12
PSM	TEWETAAPAVAETPDIK	885	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3942.3	49.38583	3	1949.8612	1949.8654	M	L	2	19
PSM	TEWETAAPAVAETPDIK	886	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4021.2	51.18117	3	2029.8293	2029.8318	M	L	2	19
PSM	NLEQILNGGESPK	887	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3764.3	44.95329	2	1477.675847	1477.681389	K	Q	219	232
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	888	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3708.3	43.52937	4	2882.1882	2882.1622	M	D	2	29
PSM	SDAAVDTSSEITTK	889	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3161.6	29.46963	2	1465.6766	1465.6779	M	D	2	16
PSM	SSTPLPTISSSAENTR	890	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3221.2	31.0226	3	1726.778771	1726.777475	R	Q	158	174
PSM	KRDHANYEEDENGDITPIK	891	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2939.5	23.77363	4	2323.010094	2323.011785	R	A	132	151
PSM	NQVAMNPTNTVFDAK	892	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3182.4	30.00977	3	1744.752971	1744.749152	K	R	57	72
PSM	IFQKGESPVDYDGGR	893	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3123.3	28.4783	3	1746.759671	1746.761431	K	T	242	257
PSM	NDSVIVADQTPTPTR	894	sp|P15336|ATF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3125.4	28.53348	3	1772.747171	1772.738326	R	F	60	75
PSM	VPPAPVPCPPPSPGPSAVPSSPK	895	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3393.2	35.47467	4	2378.082494	2378.078288	K	S	366	389
PSM	LPSAQTPNGTDYVASGK	896	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3141.3	28.9412	3	1784.798171	1784.798210	R	S	1960	1977
PSM	STGCDFAVSPK	897	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3092.3	27.67153	2	1247.488847	1247.489355	K	L	501	512
PSM	YCRPESQEHPEADPGSAAPYLK	898	sp|P40763|STAT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3136.2	28.80768	4	2581.098894	2581.094469	K	T	686	708
PSM	AVPMAPAPASPGSSNDSSAR	899	sp|Q66K74|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3042.5	26.42782	3	1948.835171	1948.835006	K	S	750	770
PSM	SVNGGPGSPDLAR	900	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2919.5	23.26237	2	1305.574847	1305.571445	R	H	982	995
PSM	LVRLSSDSFAR	901	sp|Q9HB09|B2L12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3306.2	33.22413	3	1329.647171	1329.644216	K	L	238	249
PSM	AGDNIPEEQPVASTPTTVSDGENKK	902	sp|Q9Y320|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3088.4	27.57202	4	2663.195694	2663.196351	K	D	270	295
PSM	LAIQGPEDSPSR	903	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3094.5	27.73107	2	1348.599447	1348.602411	R	Q	230	242
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	904	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3395.5	35.53757	4	2807.201294	2807.201193	R	G	70	97
PSM	SIDTQTPSVQER	905	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2904.5	22.87378	2	1439.628447	1439.629354	R	S	345	357
PSM	NAPAAVDEGSISPR	906	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3008.6	25.56688	2	1462.644247	1462.645338	R	T	373	387
PSM	LRECELSPGVNR	907	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2983.3	24.90743	3	1508.683871	1508.680678	R	D	487	499
PSM	SGSSSPDSEITELK	908	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3309.6	33.31553	2	1515.631447	1515.634164	R	F	571	585
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	909	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=1.1.3140.6	28.92417	3	2284.861571	2284.859324	R	S	326	351
PSM	NWMVGGEGGAGGRSP	910	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3175.4	29.82635	2	1526.593847	1526.597342	K	-	79	94
PSM	NHCGIASAASYPTV	911	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3415.5	36.05919	2	1526.620647	1526.622494	R	-	320	334
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	912	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3216.5	30.90188	4	3093.276894	3093.277137	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	913	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3232.3	31.3121	4	3093.281294	3093.277137	R	-	738	768
PSM	PCSEETPAISPSK	914	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2861.5	21.7757	2	1561.5743	1561.5767	M	R	2	15
PSM	APVPGTPDSLSSGSSR	915	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3051.6	26.66338	2	1593.700847	1593.703581	K	D	322	338
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	916	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3207.6	30.66995	4	3197.256094	3197.249993	R	A	333	362
PSM	AAHSEGNTTAGLDMR	917	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2726.2	18.54635	3	1625.652671	1625.650500	R	E	467	482
PSM	GRTVIIEQSWGSPK	918	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3355.2	34.49143	3	1636.796171	1636.797422	K	V	59	73
PSM	LVDAGEECDCGTPKECELDPCCEGSTCK	919	sp|Q13443|ADAM9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.3257.4	31.96257	4	3355.220094	3355.215468	K	L	421	449
PSM	LIAPVAEEEATVPNNK	920	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3300.4	33.07502	3	1693.893671	1693.888666	K	I	8	24
PSM	GLGKPGGQGDAIQLSPK	921	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3165.5	29.56987	3	1701.844571	1701.845101	K	L	160	177
PSM	EALLSSAVDHGSDEVK	922	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3376.2	35.03298	3	1735.764371	1735.766576	R	F	139	155
PSM	NDSPTQIPVSSDVCR	923	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3237.5	31.45035	2	1753.730847	1753.734230	R	L	673	688
PSM	MDATANDVPSPYEVR	924	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3255.3	31.9094	3	1759.713371	1759.712432	K	G	434	449
PSM	LVQDVANNTNEEAGDGTTTATVLAR	925	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3410.6	35.93272	3	2639.207771	2639.207584	K	S	97	122
PSM	ICEPGYSPTYKQDK	926	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2990.6	25.10007	2	1764.742447	1764.743004	K	H	210	224
PSM	VDCTAHSDVCSAQGVR	927	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2809.5	20.46858	3	1840.723571	1840.723348	K	G	119	135
PSM	TSSVSNPQDSVGSPCSR	928	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2868.4	21.95313	3	1843.739471	1843.740772	K	V	94	111
PSM	TSPSSPAPLPHQEATPR	929	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2953.5	24.13695	3	1851.852371	1851.851643	R	A	169	186
PSM	IRYESLTDPSKLDSGK	930	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3272.2	32.34025	4	1887.900094	1887.897924	K	E	54	70
PSM	IRYESLTDPSKLDSGK	931	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3294.5	32.92333	3	1967.865971	1967.864255	K	E	54	70
PSM	GNSRPGTPSAEGGSTSSTLR	932	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2797.3	20.17845	3	1997.876771	1997.880377	R	A	383	403
PSM	DGGRSSPGGQDEGGFMAQGK	933	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3039.5	26.35075	3	2016.797471	2016.799683	R	T	298	318
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	934	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3321.6	33.62845	4	4117.438894	4117.448322	K	K	158	194
PSM	SHSPSSPDPDTPSPVGDSR	935	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2859.6	21.72738	3	2080.775771	2080.777625	R	A	616	635
PSM	NSLDASRPAGLSPTLTPGER	936	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3385.5	35.27612	3	2197.974671	2197.976994	K	Q	138	158
PSM	DYHFKVDNDENEHQLSLR	937	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3273.2	32.36618	4	2258.034094	2258.035223	K	T	28	46
PSM	VSEEQTQPPSPAGAGMSTAMGR	938	sp|Q16666|IF16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3292.4	32.86762	3	2267.958371	2267.955198	K	S	144	166
PSM	SQSPAASDCSSSSSSASLPSSGR	939	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2874.6	22.11458	3	2278.896071	2278.900914	R	S	171	194
PSM	NGSLDSPGKQDTEEDEEEDEK	940	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2820.5	20.74528	3	2429.918471	2429.923149	K	D	134	155
PSM	DAAASASTPAQAPTSDSPVAEDASR	941	sp|P55789|ALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3054.6	26.74118	3	2452.032071	2452.039122	R	R	43	68
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	942	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3085.6	27.50123	3	2758.051271	2758.058931	R	E	424	448
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	943	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2788.5	19.9608	4	3104.324894	3104.322430	K	S	145	174
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	944	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3109.4	28.11872	5	3112.513118	3112.507789	R	S	847	876
PSM	EGRDDRLHSAEQDADDEAADDTDDTSSVTSSASSTTSSQSGSGTSR	945	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3103.6	27.96863	5	4770.893118	4770.899413	K	K	467	513
PSM	VLLPEYGGTKVVLDDK	946	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3646.2	41.92332	4	1824.926894	1824.927433	K	D	71	87
PSM	RASGQAFELILSPR	947	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3705.2	43.44793	3	1623.812471	1623.813407	K	S	14	28
PSM	HSGGFLSSPADFSQENK	948	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3489.4	37.938	3	1886.787971	1886.783623	R	A	772	789
PSM	DDGVFVQEVTQNSPAAR	949	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3550.2	39.51115	3	1911.835571	1911.836387	R	T	29	46
PSM	VMTIPYQPMPASSPVICAGGQDR	950	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3857.2	47.29362	4	2554.132894	2554.141953	R	C	178	201
PSM	SADTLWGIQK	951	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3970.2	50.00138	2	1277.508847	1277.509436	K	E	319	329
PSM	SSSSESEDEDVIPATQCLTPGIR	952	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3669.3	42.5139	4	2557.087294	2557.089109	R	T	996	1019
PSM	YFEADPPGQVAASPDPTT	953	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3509.3	38.45564	3	1941.806771	1941.803355	R	-	157	175
PSM	DSGFTIVSPLDI	954	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5850.2	69.02385	2	1342.599047	1342.605765	K	-	784	796
PSM	TAHNSEADLEESFNEHELEPSSPK	955	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3470.2	37.43912	4	2776.159294	2776.150129	K	S	134	158
PSM	IMNTFSVVPSPK	956	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3671.4	42.5693	2	1398.657447	1398.661840	R	V	163	175
PSM	GLFSANDWQCK	957	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3881.2	47.91288	2	1404.550447	1404.553352	R	T	62	73
PSM	ESVPEFPLSPPK	958	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3783.4	45.44442	2	1405.651647	1405.653049	K	K	30	42
PSM	ESVPEFPLSPPK	959	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3799.3	45.857	2	1405.651647	1405.653049	K	K	30	42
PSM	QEQINTEPLEDTVLSPTK	960	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3702.4	43.37667	3	2120.986271	2120.987861	K	K	271	289
PSM	TVIIEQSWGSPK	961	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3542.3	39.31272	2	1423.670447	1423.674847	R	V	61	73
PSM	YHTSQSGDEMTSLSEYVSR	962	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3484.4	37.8077	3	2175.936671	2175.937877	R	M	457	476
PSM	EQFLDGDGWTSR	963	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3689.4	43.03753	2	1489.583247	1489.587489	K	W	25	37
PSM	STETSDFENIESPLNERDSSASVDNR	964	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3547.3	39.43795	4	2978.231694	2978.241463	K	E	899	925
PSM	YQIDPDACFSAK	965	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3505.2	38.34745	3	1493.589371	1493.589797	K	V	225	237
PSM	YISPDQLADLYK	966	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4025.5	51.29099	2	1504.679847	1504.685078	R	S	270	282
PSM	GNPTVEVDLFTSK	967	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3927.3	49.0626	2	1565.638247	1565.641572	R	G	16	29
PSM	GTDDLNPVTSTPAKPSSPPPEFSFNTPGK	968	sp|Q6NXT4|ZNT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3842.2	46.91033	4	3144.364094	3144.373009	K	N	366	395
PSM	QQEPVTSTSLVFGK	969	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3578.2	40.19483	3	1599.750971	1599.754554	K	K	1107	1121
PSM	SLTNDWEDHLAVK	970	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3670.3	42.54015	3	1606.698671	1606.702853	K	H	315	328
PSM	VTNGAFTGEISPGMIK	971	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3747.2	44.52013	3	1700.784671	1700.784474	K	D	107	123
PSM	VTNGAFTGEISPGMIK	972	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3758.2	44.79597	3	1700.784671	1700.784474	K	D	107	123
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	973	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4341.2	56.57233	4	3537.362094	3537.370051	R	V	44	74
PSM	KYEMFAQTLQQSR	974	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3496.2	38.11272	3	1788.731471	1788.730738	R	G	754	767
PSM	DDGLFSGDPNWFPKK	975	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4073.3	52.40542	3	1801.767971	1801.771267	R	S	140	155
PSM	SGRNDGLLALSSPDAEEPQLPDGTGR	976	sp|O15027-5|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3789.5	45.6033	3	2731.241171	2731.245032	R	E	2242	2268
PSM	DMASPNWSILPEEER	977	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4133.2	53.48883	3	1852.769171	1852.770281	R	N	327	342
PSM	NQYDNDVTVWSPQGR	978	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	38.99947	3	1857.766571	1857.768307	R	I	4	19
PSM	GADFLVTEVENGGSLGSK	979	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4026.3	51.31365	3	1858.830971	1858.834990	K	K	189	207
PSM	GADFLVTEVENGGSLGSK	980	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3943.2	49.40195	3	1858.833671	1858.834990	K	K	189	207
PSM	RPPEPTTPWQEDPEPEDENLYEK	981	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3502.6	38.28193	3	2875.218371	2875.222566	K	N	47	70
PSM	AEELSPAALSPSLEPIR	982	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3973.4	50.07138	3	1938.872471	1938.874092	R	C	441	458
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	983	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3663.6	42.36808	4	3932.700094	3932.709658	K	T	6	40
PSM	QIESKTAFQEALDAAGDK	984	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3662.4	42.33597	3	2000.901671	2000.909217	K	L	4	22
PSM	DRDVTFSPATIENELIK	985	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4372.2	57.08868	3	2026.958771	2026.961253	K	F	46	63
PSM	DALGDSLQVPVSPSSTTSSR	986	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3624.4	41.37198	3	2082.941771	2082.947059	R	C	141	161
PSM	DNLTLWTSDQQDEEAGEGN	987	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3846.2	47.00918	3	2120.870171	2120.877051	R	-	228	247
PSM	DNLTLWTSDMQGDGEEQNK	988	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3797.3	45.8087	3	2179.928471	2179.932792	R	E	226	245
PSM	QFTPCQLLADHANSPNKK	989	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3492.2	38.00957	4	2227.948094	2227.948671	K	F	743	761
PSM	GFFICDQPYEPVSPYSCK	990	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4033.3	51.4543	3	2272.916471	2272.921045	R	E	676	694
PSM	VAASPKSPTAALNESLVECPK	991	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,9-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3581.5	40.28262	3	2328.045071	2328.047382	K	C	422	443
PSM	HNDDEQYAWESSAGGSFTVR	992	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3622.5	41.32592	3	2334.918671	2334.917884	K	T	154	174
PSM	DYEEVGVDSVEGEGEEEGEEY	993	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3770.4	45.10883	3	2347.891571	2347.897571	K	-	431	452
PSM	VKSATLSSTESTASEMQEEMK	994	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3451.5	36.96255	3	2353.006271	2353.006624	K	G	638	659
PSM	VPPAPVPCPPPSPGPSAVPSSPK	995	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3459.5	37.1711	3	2378.076371	2378.078288	K	S	366	389
PSM	DNLTLWTSDTQGDEAEAGEGGEN	996	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3926.4	49.04367	3	2407.983071	2407.988786	R	-	223	246
PSM	RGFFICDQPYEPVSPYSCK	997	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4,14-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3795.3	45.75672	3	2429.020271	2429.022156	R	E	675	694
PSM	ASTASPCNNNINAATAVALQEPR	998	sp|Q71RC2|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3586.4	40.41012	3	2449.105271	2449.105702	R	K	593	616
PSM	SQSSEGVSSLSSSPSNSLETQSQSLSR	999	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3456.6	37.09582	3	2835.240071	2835.240735	R	S	76	103
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1000	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3575.3	40.11977	5	3596.731118	3596.728741	K	-	244	278
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1001	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3832.2	46.65138	4	2881.088494	2881.094982	K	T	701	725
PSM	SNDSTEQNLSDGTPMPDSYPTTPSSTDAATSESK	1002	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3436.5	36.57472	4	3597.448094	3597.446172	K	E	2726	2760
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1003	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3574.4	40.097	5	3596.731118	3596.728741	K	-	244	278
PSM	DGDSYDPYDFSDTEEEMPQVHTPKTADSQETK	1004	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3791.6	45.65942	4	3821.442894	3821.448889	K	E	701	733
PSM	LSSSEETESTQCCPGSPVAQTESPCDLSSIVEEENTDR	1005	sp|Q12802|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:4,13-UNIMOD:4,23-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=1.1.3849.6	47.0999	4	4294.714894	4294.734903	R	S	330	368
PSM	VSMPDVELNLKSPK	1006	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	40.874	3	1636.788671	1635.794311	K	V	3415	3429
PSM	TPKTPKGPSSVEDIK	1007	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2971.4	24.60025	3	1744.792271	1742.789299	K	A	234	249
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	1008	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3290.5	32.81865	3	2660.147471	2660.147901	R	-	621	645
PSM	SSIGTGYDLSASTFSPDGR	1009	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.4025.4	51.28765	3	2038.8506	2038.8516	M	V	2	21
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	1010	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	19-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3414.5	36.03357	4	3037.294894	3037.291647	K	E	117	144
PSM	GPPQSPVFEGVYNNSR	1011	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3499.2	38.19055	3	1826.797571	1826.798879	K	M	107	123
PSM	SHPSPQAKPSNPSNPR	1012	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2649.2	17.81418	3	1821.8149	1821.8154	M	V	2	18
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1013	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3697.5	43.25213	3	2882.1601	2882.1618	M	D	2	29
PSM	MMCGAPSATQPATAETQHIADQVR	1014	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3825.4	46.4871	3	2772.1019	2772.1103	-	S	1	25
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPPKK	1015	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,25-UNIMOD:21	ms_run[1]:scan=1.1.4067.4	52.25533	4	3632.5516	3632.5562	M	D	2	33
PSM	AASEAAVVSSPSLK	1016	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3414.4	36.03023	2	1437.6731	1437.6747	M	T	2	16
PSM	MESAIAEGGASR	1017	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3533.4	39.08443	2	1299.5139	1299.5161	-	F	1	13
PSM	EAAGGNDSSGATSPINPAVALE	1018	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3767.3	45.0274	3	2106.906071	2106.910674	K	-	1236	1258
PSM	RSPTSSAIPLQSPR	1019	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3061.2	26.91033	3	1575.776471	1575.777021	K	N	1244	1258
PSM	RGSLSNAGDPEIVKSPSDPK	1020	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2982.3	24.882	4	2133.013694	2133.010328	R	Q	92	112
PSM	STTPPPAEPVSLPQEPPKPR	1021	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3269.3	32.26513	4	2204.091294	2204.087850	K	V	225	245
PSM	TPKTPKGPSSVEDIK	1022	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2899.4	22.74123	3	1662.822371	1662.822968	K	A	234	249
PSM	DDDRTPGLHGDCDDDKYR	1023	sp|O95159|ZFPL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2855.2	21.61478	4	2228.848494	2228.843005	R	R	219	237
PSM	VLLPEYGGTK	1024	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	36.17052	2	1155.558447	1155.557692	K	V	71	81
PSM	KISPFEHQTYCQR	1025	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3038.2	26.31555	3	1772.770871	1772.770556	K	T	55	68
PSM	WNSVSPASAGK	1026	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2982.5	24.88867	2	1182.506047	1182.507054	K	R	304	315
PSM	AGGSPAPGPETPAISPSK	1027	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3015.4	25.7427	3	1779.749471	1779.748163	K	R	85	103
PSM	VDSPTVTTTLK	1028	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3073.4	27.1901	2	1240.594047	1240.595200	K	N	458	469
PSM	LSLEGDHSTPPSAYGSVK	1029	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3263.5	32.11743	3	1923.860171	1923.861539	K	A	11	29
PSM	SSPNPFVGSPPK	1030	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3221.3	31.02593	2	1292.578647	1292.580219	K	G	393	405
PSM	EAENQGLDISSPGMSGHR	1031	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3152.3	29.22665	3	1963.809671	1963.809520	K	Q	191	209
PSM	GSLSNAGDPEIVKSPSDPK	1032	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3083.5	27.44618	3	1976.904671	1976.909217	R	Q	93	112
PSM	SERPPTILMTEEPSSPK	1033	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3366.5	34.78691	3	1977.907871	1977.911860	K	G	1080	1097
PSM	GINSSNVENQLQATQAAR	1034	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3381.3	35.16535	3	1979.906471	1979.906197	K	K	84	102
PSM	NLSPGAVESDVR	1035	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3389.3	35.37397	2	1322.581047	1322.586761	K	G	171	183
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1036	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2769.5	19.5263	4	2673.046494	2673.045055	K	G	134	157
PSM	ADGYEPPVQESV	1037	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3375.3	35.01073	2	1369.542647	1369.543893	R	-	253	265
PSM	SHSPSSPDPDTPSPVGDSR	1038	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2883.6	22.34413	3	2080.775771	2080.777625	R	A	616	635
PSM	AEGAATEEEGTPKESEPQAAAEPAEAK	1039	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2908.6	22.98033	4	2777.190894	2777.191659	K	E	26	53
PSM	NSGSFPSPSISPR	1040	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3318.6	33.55052	2	1411.619047	1411.613310	R	-	1258	1271
PSM	SSDQPLTVPVSPK	1041	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3277.4	32.477	2	1433.678447	1433.680327	K	F	728	741
PSM	NAEAVLQSPGLSGK	1042	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3240.4	31.52513	2	1449.684447	1449.686475	R	V	849	863
PSM	NAEAVLQSPGLSGK	1043	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3248.3	31.73047	2	1449.684447	1449.686475	R	V	849	863
PSM	NAPAAVDEGSISPR	1044	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3016.6	25.77535	2	1462.644247	1462.645338	R	T	373	387
PSM	VDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1045	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3399.6	35.6453	4	2925.351694	2925.350560	K	A	461	493
PSM	SLYASSPGGVYATR	1046	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3317.5	33.52139	2	1507.669847	1507.670825	R	S	51	65
PSM	APVPGTPDSLSSGSSR	1047	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3043.6	26.45722	2	1593.700847	1593.703581	K	D	322	338
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1048	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3199.6	30.46048	4	3197.256094	3197.249993	R	A	333	362
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	1049	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2952.5	24.11122	4	3200.389694	3200.389524	K	E	247	279
PSM	GRTVIIEQSWGSPK	1050	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	34.08238	3	1636.796171	1636.797422	K	V	59	73
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	1051	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3303.3	33.14888	3	2494.091471	2494.089063	R	L	815	839
PSM	GKGGEIQPVSVKVGDK	1052	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2987.4	25.01548	3	1676.850971	1676.849852	K	V	55	71
PSM	IDEMPEAAVKSTANK	1053	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3063.6	26.97363	2	1682.755447	1682.758653	R	Y	30	45
PSM	KPAAAAAPGTAEKLSPK	1054	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2792.2	20.05128	3	1686.869471	1686.870587	K	A	23	40
PSM	KYEMFAQTLQQSR	1055	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3424.2	36.26588	3	1708.767371	1708.764407	R	G	754	767
PSM	GQAAVQQLQAEGLSPR	1056	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3354.3	34.46833	3	1731.829571	1731.830513	R	F	43	59
PSM	ADLNQGIGEPQSPSRR	1057	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2973.5	24.65572	3	1803.826571	1803.826490	R	V	63	79
PSM	IGRIEDVTPIPSDSTR	1058	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3249.2	31.75305	3	1834.886171	1834.882608	K	R	126	142
PSM	DAGDKDKEQELSEEDK	1059	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2732.3	18.63327	3	1834.809071	1834.806846	R	Q	35	51
PSM	HTGPNSPDTANDGFVR	1060	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3048.3	26.5754	3	1843.692971	1843.692773	K	L	99	115
PSM	RLYPAVDEQETPLPR	1061	sp|Q96S59|RANB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3318.4	33.54385	3	1862.891171	1862.892779	K	S	153	168
PSM	SAPAMQSSGSFNYARPK	1062	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3166.5	29.5961	3	1877.815871	1877.813149	R	Q	719	736
PSM	MLDAEDIVNTARPDEK	1063	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3399.4	35.63863	3	1895.834471	1895.833609	K	A	240	256
PSM	GPSTPKSPGASNFSTLPK	1064	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3272.5	32.35025	3	1931.841971	1931.843126	R	I	223	241
PSM	SVSTPSEAGSQDSGDGAVGSR	1065	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2838.2	21.18367	3	2029.820171	2029.822587	K	T	92	113
PSM	GPSPSSPTPPAAAAPAEQAPR	1066	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3035.5	26.25468	3	2035.935971	2035.936435	R	A	103	124
PSM	NNDQPQSANANEPQDSTVNLQSPLK	1067	sp|P37275|ZEB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3386.2	35.29222	4	2788.235694	2788.230111	K	M	658	683
PSM	AADSSDSDGAEESPAEPGAPR	1068	sp|P16383|GCFC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2808.4	20.44303	3	2094.799271	2094.801517	R	E	13	34
PSM	KLSSWDQAETPGHTPSLR	1069	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3289.2	32.78273	4	2168.931694	2168.929315	K	W	214	232
PSM	DCNDTLEEENTNLETPTK	1070	sp|Q9BZE2|PUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3230.4	31.26362	3	2201.866871	2201.867154	R	R	452	470
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNETPK	1071	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3334.6	33.96735	4	4475.922894	4475.924947	K	K	106	153
PSM	YGVQADRVDKSAVGFDYQGK	1072	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	33.30887	4	2282.039694	2282.036877	K	T	162	182
PSM	HGGPGPGGPEPELSPITEGSEAR	1073	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3337.5	34.0409	3	2307.014171	2307.016870	R	A	554	577
PSM	LDNTPASPPRSPAEPNDIPIAK	1074	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3383.5	35.22393	3	2459.112671	2459.113487	K	G	2311	2333
PSM	ATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEK	1075	sp|O95361|TRI16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3386.5	35.30222	4	3545.517694	3545.520658	R	L	15	51
PSM	WLDDLLASPPPSGGGAR	1076	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4575.2	59.12352	3	1867.795271	1867.790696	R	R	684	701
PSM	DVQTALALAK	1077	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3628.2	41.46407	2	1108.553847	1108.552941	K	G	70	80
PSM	DLNVLTPTGF	1078	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4606.2	59.45727	2	1155.518247	1155.521307	R	-	296	306
PSM	IADPEHDHTGFLTEYVATR	1079	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3519.2	38.71328	4	2330.966094	2330.961009	R	W	190	209
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1080	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3443.3	36.74845	4	2378.083694	2378.078288	K	S	366	389
PSM	SADTLWGIQK	1081	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3660.2	42.27642	2	1197.539247	1197.543105	K	E	319	329
PSM	GTPLISPLIK	1082	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3929.2	49.11113	2	1197.578847	1197.581144	R	W	826	836
PSM	GTPLISPLIK	1083	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3939.2	49.32632	2	1197.578847	1197.581144	R	W	826	836
PSM	DSPSVWAAVPGK	1084	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3461.2	37.21357	2	1212.612447	1212.613888	K	T	27	39
PSM	EVSSLEGSPPPCLGQEEAVCTK	1085	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3494.2	38.06145	4	2453.053294	2453.049158	K	I	1388	1410
PSM	SLNILTAFQK	1086	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4852.2	61.80563	2	1293.574447	1293.577121	K	K	244	254
PSM	DLFSLDSEDPSPASPPLR	1087	sp|Q9BTK6|PAGR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4269.3	55.50113	3	2021.895071	2021.898318	R	S	224	242
PSM	TVIIEQSWGSPK	1088	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3534.4	39.11015	2	1423.670447	1423.674847	R	V	61	73
PSM	LLQCDPSSASQF	1089	sp|P84074|HPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3601.3	40.79967	2	1431.569647	1431.574147	R	-	182	194
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1090	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3578.5	40.20483	5	3596.731118	3596.728741	K	-	244	278
PSM	ATLPSPDKLPGFK	1091	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3601.2	40.79633	3	1449.725171	1449.726883	K	M	831	844
PSM	DVNSSSPVMLAFK	1092	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3597.4	40.69812	2	1489.647647	1489.652398	K	S	28	41
PSM	NQAIDACDANTTPGGVTDVIK	1093	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3502.3	38.27193	3	2238.978971	2238.982793	K	N	2144	2165
PSM	TSDIFGSPVTATSR	1094	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3504.6	38.33463	2	1517.675047	1517.676304	K	L	91	105
PSM	TSDIFGSPVTATSR	1095	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3496.5	38.12271	2	1517.675047	1517.676304	K	L	91	105
PSM	DSPESPFEVIIDK	1096	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4134.4	53.52522	2	1554.682247	1554.685472	K	A	242	255
PSM	AHASPFSGALTPSAPPGPEMNR	1097	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3548.4	39.46648	3	2350.978871	2350.980699	R	S	119	141
PSM	ALSSDSILSPAPDAR	1098	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3438.3	36.61967	2	1578.724847	1578.729068	R	A	392	407
PSM	KKSPNELVDDLFK	1099	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3676.2	42.6922	3	1611.789071	1611.790940	R	G	112	125
PSM	RASGQAFELILSPR	1100	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3737.2	44.27405	3	1623.812471	1623.813407	K	S	14	28
PSM	FSPVTPKFTPVASK	1101	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3510.2	38.47807	3	1664.761871	1664.761628	K	F	266	280
PSM	APNTPDILEIEFKK	1102	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3786.2	45.51633	3	1693.834871	1693.832805	K	G	216	230
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1103	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4243.3	55.0435	4	3425.451294	3425.458138	K	-	610	647
PSM	SSGSEGSSPNWLQALK	1104	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3941.2	49.3589	3	1726.756571	1726.756345	K	L	1708	1724
PSM	EAEQAASEAAGGDTTPGSSPSSLYYEEPLGQPPR	1105	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3750.6	44.60678	4	3528.513694	3528.520598	R	F	237	271
PSM	SYELPDGQVITIGNER	1106	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3854.3	47.21872	3	1789.882271	1789.884643	K	F	241	257
PSM	ASLGSLEGEAEAEASSPK	1107	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3608.3	40.97477	2	1811.773447	1811.782620	K	G	5748	5766
PSM	LSEKLDSTDFTGTIK	1108	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3551.3	39.54008	3	1813.778171	1813.778794	K	L	131	146
PSM	VLLPEYGGTKVVLDDK	1109	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3639.2	41.74128	3	1824.930071	1824.927433	K	D	71	87
PSM	NQLTSNPENTVFDAK	1110	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3500.5	38.2264	2	1836.731847	1836.733241	K	R	82	97
PSM	WLDDLLASPPPSGGGAR	1111	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4612.2	59.52305	3	1867.785671	1867.790696	R	R	684	701
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	1112	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:21,19-UNIMOD:21,30-UNIMOD:21	ms_run[1]:scan=1.1.3846.3	47.01252	4	3773.743694	3773.758037	R	Q	125	162
PSM	KYEQGFITDPVVLSPK	1113	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3704.2	43.42218	3	1899.938471	1899.938332	K	D	109	125
PSM	IDEPSTPYHSMMGDDEDACSDTEATEAMAPDILAR	1114	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.4064.6	52.18202	4	3920.533294	3920.541018	K	K	68	103
PSM	RYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQR	1115	sp|Q4V326|GAG2E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3741.5	44.38217	4	4076.822894	4076.828548	R	Q	16	51
PSM	DTQSPSTCSEGLLGWSQK	1116	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3831.3	46.62983	3	2059.849271	2059.855802	K	D	709	727
PSM	LTPSPDIIVLSDNEASSPR	1117	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3847.3	47.03858	3	2089.985771	2089.993281	R	S	119	138
PSM	DNLTLWTSDQQDDDGGEGNN	1118	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3877.4	47.81738	3	2192.864171	2192.873028	R	-	228	248
PSM	SSVSRVPCNVEGISPELEK	1119	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3502.4	38.27527	3	2245.970171	2245.969131	K	V	290	309
PSM	IADPEHDHTGFLTEYVATR	1120	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3703.2	43.39558	4	2250.997694	2250.994678	R	W	190	209
PSM	CSTAGSSPNSVSELSLASLTEK	1121	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3922.3	48.95868	3	2304.013571	2304.019238	K	I	355	377
PSM	DLYANTVLSGGTTMYPGIADR	1122	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3928.5	49.09217	3	2310.021671	2310.023930	K	M	292	313
PSM	EASRPPEEPSAPSPTLPAQFK	1123	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3450.4	36.93335	3	2315.079371	2315.083493	R	Q	351	372
PSM	ELSNSPLRENSFGSPLEFR	1124	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3981.2	50.21753	3	2337.999671	2338.003208	K	N	1316	1335
PSM	DYEEVGVDSVEGEGEEEGEEY	1125	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3762.4	44.90268	3	2347.891571	2347.897571	K	-	431	452
PSM	DYEEVGVDSVEGEGEEEGEEY	1126	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3787.5	45.5551	3	2427.863171	2427.863902	K	-	431	452
PSM	NALFPEVFSPTPDENSDQNSR	1127	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4200.3	54.50605	3	2443.030271	2443.032914	R	S	567	588
PSM	EGPYSISVLYGDEEVPRSPFK	1128	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3995.3	50.57497	3	2448.119171	2448.125024	R	V	1516	1537
PSM	ASKPLPPAPAPDEYLVSPITGEK	1129	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3637.5	41.69917	3	2456.220971	2456.224009	K	I	397	420
PSM	ASYHFSPEELDENTSPLLGDAR	1130	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3839.5	46.83953	3	2527.078871	2527.090429	K	F	262	284
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	1131	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3799.5	45.86367	3	2644.234271	2644.238156	R	L	55	81
PSM	DLGLPTEAYISVEEVHDDGTPTSK	1132	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4030.3	51.37967	3	2652.177671	2652.184389	K	T	130	154
PSM	MTNNEDSLSPTSSTLSNLELDAAEK	1133	sp|Q9ULH7|MRTFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4001.4	50.73107	3	2746.183871	2746.189217	R	D	535	560
PSM	TLPLTTAPEAGEVTPSDSGGQEDSPAK	1134	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3555.6	39.65508	3	2814.178271	2814.188562	K	G	2233	2260
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1135	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3596.6	40.67875	3	2897.083271	2897.089897	K	T	701	725
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1136	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3544.2	39.35925	5	2989.538618	2989.541321	K	G	202	228
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1137	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3536.2	39.1556	5	2989.538618	2989.541321	K	G	202	228
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1138	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3465.5	37.3243	4	3459.428094	3459.429735	K	L	104	135
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	1139	sp|Q12906-4|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	32-UNIMOD:21	ms_run[1]:scan=1.1.3754.6	44.70727	4	4535.102894	4535.111625	R	Q	475	520
PSM	SAESPTSPVTSETGSTFKK	1140	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3278.5	32.5067	3	2100.871271	2099.870128	K	F	280	299
PSM	DDDIAALVVDNGSGMCK	1141	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4206.2	54.57555	3	1916.7485	1916.7528	M	A	2	19
PSM	QSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN	1142	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4149.2	53.75907	4	3812.599294	3812.606179	K	-	172	207
PSM	MEGPLSVFGDR	1143	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4262.3	55.34195	2	1344.5367	1344.5416	-	S	1	12
PSM	MEGPLSVFGDR	1144	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4239.2	54.97837	2	1345.5412	1344.5412	-	S	1	12
PSM	RLQEDPNYSPQRFPNAQR	1145	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3110.4	28.14495	4	2295.056094	2295.054593	K	A	1109	1127
PSM	ASGVAVSDGVIK	1146	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3516.3	38.63843	2	1223.5756	1223.5794	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1147	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3868.4	47.59072	3	2749.2250	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1148	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3712.5	43.63827	3	2845.1851	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1149	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4043.2	51.70175	3	2829.1894	2829.1964	-	Y	1	25
PSM	WPDPEDLLTPR	1150	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4100.3	52.94725	2	1418.626847	1417.627897	R	W	39	50
PSM	MTEWETAAPAVAETPDIK	1151	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4338.2	56.51817	3	2080.8997	2080.9059	-	L	1	19
PSM	AENVVEPGPPSAK	1152	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3242.4	31.57763	2	1415.6332	1415.6329	M	R	2	15
PSM	SCINLPTVLPGSPSK	1153	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4143.2	53.6993	2	1690.7927	1690.7996	M	T	2	17
PSM	CNTPTYCDLGK	1154	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3355.6	34.50477	2	1449.5273	1449.5300	M	A	2	13
PSM	NGSLDSPGKQDTEEDEEEDEK	1155	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2890.6	22.51643	3	2430.903671	2429.923149	K	D	134	155
PSM	DTCYSPKPSVYLSTPSSASK	1156	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21,3-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3425.6	36.30312	3	2333.952071	2333.952813	K	A	538	558
PSM	SCTPSPDQISHR	1157	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2836.3	21.1374	3	1463.586071	1463.586443	R	A	271	283
PSM	GAVDGGLSIPHSTK	1158	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3272.3	32.34358	3	1497.624071	1497.626591	K	R	165	179
PSM	TPEPSSPVKEPPPVLAKPK	1159	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3059.3	26.86188	4	2077.088494	2077.086059	K	L	639	658
PSM	ACKVDSPTVNTTLR	1160	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2994.3	25.19343	3	1640.759471	1640.759322	K	S	440	454
PSM	GGNFGGRSSGPYGGGGQYFAKPR	1161	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	31.23115	4	2353.043694	2353.038943	K	N	330	353
PSM	DPNSPLYSVK	1162	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3227.5	31.18887	2	1198.526247	1198.527120	R	S	82	92
PSM	GGLGAPPLQSAR	1163	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3172.3	29.7454	2	1202.578247	1202.580887	R	S	88	100
PSM	SASWGSADQLK	1164	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3280.2	32.54853	2	1228.510047	1228.512533	R	E	221	232
PSM	NKSPAAVTEPETNKFDSTGYDK	1165	sp|O75449|KTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3108.4	28.09197	4	2478.100094	2478.095180	K	D	168	190
PSM	STGCDFAVSPK	1166	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3084.5	27.4717	2	1247.488847	1247.489355	K	L	501	512
PSM	ALINSPEGAVGR	1167	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3294.4	32.92	2	1262.600247	1262.602017	R	S	66	78
PSM	VLDTSSLTQSAPASPTNK	1168	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3245.3	31.65245	3	1895.890871	1895.887753	R	G	850	868
PSM	LDIDSPPITAR	1169	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3416.3	36.07705	2	1276.605247	1276.606433	R	N	33	44
PSM	SSPNPFVGSPPK	1170	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3213.6	30.82695	2	1292.578647	1292.580219	K	G	393	405
PSM	TRSWDSSSPVDRPEPEAASPTTR	1171	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3092.4	27.67487	4	2608.160494	2608.155489	R	T	352	375
PSM	NGLAAELGPASPR	1172	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3315.5	33.46962	2	1331.621647	1331.623480	R	R	91	104
PSM	KQSKPVTTPEEIAQVATISANGDK	1173	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3396.3	35.55672	4	2671.247694	2671.250709	K	E	157	181
PSM	AIGSASEGAQSSLQEVYHK	1174	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3375.2	35.0074	3	2040.918071	2040.915365	R	S	169	188
PSM	STNEAMEWMNNK	1175	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3407.4	35.84775	2	1453.595847	1453.596599	K	L	737	749
PSM	TPEKLDNTPASPPRSPAEPNDIPIAK	1176	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3312.6	33.39448	4	2914.347694	2914.351486	K	G	2307	2333
PSM	YLLGDAPVSPSSQK	1177	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3410.4	35.92605	2	1540.714447	1540.717440	K	L	195	209
PSM	SCTPSPDQISHR	1178	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2872.3	22.05635	3	1543.552571	1543.552774	R	A	271	283
PSM	CPNLTHLNLSGNK	1179	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3269.2	32.2618	3	1546.697771	1546.696328	K	I	87	100
PSM	PFSAPKPQTSPSPK	1180	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2927.2	23.45898	3	1547.740871	1547.738510	K	R	299	313
PSM	NGRVEIIANDQGNR	1181	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2891.4	22.5358	3	1554.784871	1554.786266	K	I	47	61
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1182	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3145.6	29.05578	4	3117.283294	3117.283662	R	A	333	362
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	1183	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	27-UNIMOD:21	ms_run[1]:scan=1.1.2889.6	22.49118	4	3173.327294	3173.326984	K	E	337	367
PSM	NRVIGSGCNLDSAR	1184	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2948.3	24.00387	3	1597.704971	1597.703204	K	F	156	170
PSM	VAAETQSPSLFGSTK	1185	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3341.5	34.143	2	1601.730847	1601.733819	K	L	215	230
PSM	ELQAAGKSPEDLER	1186	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3003.3	25.42598	3	1621.731671	1621.734881	K	L	448	462
PSM	SVTEQGAELSNEER	1187	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3011.2	25.63148	3	1627.672871	1627.672675	K	N	28	42
PSM	KKAEPSEVDMNSPK	1188	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2743.2	18.89553	3	1638.730571	1638.732439	K	S	60	74
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1189	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3156.6	29.3405	4	3290.600894	3290.597273	K	E	178	210
PSM	ADLNQGIGEPQSPSR	1190	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3066.5	27.04357	2	1647.723047	1647.725379	R	R	63	78
PSM	SAMPFTASPASSTTAR	1191	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3356.2	34.51737	3	1661.712671	1661.712038	R	V	123	139
PSM	ESVPEFPLSPPKKK	1192	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3346.2	34.25818	3	1661.842571	1661.842975	K	D	30	44
PSM	SAPASPTHPGLMSPR	1193	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3134.2	28.75522	3	1664.680271	1664.678309	R	S	416	431
PSM	DYTGCSTSESLSPVK	1194	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3157.6	29.3665	2	1709.685247	1709.685548	R	Q	199	214
PSM	QNSVQEQPGTACLSK	1195	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2900.4	22.76727	3	1725.735371	1725.739315	K	F	223	238
PSM	ALSRQEMQEVQSSR	1196	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2943.2	23.86767	3	1727.766671	1727.766198	K	S	187	201
PSM	QEDSESSEEESDSEEAAASPAQVK	1197	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2929.5	23.52087	3	2617.998071	2618.002856	K	T	759	783
PSM	FSEGVLQSPSQDQEK	1198	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3226.3	31.15632	3	1757.753471	1757.750926	R	L	428	443
PSM	DAPTSPASVASSSSTPSSK	1199	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2932.5	23.59687	2	1842.781047	1842.788433	K	T	282	301
PSM	SGKYDLDFKSPDDPSR	1200	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3212.5	30.79715	3	1905.816371	1905.814588	R	Y	254	270
PSM	GNKSPSPPDGSPAATPEIR	1201	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3009.4	25.58608	3	1956.895271	1956.894236	K	V	293	312
PSM	TPSPKEEDEEPESPPEK	1202	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2798.3	20.19923	3	2003.821871	2003.824878	K	K	202	219
PSM	SPAVATSTAAPPPPSSPLPSK	1203	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3125.6	28.54015	2	2038.995447	2038.997638	K	S	439	460
PSM	GPPASSPAPAPKFSPVTPK	1204	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	34.41623	3	2071.878671	2071.882228	R	F	254	273
PSM	NVASGGGGVGDGVQEPTTGNWR	1205	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3333.3	33.931	3	2193.940571	2193.944040	K	G	569	591
PSM	NTNDANSCQIIIPQNQVNR	1206	sp|P31150|GDIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3257.2	31.9559	3	2198.050871	2198.049828	K	K	310	329
PSM	KVEEEGSPGDPDHEASTQGR	1207	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2671.2	18.05933	4	2203.906094	2203.901900	R	T	309	329
PSM	DLHQPSLSPASPHSQGFER	1208	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3301.4	33.10077	3	2248.930871	2248.930378	K	G	58	77
PSM	WLNSGRGDEASEEGQNGSSPK	1209	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2962.6	24.3734	3	2283.940271	2283.939348	R	S	447	468
PSM	DGVVEITGKHEERQDEHGYISR	1210	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3010.2	25.6056	5	2553.228618	2553.220792	K	C	115	137
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1211	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3235.4	31.39473	4	2637.349294	2637.341499	R	R	31	56
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	1212	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3185.6	30.09442	4	2692.287294	2692.288766	R	Q	24	52
PSM	SSSSVTTSETQPCTPSSSDYSDLQR	1213	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3219.6	30.9834	3	2786.120471	2786.122594	K	V	322	347
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	1214	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3257.3	31.95923	4	3156.401294	3156.395856	K	G	306	335
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	1215	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3235.6	31.4014	4	3351.402894	3351.401211	R	A	108	139
PSM	APNTPDILEIEFKK	1216	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3794.2	45.72395	3	1693.832471	1693.832805	K	G	216	230
PSM	ESAFEFLSSA	1217	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4848.2	61.7614	2	1166.449847	1166.453287	K	-	325	335
PSM	DIDISSPEFK	1218	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3564.2	39.86777	2	1229.518647	1229.521701	K	I	172	182
PSM	SADTLWDIQK	1219	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3729.4	44.07608	2	1255.545247	1255.548584	K	D	320	330
PSM	NLFEDQNTLTSICEK	1220	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3833.2	46.6763	3	1890.799271	1890.807061	K	V	332	347
PSM	LDIDSPPITAR	1221	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3491.3	37.98652	2	1276.606847	1276.606433	R	N	33	44
PSM	NLEELNISSAQ	1222	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3672.4	42.59493	2	1296.557047	1296.559877	K	-	120	131
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	1223	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3463.3	37.26847	5	3265.401618	3265.402471	K	-	708	738
PSM	SAESPTSPVTSETGSTFK	1224	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3455.6	37.07023	3	1971.776771	1971.775165	K	K	280	298
PSM	LSELVQAVSDPSSPQYGK	1225	sp|O14773|TPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	40.015	3	1983.919271	1983.919054	R	Y	61	79
PSM	TVDSQGPTPVCTPTFLER	1226	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3683.2	42.87458	3	2083.925171	2083.928573	K	R	227	245
PSM	NLSSPFIFHEK	1227	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3643.3	41.84903	2	1397.635247	1397.638068	R	T	644	655
PSM	DVEDFLSPLLGK	1228	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.5854.2	69.06664	2	1411.657647	1411.663614	K	T	123	135
PSM	DLPTIPGVTSPSSDEPPMEASQSHLR	1229	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3894.3	48.2456	4	2827.269694	2827.273555	R	N	74	100
PSM	PVQETQAPESPGENSEQALQTLSPR	1230	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3527.2	38.9214	4	2852.2200	2852.2262	M	A	2	27
PSM	DILAQSPAAEPLK	1231	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3453.4	37.01138	2	1431.698247	1431.701062	K	N	1232	1245
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1232	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	33-UNIMOD:21	ms_run[1]:scan=1.1.3576.5	40.15275	5	3596.731118	3596.728741	K	-	244	278
PSM	LFMAQALQEYNN	1233	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3955.6	49.68572	2	1440.664647	1440.670751	K	-	341	353
PSM	EFSPFGTITSAK	1234	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4077.3	52.50107	2	1443.568247	1443.572430	K	V	313	325
PSM	EFSPFGTITSAK	1235	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4069.2	52.2911	2	1443.568247	1443.572430	K	V	313	325
PSM	SVWGSLAVQNSPK	1236	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3638.2	41.71562	2	1451.678047	1451.680995	K	G	343	356
PSM	DFTPVCTTELGR	1237	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3545.5	39.39407	2	1474.611847	1474.616346	R	A	42	54
PSM	GALQNIIPASTGAAK	1238	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3520.4	38.74627	2	1490.744847	1490.749409	R	A	201	216
PSM	GDGSPSPEYTLFR	1239	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3761.4	44.8773	2	1504.620247	1504.623540	R	L	293	306
PSM	TLEAEFNSPSPPTPEPGEGPR	1240	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3522.5	38.80182	3	2287.994471	2287.999823	K	K	525	546
PSM	ESMCSTPAFPVSPETPYVK	1241	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21,3-UNIMOD:35,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3764.4	44.95995	3	2301.889271	2301.897606	K	T	839	858
PSM	DEILPTTPISEQK	1242	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3456.4	37.08915	2	1549.725447	1549.727671	K	G	215	228
PSM	TPSSDVLVFDYTK	1243	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	48.71575	3	1550.690471	1550.690557	K	H	144	157
PSM	DSPESPFEVIIDK	1244	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4108.4	53.1175	2	1554.682247	1554.685472	K	A	242	255
PSM	TKEVYELLDSPGK	1245	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3475.2	37.56558	3	1557.733871	1557.732756	K	V	18	31
PSM	GNPTVEVDLFTSK	1246	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3937.3	49.26737	2	1565.638247	1565.641572	R	G	16	29
PSM	LPSSPVYEDAASFK	1247	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3595.5	40.6487	2	1589.697247	1589.701456	R	A	415	429
PSM	DVTPPPETEVVLIK	1248	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	45.87967	3	1615.810571	1615.811007	K	N	519	533
PSM	DMESPTKLDVTLAK	1249	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	37.87848	3	1626.761771	1626.757591	K	D	277	291
PSM	LTFDTTFSPNTGKK	1250	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3445.2	36.79643	3	1635.753371	1635.754554	K	S	108	122
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRKAER	1251	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3912.2	48.69921	4	3465.543694	3465.549076	R	T	139	169
PSM	RLEENDDDAYLNSPWADNTALK	1252	sp|P57076|CF298_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3710.6	43.59065	3	2629.129571	2629.133357	K	R	255	277
PSM	AAALAAAVAQDPAASGAPSS	1253	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3471.2	37.46393	3	1775.806271	1775.809109	R	-	203	223
PSM	ISLPGQMAGTPITPLK	1254	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3955.3	49.67572	3	1782.834071	1782.839226	K	D	213	229
PSM	LEFQQQLGEAPSDASP	1255	sp|Q9BUW7|CI016_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3744.5	44.45582	2	1795.761247	1795.766576	R	-	68	84
PSM	VSSGYVPPPVATPFSSK	1256	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3525.2	38.86942	3	1798.853771	1798.854268	R	S	168	185
PSM	VSSGYVPPPVATPFSSK	1257	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3517.3	38.66437	3	1798.853771	1798.854268	R	S	168	185
PSM	SATSSSPGSPLHSLETSL	1258	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3983.2	50.27225	3	1836.813971	1836.814254	K	-	1203	1221
PSM	NQYDNDVTVWSPQGR	1259	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3506.4	38.38012	3	1857.766571	1857.768307	R	I	4	19
PSM	DGKTLNDELEIIEGMK	1260	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4283.2	55.64807	3	1883.854271	1883.858761	K	F	203	219
PSM	FDRGYISPYFINTSK	1261	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3759.3	44.82413	3	1886.859971	1886.860416	K	G	219	234
PSM	FDRGYISPYFINTSK	1262	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3751.3	44.6215	3	1886.859971	1886.860416	K	G	219	234
PSM	KTDPSSLGATSASFNFGK	1263	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3456.2	37.08249	3	1893.848171	1893.850974	K	K	258	276
PSM	PEIVDTCSLASPASVCR	1264	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3530.3	39.0028	3	1940.8346	1940.8368	M	T	2	19
PSM	NVSSFPDDATSPLQENR	1265	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3433.6	36.49952	3	1955.827871	1955.826216	R	N	52	69
PSM	DFAARSPSASITDEDSNV	1266	sp|Q86W92|LIPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3454.6	37.04424	2	1960.801647	1960.805146	K	-	994	1012
PSM	SVPTSTVFYPSDGVATEK	1267	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3612.4	41.07656	3	1963.875971	1963.881605	R	A	439	457
PSM	MASPPAPSPAPPAISPIIK	1268	sp|Q00587|BORG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3853.2	47.19298	3	2000.939471	2000.944754	R	N	99	118
PSM	TVQGPPTSDDIFEREYK	1269	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3515.6	38.6223	3	2060.908871	2060.909217	K	Y	33	50
PSM	LSGSNPYTTVTPQIINSK	1270	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3639.3	41.74462	3	2078.931371	2078.932669	K	W	605	623
PSM	CTNSEVTVQPSPYLSYR	1271	sp|O75794|CD123_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3544.3	39.36258	3	2079.893171	2079.897273	R	L	289	306
PSM	VEIIANDQGNRTTPSYVAFTDTER	1272	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3650.4	42.03005	4	2776.263294	2776.270519	K	L	26	50
PSM	PVTTPEEIAQVATISANGDK	1273	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3726.3	43.9947	3	2120.006171	2120.003846	K	E	161	181
PSM	YESQEPLAGQESPLPLATR	1274	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3613.5	41.10452	3	2165.001071	2165.004180	R	E	590	609
PSM	DKPTYDEIFYTLSPVNGK	1275	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3984.3	50.30113	3	2165.988671	2165.992219	K	I	444	462
PSM	CGNTIPDDDNQVVSLSPGSR	1276	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3435.3	36.54185	3	2209.931471	2209.931092	R	Y	643	663
PSM	NDSPTQIPVSSDVCRLTPA	1277	sp|Q8TC07|TBC15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3673.4	42.62052	3	2215.916471	2215.922181	R	-	673	692
PSM	AGSPRGSPLAEGPQAFFPER	1278	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3947.3	49.50928	3	2229.955871	2229.960950	R	G	181	201
PSM	VPADTEVVCAPPTAYIDFAR	1279	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4106.3	53.0563	3	2271.025871	2271.028287	K	Q	71	91
PSM	VPADTEVVCAPPTAYIDFAR	1280	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4074.3	52.42105	3	2271.025871	2271.028287	K	Q	71	91
PSM	EIFDSRGNPTVEVDLFTSK	1281	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4314.2	56.08228	3	2312.989271	2312.996726	R	G	10	29
PSM	GRLTPSPDIIVLSDNEASSPR	1282	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3812.4	46.19098	3	2383.075271	2383.082187	R	S	117	138
PSM	DAEKTPAVSISCLELSNNLEK	1283	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3832.4	46.65805	3	2397.110471	2397.113473	K	K	458	479
PSM	QLSSTSPLAPYPTSQMVSSDR	1284	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3780.4	45.36707	3	2411.007071	2411.011724	R	S	408	429
PSM	FNEEHIPDSPFVVPVASPSGDAR	1285	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3804.4	45.98988	3	2546.143871	2546.147884	K	R	2311	2334
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1286	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3443.6	36.75845	3	2619.212471	2619.213536	R	D	175	200
PSM	DLGLPTEAYISVEEVHDDGTPTSK	1287	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4038.3	51.58565	3	2652.177671	2652.184389	K	T	130	154
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1288	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3460.5	37.1967	3	2719.175771	2719.173915	K	S	97	122
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1289	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3813.5	46.219	3	2881.086671	2881.094982	K	T	701	725
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	1290	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3575.6	40.12977	3	2964.312371	2964.313840	K	-	178	207
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1291	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3728.5	44.05318	4	3385.513694	3385.515651	K	A	399	429
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	1292	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4093.2	52.78828	4	3450.454894	3450.464132	R	-	226	256
PSM	QSKPVTTPEEIAQVATISANGDK	1293	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,18-UNIMOD:21	ms_run[1]:scan=1.1.3715.3	43.70768	3	2446.1554	2446.1623	K	E	158	181
PSM	NMAPGAVCSPGESK	1294	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2732.4	18.63993	2	1499.576047	1499.578581	R	E	1289	1303
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1295	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3971.3	50.0272	4	3523.450494	3522.472617	K	F	604	634
PSM	RADLNQGIGEPQSPSR	1296	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2959.3	24.28613	4	1804.830494	1803.826490	R	R	62	78
PSM	AESSESFTMASSPAQR	1297	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3199.3	30.45048	3	1822.7123	1822.7076	M	R	2	18
PSM	AESSESFTMASSPAQR	1298	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3454.5	37.0409	2	1806.7115	1806.7126	M	R	2	18
PSM	AETLPGSGDSGPGTASLGPGVAETGTR	1299	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3719.4	43.81472	3	2563.1402	2563.1434	M	R	2	29
PSM	ASGVAVSDGVIK	1300	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3373.2	34.95682	2	1143.6141	1143.6130	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1301	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3638.6	41.72895	3	2765.2213	2765.2250	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1302	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3720.5	43.84423	3	2845.1869	2845.1913	-	Y	1	25
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1303	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3699.5	43.30195	4	2882.1882	2882.1622	M	D	2	29
PSM	MQELTLSPGPAK	1304	sp|Q93015-2|NAA80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3906.4	48.55617	2	1392.6301	1392.6355	-	L	1	13
PSM	ADSGTAGGAALAAPAPGPGSGGPGPR	1305	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3391.6	35.43565	3	2238.0049	2238.0061	M	V	2	28
PSM	SGLTVPTSPK	1306	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3085.3	27.49123	2	1065.509047	1065.510742	R	G	87	97
PSM	AAHSEGNTTAGLDMR	1307	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2905.3	22.89262	3	1609.653971	1609.655585	R	E	467	482
PSM	HRVIGSGCNLDSAR	1308	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2852.3	21.54225	3	1620.722171	1620.719189	K	F	157	171
PSM	WLKSPTTPIDPEK	1309	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3410.2	35.91938	3	1670.738771	1670.735807	K	Q	859	872
PSM	KQPPVSPGTALVGSQK	1310	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3059.5	26.86855	3	1672.852571	1672.854937	R	E	31	47
PSM	QTSSTPSSLALTSASR	1311	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	29.69335	3	1672.762571	1672.766910	K	I	859	875
PSM	WDQTADQTPGATPK	1312	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2936.3	23.68962	3	1674.632471	1674.632799	R	K	200	214
PSM	NLQTVNVDEN	1313	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3066.2	27.03357	2	1144.536447	1144.536031	K	-	116	126
PSM	RLQEDPNYSPQRFPNAQR	1314	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3101.3	27.9066	4	2295.056094	2295.054593	K	A	1109	1127
PSM	KKPRPPPALGPEETSASAGLPK	1315	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3053.3	26.70478	4	2307.1992941913204	2307.1987970448195	K	K	14	36
PSM	QLSSGVSEIR	1316	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3137.5	28.84352	2	1154.533047	1154.533268	R	H	80	90
PSM	LKGEATVSFDDPPSAK	1317	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3166.3	29.58943	3	1740.796571	1740.797147	K	A	333	349
PSM	LALGDDSPALK	1318	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3338.4	34.06352	2	1178.556647	1178.558421	R	E	87	98
PSM	GNDPLTSSPGR	1319	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2917.4	23.20672	2	1179.491447	1179.492132	R	S	20	31
PSM	HLGGSGSVVPGSPCLDR	1320	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3239.3	31.49582	3	1773.788471	1773.786934	R	H	1303	1320
PSM	LKGEATVSFDDPPSAK	1321	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3241.3	31.54807	3	1820.766971	1820.763478	K	A	333	349
PSM	ADTSQEICSPRLPISASHSSK	1322	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3303.2	33.14555	4	2430.034094	2430.028771	K	T	1020	1041
PSM	EAESSPFVER	1323	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3003.4	25.42932	2	1229.495847	1229.496549	K	L	548	558
PSM	NCQTVLAPCSPNPCENAAVCK	1324	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3286.2	32.70427	4	2468.999694	2468.994638	K	E	829	850
PSM	DGNGYISAAELR	1325	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3378.3	35.08728	2	1264.603047	1264.604780	K	H	96	108
PSM	VKLESPTVSTLTPSSPGK	1326	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3324.3	33.69617	3	1906.961771	1906.965275	R	L	290	308
PSM	NFSDNQLQEGK	1327	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2964.6	24.42583	2	1278.582847	1278.584044	R	N	161	172
PSM	GGSGSGPTIEEVD	1328	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3271.4	32.32027	2	1283.491447	1283.491857	K	-	629	642
PSM	HARPPDPPASAPPDSSSNSASQDTK	1329	sp|Q15642|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2759.2	19.26292	4	2596.118094	2596.119103	R	E	486	511
PSM	ELEKPIQSKPQSPVIQAAAVSPK	1330	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3218.5	30.9546	4	2604.299294	2604.296537	R	F	207	230
PSM	AGGPTTPLSPTR	1331	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2915.6	23.162	2	1313.539847	1313.541799	R	L	15	27
PSM	PAEKPAETPVATSPTATDSTSGDSSR	1332	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2877.6	22.19217	4	2639.158094	2639.159965	K	S	148	174
PSM	TYGEPESAGPSR	1333	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2814.4	20.59642	2	1329.521847	1329.523826	R	A	104	116
PSM	SHSPSSPDPDTPSPVGDSR	1334	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2837.5	21.16957	3	2000.811371	2000.811294	R	A	616	635
PSM	LSLEGDHSTPPSAYGSVK	1335	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3367.2	34.8033	3	2003.829971	2003.827870	K	A	11	29
PSM	QEMQEVQSSRSGRGGNFGFGDSR	1336	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:35,9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3145.5	29.05245	4	2691.055294	2691.053423	R	G	191	214
PSM	KSQIFSTASDNQPTVTIK	1337	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3312.4	33.38782	3	2043.985871	2043.987802	K	V	447	465
PSM	ISVYYNEATGGK	1338	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3187.2	30.13398	2	1380.595047	1380.596263	R	Y	47	59
PSM	QAGGFLGPPPPSGK	1339	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3282.2	32.60092	2	1388.646247	1388.648967	K	F	224	238
PSM	EMPQDLRSPARTPPSEEDSAEAER	1340	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.2954.5	24.16298	4	2793.188894	2793.191283	K	L	70	94
PSM	GGNFGGRSSGPYGGGGQYFAK	1341	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3309.5	33.3122	3	2099.883071	2099.885068	K	P	278	299
PSM	EGLELPEDEEEK	1342	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3284.3	32.65572	2	1415.629447	1415.630385	K	K	412	424
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	1343	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3238.6	31.47957	4	2838.182094	2838.177635	K	M	23	49
PSM	SAHATAPVNIAGSR	1344	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2962.2	24.36007	3	1430.667971	1430.666742	R	T	2343	2357
PSM	RAPSTSPSFEGTQETYTVAHEENVR	1345	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3259.3	32.01898	4	2872.267294	2872.266496	R	F	75	100
PSM	DNPGVVTCLDEAR	1346	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3313.5	33.41748	2	1444.658247	1444.661643	K	H	227	240
PSM	EALSPCPSTVSTK	1347	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2972.3	24.63247	2	1455.630247	1455.631662	R	S	670	683
PSM	GASQAGMTGYGMPR	1348	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3251.4	31.81207	2	1462.574247	1462.573436	R	Q	183	197
PSM	SKPIPIMPASPQK	1349	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3186.2	30.1082	3	1472.743271	1472.746238	K	G	607	620
PSM	KLEDVKNSPTFK	1350	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2890.3	22.50643	3	1484.727671	1484.727611	K	S	164	176
PSM	LVEDERSDREETESSEGEEAAAGGGAK	1351	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2865.3	21.87582	4	2967.164894	2967.165595	K	S	335	362
PSM	NSGSFPSPSISPR	1352	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3383.3	35.21727	2	1491.576647	1491.579641	R	-	1258	1271
PSM	AEEDEILNRSPR	1353	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3048.2	26.57207	3	1507.667171	1507.666802	K	N	574	586
PSM	AFGPGLQGGSAGSPAR	1354	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3184.4	30.06208	2	1508.675647	1508.677307	K	F	1072	1088
PSM	SSDQPLTVPVSPK	1355	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3340.5	34.11798	2	1513.642847	1513.646658	K	F	728	741
PSM	EFHLNESGDPSSK	1356	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3092.2	27.6682	3	1525.608671	1525.608618	K	S	165	178
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	1357	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21,21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3424.6	36.27922	4	3071.302094	3071.294441	R	V	221	251
PSM	KYSPGYNTEVGDK	1358	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2908.4	22.97367	3	1536.647471	1536.649755	R	W	338	351
PSM	DAGGPRPESPVPAGR	1359	sp|Q9BVG9|PTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2798.2	20.1959	3	1541.700671	1541.698771	R	A	8	23
PSM	VPSPLEGSEGDGDTD	1360	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3301.5	33.1041	2	1553.575847	1553.577043	K	-	413	428
PSM	FLMECRNSPVTK	1361	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3129.5	28.63762	2	1560.682047	1560.682986	K	T	58	70
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1362	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3147.4	29.10123	4	3290.600894	3290.597273	K	E	178	210
PSM	ESVPEFPLSPPKKK	1363	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3338.2	34.05685	3	1661.842571	1661.842975	K	D	30	44
PSM	AAFTTPDHAPLSPQSSVASSGSEQTEEQGSSR	1364	sp|Q5PRF9|SMAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3331.6	33.88932	4	3325.436894	3325.437203	R	N	260	292
PSM	SVSSNVASVSPIPAGSK	1365	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3148.5	29.13047	2	1665.794847	1665.797482	R	K	412	429
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	1366	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3243.6	31.61025	4	3351.402894	3351.401211	R	A	108	139
PSM	NQLTSNPENTVFDAK	1367	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3347.6	34.2967	2	1676.799247	1676.800579	K	R	82	97
PSM	GEPAAAAAPEAGASPVEK	1368	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2944.2	23.8933	3	1701.763571	1701.761096	K	E	88	106
PSM	KVPQVSTPTLVEVSR	1369	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	34.5728	3	1718.894771	1718.896802	K	N	438	453
PSM	FSEGVLQSPSQDQEK	1370	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3242.3	31.5743	3	1757.753471	1757.750926	R	L	428	443
PSM	ERAMSTTSISSPQPGK	1371	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2701.2	18.3254	3	1771.779071	1771.781180	K	L	265	281
PSM	DVQDSLTVSNEAQTAK	1372	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3166.4	29.59277	3	1784.784671	1784.782954	K	E	211	227
PSM	VLGSEGEEEDEALSPAK	1373	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3198.6	30.4341	2	1838.778447	1838.782285	R	G	63	80
PSM	AVEHINKTIAPALVSK	1374	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3194.5	30.3271	3	1849.909571	1849.910417	K	K	65	81
PSM	NIGRDTPTSAGPNSFNK	1375	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3011.3	25.63482	3	1854.824771	1854.826156	K	G	134	151
PSM	QLVRGEPNVSYICSR	1376	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3275.2	32.41828	3	1856.860571	1856.860433	K	Y	269	284
PSM	VKLESPTVSTLTPSSPGK	1377	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3325.3	33.72257	3	1986.927671	1986.931606	R	L	290	308
PSM	TQPDGTSVPGEPASPISQR	1378	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3138.3	28.86312	3	2002.901171	2002.899715	R	L	1744	1763
PSM	LSSWDQAETPGHTPSLR	1379	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3408.5	35.87691	3	2040.837071	2040.834352	K	W	215	232
PSM	KPVTVSPTTPTSPTEGEAS	1380	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3024.4	25.97578	3	2044.864271	2044.864315	R	-	505	524
PSM	AGAPGALSPSYDGGLHGLQSK	1381	sp|P15923|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3418.3	36.12572	3	2061.948071	2061.952085	R	I	372	393
PSM	AEPQPLSPASSSYSVSSPR	1382	sp|P18850|ATF6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3351.5	34.39698	3	2105.863271	2105.870797	K	S	88	107
PSM	QIDSSPVGGETDETTVSQNYR	1383	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3237.4	31.44702	3	2361.996671	2361.996194	K	G	565	586
PSM	ITRKPVTVSPTTPTSPTEGEAS	1384	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3017.5	25.79798	3	2415.093671	2415.097168	R	-	502	524
PSM	NCQTVLAPCSPNPCENAAVCK	1385	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3275.6	32.43162	3	2468.991971	2468.994638	K	E	829	850
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	1386	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3254.6	31.89465	3	3722.198171	3722.195067	K	A	158	190
PSM	ASPEPQRENASPAPGTTAEEAMSR	1387	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3086.6	27.52713	3	2563.095971	2563.101011	R	G	963	987
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	1388	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3162.2	29.48213	5	2712.270618	2712.264371	K	T	139	165
PSM	SGSMEEDVDTSPGGDYYTSPSSPTSSSR	1389	sp|P08651|NFIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3381.6	35.17535	3	2962.131071	2962.133552	K	N	284	312
PSM	NLLSVAYK	1390	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3672.2	42.58827	2	986.481447	986.483799	R	N	44	52
PSM	NQVALNPQNTVFDAK	1391	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3442.3	36.72292	3	1737.807971	1737.808715	K	R	57	72
PSM	SLNILTAFQK	1392	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4221.3	54.76292	2	1213.609247	1213.610790	K	K	244	254
PSM	QVPDSAATATAYLCGVK	1393	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3684.2	42.90022	3	1830.816671	1830.822317	R	A	107	124
PSM	SQIFSTASDNQPTVTIK	1394	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3510.3	38.4814	3	1915.892771	1915.892839	K	V	448	465
PSM	KKIEEAMDGSETPQLFTVLPEK	1395	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3720.3	43.83757	4	2569.237694	2569.238673	K	R	769	791
PSM	NSLESYAFNMK	1396	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3590.3	40.51108	2	1302.589247	1302.591438	K	A	540	551
PSM	GFDPTASPFCQ	1397	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3727.4	44.02378	2	1305.472847	1305.473705	K	-	1293	1304
PSM	DAGQISGLNVLR	1398	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3755.2	44.71964	2	1321.636847	1321.639131	K	V	207	219
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	1399	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3506.5	38.38345	4	2654.188894	2654.189112	K	K	453	479
PSM	DSSQGPCEPLPGPLTQPR	1400	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3496.3	38.11605	3	2014.886171	2014.881957	R	A	101	119
PSM	DVIELTDDSFDK	1401	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3703.4	43.40225	2	1395.637647	1395.640556	K	N	161	173
PSM	AIGSASEGAQSSLQEVYHK	1402	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3452.6	36.99198	3	2120.881571	2120.881696	R	S	169	188
PSM	FASENDLPEWK	1403	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3739.4	44.32985	2	1414.576047	1414.580613	R	E	58	69
PSM	IMNTFSVVPSPK	1404	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3487.3	37.88515	2	1414.655247	1414.656755	R	V	163	175
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1405	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:4,16-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3535.3	39.13317	4	2833.347294	2833.352672	K	S	362	389
PSM	EFSPFGSITSAK	1406	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4105.4	53.04043	2	1429.551647	1429.556780	K	V	313	325
PSM	EFSPFGSITSAK	1407	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4095.2	52.83907	2	1429.551647	1429.556780	K	V	313	325
PSM	EINAREESLVEELSPASEK	1408	sp|Q9BXK5|B2L13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3531.4	39.03238	3	2209.010471	2209.015139	K	K	413	432
PSM	IMNTFSVVPSPK	1409	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3791.5	45.65608	2	1478.623847	1478.628171	R	V	163	175
PSM	ILTPLVSLDTPGK	1410	sp|Q9HC38|GLOD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4768.2	61.06372	2	1512.723047	1512.724180	K	A	240	253
PSM	DNPGVVTCLDEAR	1411	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3626.6	41.4281	2	1524.625647	1524.627974	K	H	227	240
PSM	GASSPLITVFTDDK	1412	sp|Q15155|NOMO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3989.3	50.41895	2	1529.697447	1529.701456	K	G	822	836
PSM	DNLTLWTSENQGDEGDAGEGEN	1413	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3805.3	46.01217	3	2349.944471	2349.946922	R	-	225	247
PSM	RPPSPDVIVLSDNEQPSSPR	1414	sp|Q86YP4|P66A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3521.5	38.7756	3	2349.034871	2349.040322	R	V	97	117
PSM	ISMQDVDLSLGSPK	1415	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3863.2	47.44878	3	1568.715371	1568.715726	K	L	500	514
PSM	VHSPSGALEECYVTEIDQDK	1416	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3653.5	42.10755	3	2355.984071	2355.993023	K	Y	2368	2388
PSM	SACGNCYLGDAFR	1417	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3641.2	41.793	2	1569.569847	1569.574164	K	C	272	285
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1418	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3908.3	48.60487	3	2407.983371	2407.988786	R	-	223	246
PSM	DTCYSPKPSVYLSTPSSASK	1419	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,3-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3518.6	38.69997	3	2413.919771	2413.919144	K	A	538	558
PSM	ATTPASTANSDVATIPTDTPLKEENEGFVK	1420	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3697.4	43.24547	4	3263.453694	3263.452382	K	V	274	304
PSM	QSKPVTTPEEIAQVATISANGDK	1421	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3593.6	40.6	3	2463.186071	2463.189415	K	E	158	181
PSM	RASGQAFELILSPR	1422	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3932.2	49.16245	3	1703.778071	1703.779738	K	S	14	28
PSM	NRPTSISWDGLDSGK	1423	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3444.2	36.77102	3	1711.757171	1711.756680	K	L	48	63
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1424	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	29-UNIMOD:21	ms_run[1]:scan=1.1.4224.2	54.83805	4	3425.451294	3425.458138	K	-	610	647
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	1425	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3509.5	38.4623	4	3448.566494	3448.567155	K	V	871	903
PSM	DSSTSYTETKDPSSGQEVATPPVPQLQVCEPK	1426	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,29-UNIMOD:4	ms_run[1]:scan=1.1.3592.5	40.57048	4	3541.570894	3541.580756	R	E	663	695
PSM	EPSYPMPVQETQAPESPGENSEQALQTLSPR	1427	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=1.1.3898.4	48.35545	4	3556.502494	3556.510642	K	A	137	168
PSM	NSVTPDMMEEMYKK	1428	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3501.3	38.24605	3	1781.709071	1781.707546	K	A	229	243
PSM	RIDFIPVSPAPSPTR	1429	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3801.2	45.906	3	1811.836571	1811.837252	K	G	136	151
PSM	DRSSFYVNGLTLGGQK	1430	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3682.3	42.85207	3	1820.843471	1820.845829	K	C	55	71
PSM	SWASPVYTEADGTFSR	1431	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3849.4	47.09324	2	1852.758247	1852.766910	R	L	342	358
PSM	SESAPTLHPYSPLSPK	1432	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3480.4	37.70237	3	1869.796271	1869.795113	R	G	100	116
PSM	VSSGYVPPPVATPFSSK	1433	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3612.3	41.07323	3	1878.819071	1878.820599	R	S	168	185
PSM	ENVATTDTLESTTVGTSV	1434	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3591.6	40.54763	2	1903.823247	1903.829964	K	-	580	598
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1435	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3451.4	36.95922	4	2619.212094	2619.213536	R	D	175	200
PSM	LATQSNEITIPVTFESR	1436	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3984.2	50.29447	3	1984.949771	1984.950688	K	A	172	189
PSM	GTIVLASPGWTTHSISDGK	1437	sp|Q14914|PTGR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3676.4	42.69887	3	2005.944671	2005.951022	K	D	82	101
PSM	WLDDLLASPPPSGGGARR	1438	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4053.2	51.9411	3	2023.892471	2023.891807	R	G	684	702
PSM	AAPEASSPPASPLQHLLPGK	1439	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3653.2	42.09755	3	2047.011371	2047.013957	K	A	686	706
PSM	LDNVPHTPSSYIETLPK	1440	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3886.2	48.03487	3	2069.908271	2069.911205	R	A	45	62
PSM	QAHDLSPAAESSSTFSFSGR	1441	sp|O95425|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3454.3	37.03423	3	2160.911171	2160.911342	R	D	216	236
PSM	GSGGLFSPSTAHVPDGALGQR	1442	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3788.4	45.5746	3	2169.920171	2169.924564	R	D	1023	1044
PSM	SQGYDWSEPFSPGEDEFK	1443	sp|Q86TI2|DPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4108.3	53.11083	3	2183.831471	2183.836112	K	C	463	481
PSM	DNLTLWTSDQQDDDGGEGNN	1444	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3861.3	47.40071	3	2192.864171	2192.873028	R	-	228	248
PSM	SIQTPQSHGTLTAELWDNK	1445	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3642.5	41.82948	3	2205.004271	2205.010328	K	V	1977	1996
PSM	SSVSRVPCNVEGISPELEK	1446	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3494.5	38.07145	3	2245.970171	2245.969131	K	V	290	309
PSM	SVLCSTPTINIPASPFMQK	1447	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4319.2	56.16392	3	2249.978771	2249.986696	K	L	19	38
PSM	QHPQPYIFPDSPGGTSYER	1448	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3496.4	38.11938	3	2254.967471	2254.968463	R	Y	75	94
PSM	YHTSQSGDEMTSLSEYVSR	1449	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3623.2	41.34068	3	2255.902271	2255.904208	R	M	457	476
PSM	QQPPEPEWIGDGESTSPSDK	1450	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3520.5	38.7496	3	2262.928571	2262.931803	K	V	7	27
PSM	IADPEHDHTGFLTEYVATR	1451	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3585.5	40.38737	3	2330.958671	2330.961009	R	W	190	209
PSM	FVEWLQNAEEESESEGEEN	1452	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4247.2	55.09838	3	2333.882471	2333.884913	K	-	401	420
PSM	FVEWLQNAEEESESEGEEN	1453	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4140.2	53.64957	3	2333.882471	2333.884913	K	-	401	420
PSM	ELSNSPLRENSFGSPLEFR	1454	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3971.2	50.0172	3	2337.999671	2338.003208	K	N	1316	1335
PSM	NSTLSDSGMIDNLPDSPDEVAK	1455	sp|Q9P0V3|SH3B4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3769.2	45.07558	3	2384.001371	2384.009067	R	E	116	138
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1456	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3936.3	49.24783	3	2407.983071	2407.988786	R	-	223	246
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1457	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3755.6	44.73297	3	2435.114471	2435.115856	K	A	30	54
PSM	DNLTLWTSDSAGEECDAAEGAEN	1458	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3927.4	49.06927	3	2453.973371	2453.976507	R	-	223	246
PSM	APVPEPGLDLSLSPRPDSPQPR	1459	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3811.5	46.16918	3	2484.140471	2484.145122	R	H	35	57
PSM	AGEARPGPTAESASGPSEDPSVNFLK	1460	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3489.6	37.94467	3	2650.187171	2650.191206	R	N	213	239
PSM	YDSDGDKSDDLVVDVSNEDPATPR	1461	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3509.6	38.46563	3	2688.104771	2688.107595	R	V	238	262
PSM	YDSDGDKSDDLVVDVSNEDPATPR	1462	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3501.6	38.25605	3	2688.104771	2688.107595	R	V	238	262
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1463	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3648.6	41.98763	4	2972.322094	2972.324602	K	Q	178	204
PSM	FSDCWNTEGSYDCVCSPGYEPVSGAK	1464	sp|Q9UHX3|AGRE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3769.5	45.08892	3	3051.131171	3051.139841	K	T	82	108
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	1465	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3569.3	39.96947	4	3062.398094	3062.401610	K	S	2194	2221
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	1466	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3605.2	40.89825	5	3464.573118	3464.574823	K	E	218	249
PSM	VGPATPSAQVGKWEEDSESSSEESSDSSDGEVPTAVAPAQEK	1467	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3597.6	40.70478	4	4340.854894	4340.860555	K	S	529	571
PSM	GVVDSEDLPLNISR	1468	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3655.4	42.1538	2	1512.773247	1512.778387	R	E	387	401
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1469	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3395.6	35.5409	3	2640.193871	2639.207584	K	S	97	122
PSM	AIVDALPPPCESACTVPTDVDK	1470	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3688.6	43.0184	3	2435.102471	2434.079730	R	W	261	283
PSM	QLSSGVSEIR	1471	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3603.2	40.84807	2	1137.5039	1137.5062	R	H	80	90
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1472	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3646.6	41.93665	3	2765.2213	2765.2250	-	Y	1	25
PSM	VASGGGGVGDGVQEPTTGNWR	1473	sp|O00429-2|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3293.2	32.88687	3	2079.902771	2079.901112	K	G	559	580
PSM	SYTPGVGGDPAQLAQR	1474	sp|O15400|STX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3603.3	40.8514	3	1737.7708	1737.7718	M	I	2	18
PSM	MEPSSLELPADTVQR	1475	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3989.2	50.40895	3	1793.7890	1793.7902	-	I	1	16
PSM	MMCGAPSATQPATAETQHIADQVR	1476	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3795.4	45.76338	3	2692.1371	2692.1439	-	S	1	25
PSM	SDAAVDTSSEITTK	1477	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3090.6	27.63043	2	1545.6373	1545.6442	M	D	2	16
PSM	MNPVYSPGSSGVPYANAK	1478	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3803.2	45.96088	3	1959.8444	1959.8433	-	G	1	19
PSM	GLLSGQTSPTNAK	1479	sp|Q969J3|BORC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3071.2	27.135	2	1352.633047	1352.633711	K	L	68	81
PSM	MNLLPNIESPVTRQEK	1480	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4300.2	55.85808	3	1989.9542	1989.9590	-	M	1	17
PSM	ASASYHISNLLEK	1481	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3905.4	48.53698	2	1553.7080	1553.7122	M	M	2	15
PSM	NGSLDSPGKQDTEEDEEEDEK	1482	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2873.3	22.08885	3	2430.903071	2429.923149	K	D	134	155
PSM	NILLTNEQLESARK	1483	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3342.2	34.15803	3	1707.849371	1707.855665	R	I	36	50
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1484	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3679.6	42.78355	3	2574.976571	2573.998594	R	G	239	267
PSM	LSSGNEENKKEEDNDEIK	1485	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2627.2	17.45603	4	2076.946094	2076.944737	K	I	135	153
PSM	SWHDVQVSSAYVK	1486	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3360.2	34.6219	3	1584.696371	1584.697374	R	T	96	109
PSM	SGTSEFLNK	1487	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3110.2	28.13828	2	1061.443247	1061.443056	K	M	169	178
PSM	AAGARPLTSPESLSR	1488	sp|P46379|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3088.2	27.56535	3	1591.771271	1591.771936	K	D	1073	1088
PSM	TPSPKEEDEEPESPPEKK	1489	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2725.2	18.5216	4	2131.920894	2131.919841	K	T	202	220
PSM	DYDDMSPR	1490	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2932.2	23.58687	2	1077.345647	1077.347441	R	R	279	287
PSM	DLHQPSLSPASPHSQGFER	1491	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3210.3	30.73892	4	2168.968894	2168.964047	K	G	58	77
PSM	PYQYPALTPEQKK	1492	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3147.2	29.09457	3	1641.7805	1641.7799	M	E	2	15
PSM	AVNSATGVPTV	1493	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3369.3	34.85828	2	1094.501247	1094.500906	K	-	626	637
PSM	TTEEQVQASTPCPR	1494	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2785.2	19.88035	3	1682.698571	1682.697116	K	T	97	111
PSM	LQTPNTFPK	1495	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3098.3	27.82778	2	1124.526647	1124.526726	K	R	605	614
PSM	IDEMPEAAVKSTANK	1496	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2899.5	22.74457	3	1698.755771	1698.753568	R	Y	30	45
PSM	YIDQEELNK	1497	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2954.4	24.15965	2	1150.549647	1150.550619	K	T	198	207
PSM	QLSSGVSEIR	1498	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3145.3	29.04578	2	1154.533047	1154.533268	R	H	80	90
PSM	SAPPTRGPPPSYGGSSR	1499	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2811.3	20.51955	3	1749.784871	1749.783563	R	Y	293	310
PSM	WNSVSPASAGK	1500	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2974.5	24.6817	2	1182.506047	1182.507054	K	R	304	315
PSM	SSDEENGPPSSPDLDR	1501	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2966.5	24.47472	3	1780.679171	1780.678883	R	I	202	218
PSM	ADTSQEICSPRLPISASHSSK	1502	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3295.3	32.9423	4	2430.034094	2430.028771	K	T	1020	1041
PSM	TDYNASVSVPDSSGPER	1503	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3177.2	29.87317	3	1859.755571	1859.757467	R	I	70	87
PSM	KITIADCGQLE	1504	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3228.4	31.21218	2	1246.621447	1246.622738	K	-	155	166
PSM	DLEVTCDPDSGGSQGLR	1505	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3337.3	34.03423	3	1884.756971	1884.756088	R	G	1319	1336
PSM	RFSEGVLQSPSQDQEK	1506	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3127.3	28.58083	3	1913.851571	1913.852037	R	L	427	443
PSM	DSAQNSVIIVDK	1507	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3128.4	28.60927	2	1287.667047	1287.667045	K	N	194	206
PSM	EALQDVEDENQ	1508	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3085.4	27.49457	2	1288.540047	1288.541905	K	-	245	256
PSM	SASSSAAGSPGGLTSLQQQK	1509	sp|Q8NEZ2|VP37A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3166.6	29.59943	3	1940.881571	1940.884065	K	Q	10	30
PSM	CSGPGLSPGMVR	1510	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3291.4	32.84187	2	1296.535647	1296.535594	K	A	1453	1465
PSM	GAGAGHPGAGGAQPPDSPAGVR	1511	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2833.4	21.06485	3	1962.866771	1962.869752	R	T	71	93
PSM	EQVANSAFVER	1512	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3105.4	28.01398	2	1328.575847	1328.576196	K	V	365	376
PSM	TPKGPSSVEDIK	1513	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2935.4	23.6676	2	1336.625647	1336.627563	K	A	237	249
PSM	NNASTDYDLSDK	1514	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2927.5	23.46898	2	1341.563847	1341.568454	K	S	301	313
PSM	DGFPSGTPALNAK	1515	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3296.3	32.96785	2	1353.594847	1353.596597	K	G	148	161
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	1516	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3153.5	29.25938	4	2712.264494	2712.264371	K	T	139	165
PSM	GKEDEGEEAASPMLQIQR	1517	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3078.4	27.313	3	2082.895571	2082.892916	K	D	2400	2418
PSM	QAGGFLGPPPPSGK	1518	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3274.3	32.3953	2	1388.646247	1388.648967	K	F	224	238
PSM	ESDFSDTLSPSK	1519	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3183.4	30.03605	2	1391.548247	1391.549372	K	E	444	456
PSM	GVQVETISPGDGR	1520	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3101.6	27.9166	2	1393.6223	1393.6233	M	T	2	15
PSM	ASEAKEGEEAGPGDPLLEAVPKTGDEK	1521	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3369.5	34.86495	4	2803.285694	2803.280080	K	D	348	375
PSM	ETSAATLSPGASSR	1522	sp|Q9Y6I9|TX264_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2832.4	21.04668	2	1413.612647	1413.613704	R	G	237	251
PSM	GAVDGGLSIPHSTK	1523	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3146.4	29.0753	2	1417.659847	1417.660260	K	R	165	179
PSM	DALKPNSPLTER	1524	sp|Q5R3I4|TTC38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2989.2	25.06072	3	1419.676571	1419.675910	R	L	446	458
PSM	DSVFLSCSEDNR	1525	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3255.4	31.91273	2	1427.595447	1427.598708	K	I	180	192
PSM	SSTPLHSPSPIR	1526	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	25.00882	3	1437.606071	1437.605462	R	V	283	295
PSM	ISVREPMQTGIK	1527	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3140.3	28.91417	3	1437.708671	1437.705102	R	A	183	195
PSM	SGAQASSTPLSPTR	1528	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2852.4	21.54892	2	1438.642647	1438.645338	R	I	12	26
PSM	FQTGNKSPEVLR	1529	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2980.5	24.8369	2	1454.690447	1454.691894	R	A	432	444
PSM	TVEVAEGEAVRTPQSVTAKQPPEIDK	1530	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3282.3	32.60425	4	2938.374094	2938.372615	R	K	132	158
PSM	DVSGPMPDSYSPR	1531	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3249.4	31.75972	2	1486.579847	1486.579961	K	Y	291	304
PSM	EGHLSPDIVAEQK	1532	sp|P15559|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3137.3	28.83685	3	1501.683371	1501.681389	K	K	78	91
PSM	NIDINDVTPNCR	1533	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3243.4	31.60358	2	1509.628247	1509.628308	K	V	102	114
PSM	YRDVAECGPQQELDLNSPRNTTLER	1534	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3406.5	35.82455	4	3040.370494	3040.370978	K	Q	102	127
PSM	NHCGIASAASYPTV	1535	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3407.6	35.85442	2	1526.620647	1526.622494	R	-	320	334
PSM	ELSDQATASPIVAR	1536	sp|Q5JSH3|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3135.2	28.78088	3	1536.721871	1536.718503	K	T	88	102
PSM	SLPTTVPESPNYR	1537	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3282.4	32.60758	2	1539.695247	1539.697039	R	N	766	779
PSM	AQLSPGIYDDTSAR	1538	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3339.6	34.09572	2	1572.678047	1572.682118	K	R	1469	1483
PSM	NNAYLAQSPQLYK	1539	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3392.2	35.44882	3	1588.725671	1588.728674	K	Q	242	255
PSM	VAAETQSPSLFGSTK	1540	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3325.6	33.73257	2	1601.730847	1601.733819	K	L	215	230
PSM	QLPLEPESPSGQVGPRPAPPQEESPSSEAK	1541	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3406.6	35.82788	4	3204.497694	3204.497618	K	S	63	93
PSM	AGMTSSPDATTGQTFG	1542	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3351.6	34.40032	2	1607.612447	1607.617468	R	-	779	795
PSM	DLVAQAPLKPKTPR	1543	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3091.2	27.64267	3	1612.869971	1612.870193	K	G	523	537
PSM	KSSPSVKPAVDPAAAK	1544	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2800.2	20.24487	3	1631.827571	1631.828388	K	L	181	197
PSM	PYQYPALTPEQKK	1545	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3155.3	29.30458	3	1641.7781	1641.7799	M	E	2	15
PSM	IDEMPEAAVKSTANK	1546	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3055.2	26.75407	3	1682.758871	1682.758653	R	Y	30	45
PSM	EQGPYETYEGSPVSK	1547	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3129.6	28.64095	2	1749.712047	1749.713477	K	G	549	564
PSM	ERAMSTTSISSPQPGK	1548	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2867.4	21.92722	3	1755.783071	1755.786265	K	L	265	281
PSM	KPAAAAAPGTAEKLSPK	1549	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2818.6	20.69773	3	1766.834471	1766.836918	K	A	23	40
PSM	DAPTSPASVASSSSTPSSK	1550	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2924.6	23.39528	2	1842.787847	1842.788433	K	T	282	301
PSM	GVGSGPHPPDTQQPSPSK	1551	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2801.5	20.28323	3	1851.813371	1851.815257	R	A	646	664
PSM	SFEAPATINSASLHPEK	1552	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3390.6	35.40987	2	1877.851047	1877.856059	K	E	219	236
PSM	EQPPTEPGPQSASEVEK	1553	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2967.6	24.5039	3	1888.809371	1888.809169	R	I	393	410
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1554	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3142.4	28.97038	5	3290.605618	3290.597273	K	E	178	210
PSM	HASSSPESPKPAPAPGSHR	1555	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2474.2	16.31032	4	1975.892894	1975.890153	R	E	433	452
PSM	GSLSNAGDPEIVKSPSDPK	1556	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3091.4	27.64933	3	1976.904671	1976.909217	R	Q	93	112
PSM	DSESSNDDTSFPSTPEGIK	1557	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3352.4	34.41957	3	2091.815471	2091.815770	K	D	437	456
PSM	HTGCCGDNDPIDVCEIGSK	1558	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3224.3	31.10423	3	2132.857571	2132.856139	K	V	110	129
PSM	TPVDESDDEIQHDEIPTGK	1559	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3222.3	31.05247	3	2203.915571	2203.915819	R	C	923	942
PSM	GHTDTEGRPPSPPPTSTPEK	1560	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2774.3	19.65197	4	2246.923294	2246.924624	R	C	353	373
PSM	GHASAPYFGKEEPSVAPSSTGK	1561	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3095.3	27.75013	4	2283.020894	2283.020893	K	T	131	153
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	1562	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3251.6	31.81873	3	2541.177371	2541.174827	K	I	50	74
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	1563	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2848.4	21.4475	3	2611.084571	2611.085754	K	L	460	485
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDK	1564	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	20-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3236.6	31.42728	3	2625.094871	2625.090171	R	L	221	248
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1565	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3371.5	34.9162	4	2727.233694	2727.234862	R	G	70	97
PSM	VSDPISTSESSEEEEEAEAETAKATPR	1566	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3359.6	34.60917	3	2958.247271	2958.250297	R	L	78	105
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1567	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3021.5	25.90213	4	2968.359694	2968.358028	R	L	420	447
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1568	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2798.6	20.20923	4	3024.353694	3024.356099	K	S	145	174
PSM	QPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGAR	1569	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,35-UNIMOD:21	ms_run[1]:scan=1.1.3163.6	29.52122	4	4180.614894	4180.617956	K	L	82	122
PSM	SGVGNIFIK	1570	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3642.2	41.81948	2	1013.492047	1013.494698	K	N	96	105
PSM	RIDFTPVSPAPSPTRGFGK	1571	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3548.2	39.45982	4	2189.002094	2189.007171	K	M	108	127
PSM	GDLGIEIPAEK	1572	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3457.2	37.10928	2	1140.602047	1140.602654	R	V	295	306
PSM	SQPEPSPVLSQLSQR	1573	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3477.2	37.6171	3	1731.819671	1731.819280	K	Q	427	442
PSM	DLNVLTPTGF	1574	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4623.2	59.65992	2	1155.518247	1155.521307	R	-	296	306
PSM	VLPGVDALSNI	1575	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4320.2	56.18955	2	1176.575447	1176.579156	K	-	407	418
PSM	SMSAPVIFDR	1576	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3696.2	43.21332	2	1201.519047	1201.520261	K	S	117	127
PSM	APVPEPGLDLSLSPRPDSPQPR	1577	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3810.2	46.13393	4	2484.139694	2484.145122	R	H	35	57
PSM	SESAPTLHPYSPLSPK	1578	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3472.2	37.4891	3	1869.796271	1869.795113	R	G	100	116
PSM	VLENAEGARTTPSVVAFTADGER	1579	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3511.3	38.50705	4	2549.120894	2549.120029	K	L	77	100
PSM	DLKPSNLLLNTTCDLK	1580	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3709.3	43.5553	3	1923.934871	1923.937681	R	I	149	165
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1581	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3633.3	41.59023	4	2573.997694	2573.998594	R	G	239	267
PSM	KQSKPVTTPEEIAQVATISANGDK	1582	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3442.5	36.72958	4	2591.283294	2591.284378	K	E	157	181
PSM	EDFDSLLQSAK	1583	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3791.2	45.64608	2	1331.564047	1331.564628	K	K	288	299
PSM	GSLESPATDVFGSTEEGEK	1584	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3702.2	43.37	3	2018.833571	2018.835777	K	R	331	350
PSM	SESVEGFLSPSR	1585	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3583.4	40.33204	2	1373.584247	1373.586426	R	C	1311	1323
PSM	NLSSPFIFHEK	1586	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3651.4	42.05482	2	1397.635247	1397.638068	R	T	644	655
PSM	WPDPEDLLTPR	1587	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4111.3	53.19456	2	1417.626047	1417.627897	R	W	39	50
PSM	GFPTIYFSPANK	1588	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3950.2	49.55667	2	1420.639047	1420.642819	R	K	449	461
PSM	QREEYQPATPGLGMFVEVKDPEDK	1589	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3755.4	44.7263	4	2842.286894	2842.288477	K	V	72	96
PSM	AFLAELEQNSPK	1590	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3681.3	42.82583	2	1425.650847	1425.654112	K	I	4512	4524
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1591	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3577.4	40.17532	5	3596.731118	3596.728741	K	-	244	278
PSM	CDENILWLDYK	1592	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3954.3	49.65023	2	1467.664447	1467.670417	K	N	152	163
PSM	ASGQAFELILSPR	1593	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3984.4	50.3078	2	1467.708647	1467.712296	R	S	15	28
PSM	TQVLSPDSLFTAK	1594	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3974.3	50.09467	2	1485.706847	1485.711627	K	F	1717	1730
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1595	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3527.3	38.92473	4	2989.534494	2989.541321	K	G	202	228
PSM	YRCELLYEGPPDDEAAMGIKSCDPK	1596	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	3-UNIMOD:4,21-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3607.4	40.9536	4	2993.2651	2993.2641	K	G	367	392
PSM	ELENANDLLSATK	1597	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3525.4	38.87608	2	1496.672647	1496.675970	K	R	352	365
PSM	TLTIVDTGIGMTK	1598	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3879.4	47.86907	2	1508.657047	1508.659865	R	A	28	41
PSM	NIEIDSPYEISR	1599	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3553.5	39.5992	2	1514.660647	1514.665405	K	A	380	392
PSM	DPVASSLSPYFGTK	1600	sp|Q9UNW1|MINP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3869.5	47.61352	2	1547.685847	1547.690891	R	T	37	51
PSM	DIEREDIEFICK	1601	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3522.2	38.79182	3	1565.747471	1565.739559	K	T	327	339
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	1602	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3559.6	39.75727	4	3194.430494	3194.432255	K	R	65	93
PSM	SSDEENGPPSSPDLDRIAASMR	1603	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3700.3	43.32125	3	2410.006571	2410.010799	R	A	202	224
PSM	QSKPVTTPEEIAQVATISANGDK	1604	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3495.6	38.10017	3	2463.184871	2463.189415	K	E	158	181
PSM	IFVGGLSPDTPEEK	1605	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3692.5	43.11887	2	1647.681047	1647.683437	K	I	184	198
PSM	NGYELSPTAAANFTR	1606	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3667.4	42.46578	2	1690.729847	1690.735216	R	R	71	86
PSM	NRPTSISWDGLDSGK	1607	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3512.3	38.53325	3	1711.757171	1711.756680	K	L	48	63
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1608	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	28-UNIMOD:21	ms_run[1]:scan=1.1.4211.2	54.63788	4	3425.451294	3425.458138	K	-	610	647
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	1609	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3501.5	38.25272	4	3448.566494	3448.567155	K	V	871	903
PSM	NQVAMNPTNTVFDAK	1610	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3441.5	36.70303	2	1728.753047	1728.754237	K	R	57	72
PSM	CFSPGVIEVQEVQGK	1611	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3707.3	43.50357	3	1755.788171	1755.790288	R	K	256	271
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1612	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3858.3	47.32608	4	3522.466094	3522.472617	K	F	604	634
PSM	DDGLFSGDPNWFPKK	1613	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4064.2	52.16868	3	1801.767971	1801.771267	R	S	140	155
PSM	SESVPPVTDWAWYK	1614	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4492.2	58.29825	2	1823.714647	1823.720885	K	I	244	258
PSM	DMASPNWSILPEEER	1615	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3934.3	49.1854	3	1868.765171	1868.765196	R	N	327	342
PSM	TDGFAEAIHSPQVAGVPR	1616	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3500.3	38.21973	3	1930.894571	1930.893842	R	F	2146	2164
PSM	IDEPSTPYHSMMGDDEDACSDTEATEAMAPDILAR	1617	sp|P41236|IPP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.4063.2	52.14747	4	3920.533294	3920.541018	K	K	68	103
PSM	QENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVR	1618	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4,15-UNIMOD:21,21-UNIMOD:21,26-UNIMOD:4	ms_run[1]:scan=1.1.3549.5	39.49517	4	3923.674494	3923.685663	R	L	257	293
PSM	TIGGGDDSFNTFFSETGAGK	1619	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3960.2	49.76582	3	2006.879771	2006.885765	K	H	41	61
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1620	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3747.4	44.5268	5	3385.514118	3385.515651	K	A	399	429
PSM	DNLTLWTSDQQDEEAGEGN	1621	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3862.3	47.42982	3	2120.867171	2120.877051	R	-	228	247
PSM	DCCVEPGTELSPTLPHQL	1622	sp|Q14012|KCC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3854.5	47.22872	3	2131.890071	2131.895558	R	-	353	371
PSM	KYEQGFITDPVVLSPKDR	1623	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3521.2	38.7656	4	2171.062494	2171.066387	K	V	109	127
PSM	SIDSNSEIVSFGSPCSINSR	1624	sp|P42702|LIFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3725.4	43.97187	3	2234.949971	2234.951493	R	Q	1047	1067
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	1625	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3859.4	47.352	4	3013.328894	3013.339266	K	V	8	36
PSM	DSALQDTDDSDDDPVLIPGAR	1626	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3807.4	46.06528	3	2293.957871	2293.958746	R	Y	648	669
PSM	TQDPAKAPNTPDILEIEFKK	1627	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	41.68917	4	2334.153694	2334.150844	K	G	210	230
PSM	GVVPLAGTNGETTTQGLDGLSER	1628	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3736.4	44.2559	3	2351.095871	2351.100600	K	C	112	135
PSM	FNSESESGSEASSPDYFGPPAK	1629	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3429.5	36.3963	3	2368.935971	2368.937282	R	N	96	118
PSM	YGKDATNVGDEGGFAPNILENK	1630	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3641.3	41.79633	3	2388.057371	2388.063486	K	E	200	222
PSM	KFVEWLQNAEEESESEGEEN	1631	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3928.6	49.0955	3	2461.974671	2461.979876	K	-	400	420
PSM	ADLLLSTQPGREEGSPLELER	1632	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3875.6	47.77217	3	2469.114671	2469.118966	K	L	593	614
PSM	HASSSDDFSDFSDDSDFSPSEK	1633	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3552.6	39.57638	3	2487.881771	2487.886369	R	G	129	151
PSM	ESVTDYTTPSSSLPNTVATNNTK	1634	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3462.4	37.24593	3	2506.106771	2506.111224	K	M	2185	2208
PSM	APSEEDSLSSVPISPYKDEPWK	1635	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3884.3	47.98925	3	2620.095071	2620.102313	K	Y	36	58
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	1636	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3505.6	38.36078	3	2654.187971	2654.189112	K	K	453	479
PSM	NTFTAWSDEESDYEIDDRDVNK	1637	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3727.6	44.03045	3	2728.078571	2728.081381	K	I	621	643
PSM	IADPEHDHTGFLTEYVATRWYR	1638	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3880.2	47.88787	5	2836.206618	2836.204762	R	A	190	212
PSM	NEETPAAPTPAGATGGSSAWLDSSSENR	1639	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3558.6	39.73298	3	2839.185971	2839.193391	R	G	385	413
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1640	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3572.3	40.04295	5	3596.731118	3596.728741	K	-	244	278
PSM	RASGQAFELILSPR	1641	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3953.2	49.62435	3	1704.778871	1703.779738	K	S	14	28
PSM	NAVITVPAYFNDSQR	1642	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3888.2	48.08463	3	1773.809171	1773.808715	K	Q	188	203
PSM	ATGANATPLDFPSK	1643	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3612.6	41.08323	2	1510.6662	1510.6700	M	K	2	16
PSM	QQEPVTSTSLVFGK	1644	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=1.1.3919.3	48.88117	2	1582.7255	1582.7275	K	K	1107	1121
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1645	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4071.3	52.3443	3	2829.1915	2829.1964	-	Y	1	25
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKK	1646	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,42-UNIMOD:21	ms_run[1]:scan=1.1.3427.6	36.35117	5	4721.2071	4721.2089	M	V	2	54
PSM	IFVGGLSPDTPEEK	1647	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3684.5	42.91022	2	1648.682647	1647.683437	K	I	184	198
PSM	NREPLMPSPQFIK	1648	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3596.3	40.66875	3	1636.783271	1635.784415	K	S	246	259
PSM	PFSAPKPQTSPSPK	1649	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2935.2	23.66093	3	1547.740871	1547.738510	K	R	299	313
PSM	NVSSFPDDATSPLQENR	1650	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3449.5	36.91039	3	1956.828071	1955.826216	R	N	52	69
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1651	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3711.4	43.60948	4	2882.1882	2882.1622	M	D	2	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1652	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3712.3	43.6316	4	2882.1882	2882.1622	M	D	2	29
PSM	SETSVANGSQSESSVSTPSASFEPNNTCENSQSR	1653	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3255.6	31.9194	4	3642.454494	3641.469702	K	N	117	151
PSM	PRPDPSPEIEGDLQPATHGSR	1654	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3181.4	29.98375	4	2335.064894	2335.059404	R	F	146	167
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1655	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3814.2	46.23357	4	2881.088494	2881.094982	K	T	701	725
PSM	SGPDVETPSAIQICR	1656	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3666.5	42.443	2	1750.7531	1750.7592	M	I	2	17
PSM	AAAMDVDTPSGTNSGAGKK	1657	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,4-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.2799.3	20.22692	3	1914.7954	1914.8025	M	R	2	21
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1658	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3695.4	43.19413	3	2574.978971	2573.998594	R	G	239	267
PSM	YNQLLRIEEELGSK	1659	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3835.2	46.7301	3	1770.849671	1770.855331	K	A	407	421
PSM	KPPPSPQPTGKIEIK	1660	sp|Q13438-2|OS9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2911.2	23.04457	4	1695.895294	1695.896074	K	I	525	540
PSM	KRHEHPPNPPVSPGK	1661	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2651.2	17.86332	4	1755.856894	1755.857003	K	T	662	677
PSM	DKGDEEEEGEEKLEEK	1662	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2888.2	22.45302	4	1891.821694	1891.817077	K	Q	536	552
PSM	SGPKPFSAPKPQTSPSPK	1663	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2910.3	23.02482	4	1916.940494	1916.939729	R	R	295	313
PSM	VLTPTQVK	1664	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3028.2	26.06853	2	964.499247	964.499449	K	N	40	48
PSM	GVISTPVIR	1665	sp|Q9NZB2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3335.2	33.9799	2	1020.533047	1020.536897	R	T	987	996
PSM	DLHQPSLSPASPHSQGFER	1666	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3226.2	31.15298	4	2168.968894	2168.964047	K	G	58	77
PSM	GHTDTEGRPPSPPPTSTPEK	1667	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2784.4	19.8661	4	2246.923294	2246.924624	R	C	353	373
PSM	GHLSRPEAQSLSPYTTSANR	1668	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3099.4	27.85773	4	2251.04969419132	2251.0382736521397	R	A	424	444
PSM	GTGLLSSDYR	1669	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3351.2	34.38698	2	1147.488047	1147.491069	K	I	402	412
PSM	LSQVPMSALK	1670	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3425.2	36.28978	2	1152.556047	1152.561397	R	S	398	408
PSM	RVTNDISPESSPGVGR	1671	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2941.3	23.81902	3	1749.803171	1749.804692	K	R	59	75
PSM	LREVVETPLLHPER	1672	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3291.3	32.83853	3	1766.907371	1766.908035	K	F	187	201
PSM	EAALPPVSPLK	1673	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3399.3	35.6353	2	1200.614247	1200.615542	R	A	1224	1235
PSM	NAGVEGSLIVEK	1674	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3185.4	30.08775	2	1214.648247	1214.650667	K	I	482	494
PSM	RKIDAGTMAEPSASPSK	1675	sp|Q8IXQ3|CI040_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2847.3	21.41522	3	1824.846971	1824.844114	K	R	56	73
PSM	NQDNLQGWNK	1676	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3030.5	26.12803	2	1215.561047	1215.563249	R	T	97	107
PSM	LEGQGDVPTPK	1677	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2953.4	24.13362	2	1219.547247	1219.548584	K	Q	257	268
PSM	AGSSTPGDAPPAVAEVQGR	1678	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3184.3	30.05875	3	1845.822971	1845.825822	R	S	2885	2904
PSM	DNSTMGYMMAK	1679	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3273.4	32.37285	2	1247.497247	1247.498465	R	K	486	497
PSM	SSEHINEGETAMLVCK	1680	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3176.4	29.85375	3	1883.775071	1883.779466	K	S	228	244
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1681	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3355.4	34.4981	4	2539.243694	2539.247205	R	D	175	200
PSM	TTLPQDCSNPAPLSSPLNGVHDR	1682	sp|P16278|BGAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3408.3	35.87025	4	2555.147294	2555.147567	R	A	420	443
PSM	VDSPTVNTTLR	1683	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3061.3	26.91367	2	1281.594847	1281.596597	K	S	443	454
PSM	EITALAPSTMK	1684	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3391.4	35.42898	2	1320.540847	1320.543772	K	I	318	329
PSM	SLSPGAASSSSGDGDGKEGLEEPKGPR	1685	sp|Q6ZN18|AEBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3002.5	25.40685	4	2651.175294	2651.171199	R	G	139	166
PSM	HRNDHLTSTTSSPGVIVPESSENK	1686	sp|O75496|GEMI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3006.3	25.50417	4	2671.221694	2671.223903	K	N	53	77
PSM	DNNQFASASLDR	1687	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3143.4	28.99703	2	1336.600647	1336.600757	K	T	154	166
PSM	VTAEADSSSPTGILATSESK	1688	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3356.5	34.52737	3	2029.906871	2029.909277	K	S	486	506
PSM	DGFPSGTPALNAK	1689	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3312.3	33.38448	2	1353.594047	1353.596597	K	G	148	161
PSM	DGFPSGTPALNAK	1690	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3304.4	33.17787	2	1353.594847	1353.596597	K	G	148	161
PSM	ELASPVSPELR	1691	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3381.5	35.17202	2	1356.572847	1356.572764	K	Q	175	186
PSM	RLQKLESPVAH	1692	sp|Q86TM6|SYVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2843.2	21.30937	3	1356.693371	1356.691500	R	-	607	618
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1693	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3379.4	35.11623	4	2727.233694	2727.234862	R	G	70	97
PSM	TPQEWAPQTAR	1694	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3077.4	27.28793	2	1363.591647	1363.592180	K	I	286	297
PSM	ELISNSSDALDK	1695	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3217.5	30.92805	2	1370.594047	1370.596657	R	I	47	59
PSM	AVADAIRTSLGPK	1696	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3183.3	30.03272	2	1377.701647	1377.701731	K	G	43	56
PSM	LLGGTRTPINDAS	1697	sp|Q8N357|S35F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3155.5	29.31125	2	1393.658247	1393.660260	R	-	359	372
PSM	NSGSFPSPSISPR	1698	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3310.5	33.33798	2	1411.619047	1411.613310	R	-	1258	1271
PSM	LDQPVSAPPSPR	1699	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2991.2	25.11265	3	1422.596471	1422.594562	K	D	235	247
PSM	NGEVVHTPETSV	1700	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3061.5	26.92033	2	1427.534447	1427.537107	K	-	454	466
PSM	SSDQPLTVPVSPK	1701	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3285.3	32.68245	2	1433.678447	1433.680327	K	F	728	741
PSM	SSGPYGGGGQYFAK	1702	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3284.4	32.65905	2	1454.585247	1454.586761	R	P	285	299
PSM	STTPPPAEPVSLPQEPPKPR	1703	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3274.4	32.39863	3	2204.086871	2204.087850	K	V	225	245
PSM	GTDTQTPAVLSPSK	1704	sp|P46087|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3036.3	26.26927	2	1480.674447	1480.681055	K	T	722	736
PSM	DVSGPMPDSYSPR	1705	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3241.5	31.55473	2	1486.579847	1486.579961	K	Y	291	304
PSM	MPPRTPAEASSTGQTGPQSAL	1706	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3296.4	32.97118	3	2242.935971	2242.933080	K	-	238	259
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1707	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3080.6	27.37088	4	3048.323694	3048.324359	R	L	420	447
PSM	VPSPLEGSEGDGDTD	1708	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3277.5	32.48034	2	1553.575847	1553.577043	K	-	413	428
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	1709	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3249.5	31.76305	4	3156.401294	3156.395856	K	G	306	335
PSM	NSNSPPSPSSMNQR	1710	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2845.4	21.36385	3	1581.626471	1581.624285	R	R	454	468
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1711	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3252.4	31.83778	4	3162.510094	3162.502310	K	E	179	210
PSM	ESQRSGNVAELALK	1712	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3201.2	30.49953	3	1580.760071	1580.755951	K	A	658	672
PSM	RHEHPPNPPVSPGK	1713	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2690.2	18.19418	4	1627.763294	1627.762040	K	T	663	677
PSM	SQDATFSPGSEQAEKSPGPIVSR	1714	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3193.6	30.30368	3	2454.106571	2454.106414	R	T	329	352
PSM	GGKPEPPAMPQPVPTA	1715	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3300.6	33.08168	2	1652.762247	1652.763345	K	-	228	244
PSM	SAPASPTHPGLMSPR	1716	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3126.3	28.55577	3	1664.680271	1664.678309	R	S	416	431
PSM	WDQTADQTPGATPK	1717	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2941.6	23.82902	2	1674.631847	1674.632799	R	K	200	214
PSM	KPAAAAAPGTAEKLSPK	1718	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2801.4	20.27657	3	1686.869471	1686.870587	K	A	23	40
PSM	SSGPYGGGGQYFAKPR	1719	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3192.3	30.26798	3	1707.740471	1707.740636	R	N	337	353
PSM	NQVAMNPTNTVFDAK	1720	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3398.2	35.60578	3	1728.754271	1728.754237	K	R	57	72
PSM	NQTAEKEEFEHQQK	1721	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2656.2	17.93088	4	1744.805294	1744.801642	K	E	584	598
PSM	DCDLQEDACYNCGR	1722	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3080.3	27.36088	3	1774.636271	1774.634519	K	G	66	80
PSM	DKPHVNVGTIGHVDHGK	1723	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2870.3	22.0018	4	1808.927694	1808.928179	R	T	54	71
PSM	GCITIIGGGDTATCCAK	1724	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,11-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3388.3	35.34792	3	1833.747071	1833.746057	R	W	366	383
PSM	EQGQAPITPQQGQALAK	1725	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3088.3	27.56868	3	1843.877771	1843.882943	K	Q	131	148
PSM	TSSVSNPQDSVGSPCSR	1726	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2860.5	21.74992	3	1843.739471	1843.740772	K	V	94	111
PSM	DETVSDCSPHIANIGR	1727	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3244.2	31.62288	3	1849.767671	1849.766593	K	L	200	216
PSM	GVQVETISPGDGRTFPK	1728	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3350.3	34.36442	3	1866.8858	1866.8872	M	R	2	19
PSM	IRYESLTDPSKLDSGK	1729	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	31.8054	3	1887.901271	1887.897924	K	E	54	70
PSM	GSSGENNNPGSPTVSNFR	1730	sp|Q99576-3|T22D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3075.4	27.23855	3	1899.776471	1899.774849	R	Q	32	50
PSM	ERSPALKSPLQSVVVR	1731	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3380.3	35.13918	3	1924.954871	1924.953679	R	R	246	262
PSM	KPVTVSPTTPTSPTEGEAS	1732	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3012.5	25.66765	3	1964.896871	1964.897984	R	-	505	524
PSM	HRVIGSGCNLDSARFR	1733	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3165.2	29.55987	4	2003.854094	2003.855045	K	Y	157	173
PSM	SMGTGDTPGLEVPSSPLRK	1734	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3416.4	36.08038	3	2007.932471	2007.933658	R	A	381	400
PSM	FIHQQPQSSSPVYGSSAK	1735	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2998.5	25.30387	3	2026.914971	2026.914971	R	T	76	94
PSM	DSGLESPAAAEAPLRGQYK	1736	sp|Q8NBR6|MINY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3403.3	35.73943	3	2038.938671	2038.936101	K	V	89	108
PSM	NQGGYGGSSSSSSYGSGRRF	1737	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3006.5	25.51083	3	2076.825671	2076.828675	R	-	353	373
PSM	AMHQAQTMEGCSSPMVVK	1738	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2995.5	25.22612	3	2086.838471	2086.834555	K	F	167	185
PSM	ETVSEESNVLCLSKSPNK	1739	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3333.6	33.941	2	2099.943447	2099.944617	R	H	581	599
PSM	TVEVAEGEAVRTPQSVTAK	1740	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3180.4	29.9576	3	2130.958271	2130.959947	R	Q	132	151
PSM	KYEDICPSTHNMDVPNIK	1741	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3318.3	33.54052	4	2239.962894	2239.964306	K	R	68	86
PSM	SQSPAASDCSSSSSSASLPSSGR	1742	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.2857.3	21.66937	3	2278.899071	2278.900914	R	S	171	194
PSM	SWDSSSPVDRPEPEAASPTTR	1743	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3191.5	30.24858	3	2351.003171	2351.006699	R	T	354	375
PSM	DTSSITSCGDGNVVKQEQLSPK	1744	sp|Q9Y6Q9|NCOA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3195.5	30.3528	3	2429.079071	2429.078150	K	K	709	731
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1745	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3403.4	35.74277	4	2807.201294	2807.201193	R	G	70	97
PSM	NQIHVKSPPREGSQGELTPANSQSR	1746	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2921.5	23.31367	4	2876.292494	2876.296765	R	M	462	487
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	1747	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3416.5	36.08372	3	3037.289171	3037.291647	K	E	117	144
PSM	SVTSNQSDGTQESCESPDVLDRHQTMEVSC	1748	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,14-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3335.6	33.99323	3	3462.359171	3462.364709	R	-	346	376
PSM	ETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEK	1749	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3409.6	35.9066	4	3827.682894	3827.686009	K	T	159	192
PSM	SSNLLDLK	1750	sp|Q86X55|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3541.2	39.28413	2	968.456447	968.457978	K	N	463	471
PSM	VLPGVDALSNI	1751	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4309.2	55.9934	2	1176.575447	1176.579156	K	-	407	418
PSM	KIFVGGLSPDTPEEK	1752	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3541.4	39.2908	3	1775.773871	1775.778400	K	I	183	198
PSM	RGFFICDQPYEPVSPYSCK	1753	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,14-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3790.2	45.6202	4	2429.020894	2429.022156	R	E	675	694
PSM	GPPQSPVFEGVYNNSR	1754	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3532.3	39.0548	3	1826.790371	1826.798879	K	M	107	123
PSM	AIVDALPPPCESACTVPTDVDK	1755	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3689.2	43.03087	4	2434.077694	2434.079730	R	W	261	283
PSM	DYPDFSPSVDAEAIQK	1756	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3798.2	45.82815	3	1860.780671	1860.781891	R	A	14	30
PSM	LLLDPSSPPTK	1757	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3447.2	36.84823	2	1246.619447	1246.621021	K	A	21	32
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	1758	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	21-UNIMOD:21,25-UNIMOD:21,30-UNIMOD:21	ms_run[1]:scan=1.1.3847.2	47.03525	6	3773.750541	3773.758037	R	Q	125	162
PSM	DLRSPLIATPTFVADK	1759	sp|P49116|NR2C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3890.2	48.13553	3	1902.886871	1902.889348	K	D	216	232
PSM	VMTIPYQPMPASSPVICAGGQDR	1760	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,9-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=1.1.3712.2	43.62827	4	2570.133294	2570.136868	R	C	178	201
PSM	VMTIPYQPMPASSPVICAGGQDR	1761	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3665.3	42.4099	4	2570.134494	2570.136868	R	C	178	201
PSM	NLEELNISSAQ	1762	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3680.4	42.80315	2	1296.557047	1296.559877	K	-	120	131
PSM	VWSPLVTEEGK	1763	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3663.2	42.35475	2	1323.607447	1323.611184	K	R	88	99
PSM	TLTPISAAYAR	1764	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3494.3	38.06479	2	1322.567647	1322.567285	K	A	295	306
PSM	EVYELLDSPGK	1765	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3549.4	39.49183	2	1328.585647	1328.590115	K	V	20	31
PSM	AAMYDIISSPSK	1766	sp|Q6KC79|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3552.5	39.57305	2	1361.584647	1361.593820	K	D	342	354
PSM	PVQETQAPESPGENSEQALQTLSPR	1767	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3431.5	36.44537	4	2772.2575	2772.2598	M	A	2	27
PSM	DQPPFGDSDDSVEADKSSPGIHLER	1768	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3478.4	37.65037	4	2777.176494	2777.181763	K	S	488	513
PSM	IMNTFSVVPSPK	1769	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3663.4	42.36142	2	1398.657447	1398.661840	R	V	163	175
PSM	VEIIANDQGNRTTPSYVAFTDTER	1770	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3689.3	43.0342	4	2856.233694	2856.236850	K	L	26	50
PSM	EGFSIPVSADGFK	1771	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3965.4	49.90795	2	1432.625247	1432.627563	K	F	1887	1900
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	1772	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3704.3	43.42552	4	2896.358494	2896.363082	K	A	2621	2646
PSM	LTFDSSFSPNTGK	1773	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3581.4	40.27928	2	1479.626247	1479.628291	K	K	97	110
PSM	SLPTPAVLLSPTK	1774	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3914.3	48.74577	2	1482.712247	1482.713615	K	E	632	645
PSM	GNPTVEVDLFTSK	1775	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3758.4	44.80264	2	1485.671447	1485.675241	R	G	16	29
PSM	EQFLDGDGWTSR	1776	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3663.5	42.36475	2	1489.584647	1489.587489	K	W	25	37
PSM	EIGINEDQFQEACTSPLAK	1777	sp|Q96G28|CFA36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3683.3	42.87792	3	2228.966171	2228.966080	K	T	71	90
PSM	DAGVQPEEISYINAHATSTPLGDAAENK	1778	sp|Q9NWU1|OXSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3673.5	42.62385	4	2977.321694	2977.334241	K	A	334	362
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	1779	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3867.3	47.55538	4	3013.328894	3013.339266	K	V	8	36
PSM	TSDIFGSPVTATSR	1780	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3525.5	38.87942	2	1517.670647	1517.676304	K	L	91	105
PSM	TTPSVVAFTADGER	1781	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3535.5	39.13983	2	1529.670647	1529.676304	R	L	86	100
PSM	DGDSYRSPWSNKYDPPLEDGAMPSAR	1782	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3717.5	43.76575	4	3070.223694	3070.220548	R	L	67	93
PSM	ESMCSTPAFPVSPETPYVK	1783	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:35,4-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3772.4	45.16655	3	2301.889271	2301.897606	K	T	839	858
PSM	TQVLSPDSLFTAK	1784	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4183.3	54.25617	2	1565.675847	1565.677958	K	F	1717	1730
PSM	APNTPDILEIEFK	1785	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4150.3	53.77863	2	1565.732847	1565.737842	K	K	216	229
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	1786	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3662.6	42.34263	5	3932.704618	3932.709658	K	T	6	40
PSM	ISMQDVDLSLGSPK	1787	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3480.2	37.6957	3	1584.713471	1584.710641	K	L	500	514
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	1788	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3572.6	40.05295	4	3199.392094	3199.394275	K	N	213	241
PSM	SLTNDWEDHLAVK	1789	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3648.2	41.9743	3	1606.704371	1606.702853	K	H	315	328
PSM	AQQATPGGAAPTIFSR	1790	sp|Q9BX68|HINT2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3431.6	36.4487	2	1651.770447	1651.771936	K	I	43	59
PSM	NTPASASLEGLAQTAGR	1791	sp|Q96Q45|TM237_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3703.3	43.39892	3	1722.793271	1722.793793	K	R	43	60
PSM	DNLTLWTADNAGEEGGEAPQEPQS	1792	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4133.3	53.49883	3	2608.053671	2608.060251	R	-	225	249
PSM	VGIDTPDIDIHGPEGK	1793	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3452.2	36.97865	3	1741.792571	1741.792396	K	L	4560	4576
PSM	ASLGSLEGEAEAEASSPK	1794	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3600.4	40.7765	3	1811.781371	1811.782620	K	G	5748	5766
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1795	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,11-UNIMOD:4,15-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3575.5	40.12643	4	3642.453694	3642.458229	K	V	60	92
PSM	AEEYEFLTPVEEAPK	1796	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3780.5	45.3704	2	1830.794047	1830.796479	R	G	153	168
PSM	ASSTSPVEISEWLDQK	1797	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4110.2	53.1689	3	1855.821071	1855.824091	K	L	188	204
PSM	ASSTSPVEISEWLDQK	1798	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4100.2	52.93725	3	1855.821071	1855.824091	K	L	188	204
PSM	VSSGYVPPPVATPFSSK	1799	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	40.82208	3	1878.817871	1878.820599	R	S	168	185
PSM	DRSSFYVNGLTLGGQK	1800	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3802.4	45.93863	3	1900.809371	1900.812160	K	C	55	71
PSM	TFEEDPAVGAIVLTGGDK	1801	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	45.85367	3	1897.871171	1897.871041	K	A	75	93
PSM	VGINYQPPTVVPGGDLAK	1802	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3733.2	44.1732	3	1903.943171	1903.944480	K	V	353	371
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	1803	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	20-UNIMOD:21,32-UNIMOD:4	ms_run[1]:scan=1.1.3595.6	40.65203	4	3813.464894	3813.463279	R	G	32	65
PSM	KEESEESDDDMGFGLFD	1804	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4062.5	52.12973	2	1948.747047	1948.752033	K	-	98	115
PSM	QENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVR	1805	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4,15-UNIMOD:21,25-UNIMOD:21,26-UNIMOD:4	ms_run[1]:scan=1.1.3557.6	39.70707	4	3923.674494	3923.685663	R	L	257	293
PSM	SVPTSTVFYPSDGVATEK	1806	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3603.5	40.85807	3	1963.875971	1963.881605	R	A	439	457
PSM	SCGSSTPDEFPTDIPGTK	1807	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3539.6	39.2466	2	1974.784247	1974.791804	R	G	104	122
PSM	DSSTSPGDYVLSVSENSR	1808	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3787.3	45.5451	3	1978.815671	1978.815711	R	V	39	57
PSM	SQSASVESIPEVLEECTSPADHSDSASVHDMDYVNPR	1809	sp|Q92538|GBF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3908.6	48.61487	4	4124.714894	4124.725265	K	G	345	382
PSM	LATQSNEITIPVTFESR	1810	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4096.2	52.85437	3	2064.912671	2064.917019	K	A	172	189
PSM	DLLLTSSYLSDSGSTGEHTK	1811	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3636.3	41.66685	3	2110.007171	2110.006609	K	S	397	417
PSM	DNLTLWTSDMQGDGEEQNK	1812	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3590.5	40.51775	3	2195.927771	2195.927707	R	E	226	245
PSM	DSLGAHSITSPGGNNVQLIDK	1813	sp|Q92503|S14L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3504.3	38.32463	3	2202.025871	2202.031792	K	V	577	598
PSM	TQDPAKAPNTPDILEIEFK	1814	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3889.4	48.11643	3	2206.051271	2206.055881	K	K	210	229
PSM	QQPPEPEWIGDGESTSPSDK	1815	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3529.6	38.9869	3	2262.925871	2262.931803	K	V	7	27
PSM	IADPEHDHTGFLTEYVATR	1816	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3550.6	39.52448	3	2330.955671	2330.961009	R	W	190	209
PSM	DDTDDEIAKYDGKWEVEEMK	1817	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3668.3	42.48835	4	2415.037694	2415.042402	K	E	91	111
PSM	SAMDSPVPASMFAPEPSSPGAAR	1818	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3985.3	50.33372	3	2418.960071	2418.962665	R	A	8	31
PSM	CESAPGCGVWQRPVIDNPNYK	1819	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3535.6	39.14317	3	2526.074771	2526.082130	R	G	360	381
PSM	DGAVNGPSVVGDQTPIEPQTSIER	1820	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3573.5	40.07518	3	2625.129371	2625.136073	K	L	377	401
PSM	NMTVEQLLTGSPTSPTVEPEKPTR	1821	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3914.4	48.75243	3	2691.281171	2691.282663	K	E	826	850
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	1822	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3574.6	40.10367	3	2964.312371	2964.313840	K	-	178	207
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1823	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:35,15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.4068.3	52.27315	3	2968.316771	2968.325196	R	S	59	86
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	1824	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3719.6	43.82138	3	3393.341171	3393.345713	K	F	86	114
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	1825	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,20-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3678.6	42.75772	4	3544.533694	3544.541154	K	E	218	249
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1826	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3571.3	40.01833	5	3596.731118	3596.728741	K	-	244	278
PSM	VSMPDVELNLKSPK	1827	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3613.2	41.09452	3	1636.789571	1635.794311	K	V	3415	3429
PSM	SAESPTSPVTSETGSTFK	1828	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3463.4	37.2718	3	1972.779971	1971.775165	K	K	280	298
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1829	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4259.2	55.25575	4	3427.4512	3425.4572	K	-	610	647
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	1830	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3566.5	39.90705	4	3529.521294	3528.533486	K	V	871	903
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1831	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3649.5	42.00873	3	2588.0348	2588.0424	M	R	2	32
PSM	VLLPEYGGTK	1832	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	35.97127	2	1155.558447	1155.557692	K	V	71	81
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1833	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3323.6	33.6801	4	2898.287694	2898.290225	K	L	281	308
PSM	SPAVATSTAAPPPPSSPLPSK	1834	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3134.5	28.76522	3	2038.997771	2038.997638	K	S	439	460
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1835	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2862.5	21.8015	4	2674.028094	2673.045055	K	G	134	157
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1836	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3704.5	43.43218	3	2845.1869	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1837	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4062.4	52.1264	3	2829.1915	2829.1964	-	Y	1	25
PSM	ADQLTEEQIAEFK	1838	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3886.3	48.0382	2	1562.7387	1562.7459	M	E	2	15
PSM	SISQSSTDSYSSAASYTDSSDDEVSPREK	1839	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3211.5	30.77157	4	3165.284094	3165.278302	R	Q	66	95
PSM	SSIGTGYDLSASTFSPDGR	1840	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.4017.3	51.07837	3	2038.8506	2038.8516	M	V	2	21
PSM	NVSSFPDDATSPLQENR	1841	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3441.3	36.69637	3	1956.828071	1955.826216	R	N	52	69
PSM	TEWETAAPAVAETPDIK	1842	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3962.3	49.82432	3	1949.8612	1949.8654	M	L	2	19
PSM	MPPRTPAEASSTGQTGPQSAL	1843	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3276.3	32.44765	3	2243.929271	2242.933080	K	-	238	259
PSM	QFTPCQLLADHANSPNK	1844	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3675.3	42.67215	3	2099.848271	2099.853707	K	K	743	760
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1845	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3710.5	43.58732	4	2882.1882	2882.1622	M	D	2	29
PSM	DAINQGMDEELERDEK	1846	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3296.2	32.96452	3	1890.830471	1890.826536	R	V	37	53
PSM	VKLESPTVSTLTPSSPGK	1847	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3351.4	34.39365	3	2066.892971	2066.897937	R	L	290	308
PSM	SGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLSTVSHDYLK	1848	sp|O15357|SHIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3870.6	47.6429	4	4306.950894	4306.955990	R	G	145	188
PSM	MDLFGDLPEPERSPRPAAGK	1849	sp|Q9H0C8|ILKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4135.3	53.55067	3	2304.0575	2304.0605	-	E	1	21
PSM	TVDNFVALATGEK	1850	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3599.3	40.74658	2	1443.661647	1443.664677	K	G	72	85
PSM	AAPEEHDSPTEASQPIVEEEETK	1851	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3357.6	34.55673	3	2644.0981	2644.1060	M	T	2	25
PSM	GMGPGTPAGYGR	1852	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2810.3	20.48737	2	1215.471847	1215.474374	R	G	682	694
PSM	MEDLVQDGVASPATPGTGK	1853	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4025.3	51.28432	3	1993.8665	1993.8699	-	S	1	20
PSM	CPNLTHLNLSGNK	1854	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3683.4	42.88125	2	1529.6664	1529.6693	K	I	87	100
PSM	SAPASPTHPGLMSPR	1855	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,12-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2910.4	23.03148	3	1680.670871	1680.673224	R	S	416	431
PSM	ESSETPDQFMTADETR	1856	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3418.6	36.13572	2	1922.740647	1922.724118	K	N	716	732
PSM	VKLDSPAGTALSPSGHTK	1857	sp|P32322|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3098.2	27.82445	4	1924.874494	1924.869675	K	L	290	308
PSM	NVSIGIVGK	1858	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3374.2	34.98192	2	965.493247	965.494698	K	D	209	218
PSM	SKPIPIMPASPQK	1859	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.2925.2	23.4077	3	1488.744671	1488.741153	K	G	607	620
PSM	SGPKPFSAPKPQTSPSPK	1860	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2961.4	24.3413	4	1996.907294	1996.906060	R	R	295	313
PSM	GLTSVINQK	1861	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3399.2	35.63197	2	1038.510047	1038.511076	R	L	300	309
PSM	SAGLFQNPK	1862	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3200.2	30.47307	2	1040.470847	1040.469212	R	Q	233	242
PSM	NLETPLCK	1863	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3025.2	25.99403	2	1053.457047	1053.456598	K	N	86	94
PSM	NLETPLCK	1864	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3017.2	25.78798	2	1053.457047	1053.456598	K	N	86	94
PSM	DATLTALDR	1865	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	34.5434	2	1054.466847	1054.469606	K	G	391	400
PSM	MLTFNPNK	1866	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3191.2	30.23858	2	1059.446447	1059.446034	R	R	310	318
PSM	DLSLEEIQK	1867	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3402.2	35.70952	2	1073.561047	1073.560455	K	K	44	53
PSM	INNFSADIK	1868	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3284.2	32.65238	2	1100.487647	1100.490341	K	D	289	298
PSM	STTPPPAEPVSLPQEPPKPR	1869	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3268.3	32.23987	4	2204.091294	2204.087850	K	V	225	245
PSM	ERESLQQMAEVTR	1870	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3204.2	30.5777	3	1655.739371	1655.733836	K	E	123	136
PSM	SPGAPGPLTLK	1871	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3320.3	33.59248	2	1116.556047	1116.558027	R	E	344	355
PSM	YNEQHVPGSPFTAR	1872	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3202.4	30.5321	3	1681.729571	1681.724985	K	V	1938	1952
PSM	SGCSEAQPPESPETR	1873	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2764.4	19.39465	3	1710.655871	1710.655645	K	L	424	439
PSM	IYQYIQSR	1874	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2988.3	25.0379	2	1149.521447	1149.521975	R	F	318	326
PSM	QLRFEDVVNQSSPK	1875	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3401.2	35.68385	3	1725.806171	1725.808715	K	N	190	204
PSM	TEDEVLTSKGDAWAK	1876	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3250.3	31.78258	3	1728.762971	1728.760762	K	Y	138	153
PSM	GASLKSPLPSQ	1877	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3099.5	27.86107	2	1163.558247	1163.558755	K	-	113	124
PSM	ILKSPEIQR	1878	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2902.2	22.81215	3	1162.612271	1162.611125	R	A	292	301
PSM	NNEESPTATVAEQGEDITSKK	1879	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3238.3	31.46957	4	2327.018494	2327.016595	K	D	9	30
PSM	TISPMVMDAK	1880	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3334.2	33.95402	2	1171.500047	1171.501834	K	A	793	803
PSM	ADTSQEICSPRLPISASHSSK	1881	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3222.2	31.04913	4	2350.063694	2350.062440	K	T	1020	1041
PSM	RADLNQGIGEPQSPSRR	1882	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2879.2	22.23032	5	1959.933118	1959.927602	R	V	62	79
PSM	QMEKDETVSDCSPHIANIGR	1883	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3153.2	29.24938	4	2366.003294	2366.003211	R	L	196	216
PSM	GCESAVDELK	1884	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3131.4	28.68465	2	1186.462047	1186.457721	K	G	441	451
PSM	KKPRPPPALGPEETSASAGLPK	1885	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3133.4	28.73613	4	2387.1676941913206	2387.1651280448195	K	K	14	36
PSM	ADTSQEICSPRLPISASHSSK	1886	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	32.73038	4	2430.034094	2430.028771	K	T	1020	1041
PSM	YEELQSLAGK	1887	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	34.6482	2	1216.532647	1216.537685	K	H	286	296
PSM	RELHGQNPVVTPCNK	1888	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2778.3	19.74528	3	1827.843971	1827.845118	K	Q	147	162
PSM	NTCPGDRSAITPGGLR	1889	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3102.4	27.9355	3	1830.749171	1830.748514	K	L	410	426
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	1890	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3264.2	32.13337	4	2449.053694	2449.048187	R	A	90	114
PSM	VEIIANDQGNR	1891	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2927.3	23.46232	2	1227.618447	1227.620764	R	I	50	61
PSM	EITALAPSTMK	1892	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3370.2	34.8809	2	1240.574247	1240.577441	K	I	318	329
PSM	SRLTPVSPESSSTEEK	1893	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2901.5	22.79635	3	1892.781971	1892.780585	R	S	266	282
PSM	ERASTPYIEK	1894	sp|Q969Z0|FAKD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2803.2	20.33423	3	1272.575171	1272.575133	K	Q	61	71
PSM	TKTEQELPRPQSPSDLDSLDGR	1895	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3326.3	33.74842	4	2548.174894	2548.180641	K	S	90	112
PSM	ELISNASDALDK	1896	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3253.2	31.85663	2	1274.634047	1274.635411	R	I	103	115
PSM	ELASPVSPELR	1897	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3306.5	33.23413	2	1276.606247	1276.606433	K	Q	175	186
PSM	EQNSPIYISR	1898	sp|O14910|LIN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3099.6	27.8644	2	1285.570647	1285.570382	K	I	127	137
PSM	KQSKPVTTPEEIAQVATISANGDK	1899	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3373.4	34.96348	4	2591.282494	2591.284378	K	E	157	181
PSM	QHEAPSNRPLNELLTPQGPSPR	1900	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3409.3	35.8966	4	2597.181294	2597.178881	R	T	167	189
PSM	EDQTEYLEER	1901	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3062.2	26.93597	2	1310.563047	1310.562640	K	R	166	176
PSM	DQVANSAFVER	1902	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3120.4	28.40363	2	1314.560447	1314.560546	K	L	500	511
PSM	VKLESPTVSTLTPSSPGK	1903	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3356.4	34.52403	3	1986.929171	1986.931606	R	L	290	308
PSM	STPSHGSVSSLNSTGSLSPK	1904	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3006.4	25.5075	3	2008.909571	2008.910280	R	H	238	258
PSM	TVSGPGTPEPRPATPGASSVEQLRK	1905	sp|Q9H3U1|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3157.4	29.35983	4	2678.2452	2678.2461	M	E	2	27
PSM	LDQPVSAPPSPR	1906	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2979.6	24.81415	2	1342.628247	1342.628231	K	D	235	247
PSM	SAESPTSPVTSETGSTFKK	1907	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3086.4	27.52047	3	2019.904271	2019.903797	K	F	280	299
PSM	GEPNVSYICSR	1908	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3151.3	29.20098	2	1360.548847	1360.548267	R	Y	273	284
PSM	SSPNPFVGSPPK	1909	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3390.4	35.4032	2	1372.544647	1372.546550	K	G	393	405
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	1910	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3093.6	27.70782	4	2769.238094	2769.239553	K	V	100	125
PSM	EMPQDLRSPARTPPSEEDSAEAER	1911	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3088.5	27.57535	4	2777.194894	2777.196368	K	L	70	94
PSM	ESDFSDTLSPSK	1912	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3191.4	30.24525	2	1391.548247	1391.549372	K	E	444	456
PSM	SPSGPVKSPPLSPVGTTPVK	1913	sp|Q9BVC5|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3261.4	32.06315	3	2091.003071	2091.005440	K	L	182	202
PSM	AAQQAASSSGQGQQAQTPTGF	1914	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3110.6	28.15162	3	2099.894171	2099.890941	K	-	305	326
PSM	EGLELPEDEEEK	1915	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3276.2	32.44432	2	1415.629447	1415.630385	K	K	412	424
PSM	SSTETCYSAIPK	1916	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3142.5	28.97372	2	1422.573247	1422.573813	R	A	2496	2508
PSM	ADVVPKTAENFR	1917	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3120.2	28.39697	3	1425.658871	1425.665345	K	A	68	80
PSM	TSKAEELLAEEK	1918	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3193.5	30.30035	2	1426.650847	1426.659257	K	S	595	607
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	1919	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.2994.5	25.2001	4	2858.108894	2858.104652	K	M	639	664
PSM	SGAQASSTPLSPTR	1920	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2860.6	21.75325	2	1438.642647	1438.645338	R	I	12	26
PSM	STIGVMVTASHNPEEDNGVK	1921	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3292.2	32.86095	3	2163.952271	2163.950764	K	L	55	75
PSM	STGGAPTFNVTVTK	1922	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3407.5	35.85108	2	1458.672047	1458.675576	K	T	92	106
PSM	AMSTTSISSPQPGK	1923	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2916.5	23.1845	2	1470.638847	1470.642561	R	L	267	281
PSM	DTYSDRSGSSSPDSEITELK	1924	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3339.5	34.09238	3	2252.932871	2252.932197	R	F	565	585
PSM	SESPKEPEQLRK	1925	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2755.5	19.1765	3	1506.706271	1506.707938	K	L	4	16
PSM	NIDINDVTPNCR	1926	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3251.5	31.8154	2	1509.628247	1509.628308	K	V	102	114
PSM	AIEINPDSAQPYK	1927	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3329.3	33.82658	2	1524.683047	1524.686140	R	W	174	187
PSM	KKPRPPPALGPEETSASAGLPK	1928	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3060.5	26.89453	3	2307.1965706434903	2307.1987970448195	K	K	14	36
PSM	YRDVAECGPQQELDLNSPR	1929	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3358.6	34.5828	3	2326.003571	2326.004926	K	N	102	121
PSM	AAVVTSPPPTTAPHK	1930	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2851.2	21.51067	3	1552.764671	1552.765059	R	E	7	22
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1931	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3153.6	29.26272	4	3117.283294	3117.283662	R	A	333	362
PSM	NISSSPSVESLPGGR	1932	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3253.4	31.8633	2	1565.702447	1565.708667	K	E	535	550
PSM	GIETPQCDQSTGQCVCVEGVEGPRCDK	1933	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=1.1.3293.4	32.89353	4	3145.263294	3145.261036	R	C	1138	1165
PSM	NSNSPPSPSSMNQR	1934	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2853.5	21.574	2	1581.623047	1581.624285	R	R	454	468
PSM	TQSPGGCSAEAVLAR	1935	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3226.5	31.16298	2	1582.679247	1582.681072	R	K	74	89
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	1936	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,9-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3336.6	34.01902	4	3213.340094	3213.342046	K	F	173	200
PSM	RSEACPCQPDSGSPLPAEEEK	1937	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2968.6	24.52973	3	2422.975571	2422.977056	R	R	492	513
PSM	TAADVVSPGANSVDSR	1938	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2999.6	25.33295	2	1624.707047	1624.709395	K	V	1000	1016
PSM	APGTPHSHTKPYVR	1939	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2607.2	17.29757	3	1626.768671	1626.766791	K	S	155	169
PSM	GGAAGGALPTSPGPALGAK	1940	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3308.6	33.28902	2	1628.787247	1628.792337	R	G	7	26
PSM	SSGGREDLESSGLQR	1941	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2964.3	24.41583	3	1656.713771	1656.710458	K	R	70	85
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	1942	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3099.3	27.8544	5	2769.245118	2769.239553	K	V	100	125
PSM	ESVPEFPLSPPKKK	1943	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3330.2	33.84948	3	1661.842571	1661.842975	K	D	30	44
PSM	YNEQHVPGSPFTAR	1944	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3197.3	30.39813	3	1681.729571	1681.724985	K	V	1938	1952
PSM	NLEEAAAAEQGGGCDQVDSSPVPR	1945	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3348.6	34.32232	3	2536.058171	2536.053726	R	Y	333	357
PSM	SDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPK	1946	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	32-UNIMOD:21	ms_run[1]:scan=1.1.2834.4	21.08975	4	3379.490094	3379.494049	K	A	164	199
PSM	STAGDTHLGGEDFDNR	1947	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3004.5	25.45915	3	1690.715771	1690.718306	K	M	224	240
PSM	GTSFDAAATSGGSASSEK	1948	sp|P13804|ETFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2950.6	24.06225	2	1709.677047	1709.678155	R	A	170	188
PSM	LGAGGGSPEKSPSAQELK	1949	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2900.5	22.7706	3	1791.838871	1791.840409	R	E	13	31
PSM	QASTDAGTAGALTPQHVR	1950	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2914.4	23.12887	3	1859.849771	1859.852705	R	A	107	125
PSM	AELLQSDENGIPSSPQK	1951	sp|Q14542|S29A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	33.38115	3	1891.854671	1891.856453	K	V	239	256
PSM	FQEQECPPSPEPTRK	1952	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2875.5	22.13715	3	1908.804971	1908.807729	K	E	178	193
PSM	DSENLASPSEYPENGER	1953	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3193.3	30.29368	3	1972.770071	1972.768760	R	F	617	634
PSM	DVDDGSGSPHSPHQLSSK	1954	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2750.3	19.0704	3	2008.754471	2008.756496	R	S	2022	2040
PSM	EAGVEMGDEDDLSTPNEK	1955	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3223.4	31.0817	3	2014.772471	2014.771463	R	L	357	375
PSM	AYEDGCKTVDLKPDWGK	1956	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3317.3	33.51472	4	2060.894094	2060.891459	K	G	57	74
PSM	AKPSPAPPSTTTAPDASGPQK	1957	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2816.4	20.64678	3	2084.975471	2084.977965	K	R	32	53
PSM	DSESSNDDTSFPSTPEGIK	1958	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3344.4	34.21452	3	2091.815471	2091.815770	K	D	437	456
PSM	SAESPTSPVTSETGSTFKK	1959	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3238.5	31.47623	3	2099.872271	2099.870128	K	F	280	299
PSM	SYLMTNYESAPPSPQYKK	1960	sp|O75223|GGCT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3354.6	34.47833	3	2182.962671	2182.964624	R	I	124	142
PSM	KLEKEEEEGISQESSEEEQ	1961	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2896.4	22.66442	3	2235.985871	2235.986661	K	-	89	108
PSM	DQQNLPYGVTPASPSGHSQGR	1962	sp|Q7KZI7|MARK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3206.4	30.63683	3	2275.001171	2275.001889	R	R	607	628
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNETPK	1963	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,38-UNIMOD:21	ms_run[1]:scan=1.1.3363.6	34.71287	4	4555.886894	4555.891278	K	K	106	153
PSM	GHASAPYFGKEEPSVAPSSTGK	1964	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3113.2	28.21623	4	2283.027694	2283.020893	K	T	131	153
PSM	SISSPSVSSETMDKPVDLSTR	1965	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3402.4	35.71618	3	2302.030571	2302.039973	K	K	2802	2823
PSM	RGGSGSHNWGTVKDELTESPK	1966	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3133.2	28.72947	4	2321.048094	2321.043754	K	Y	216	237
PSM	GSLAEAVGSPPPAATPTPTPPTR	1967	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3393.5	35.48466	3	2331.051071	2331.054910	R	K	446	469
PSM	LGSTAPQVLSTSSPAQQAENEAK	1968	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3383.4	35.2206	3	2393.111771	2393.111165	K	A	260	283
PSM	LDNTPASPPRSPAEPNDIPIAK	1969	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3375.5	35.0174	3	2459.112671	2459.113487	K	G	2311	2333
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENK	1970	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3208.6	30.69617	4	4076.770894	4076.772015	K	I	530	567
PSM	LSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGAR	1971	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21,43-UNIMOD:21	ms_run[1]:scan=1.1.3276.6	32.45765	5	4996.048618	4996.056840	R	L	74	122
PSM	GIETPQCDQSTGQCVCVEGVEGPR	1972	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3428.2	36.36532	3	2742.090071	2742.108481	R	C	1138	1162
PSM	IGPLGLSPK	1973	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3506.2	38.37345	2	960.502447	960.504534	K	K	32	41
PSM	NLLSVAYK	1974	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3664.2	42.38115	2	986.481447	986.483799	R	N	44	52
PSM	AVDSLVPIGR	1975	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3604.3	40.87733	2	1105.550847	1105.553276	K	G	195	205
PSM	STFVLDEFK	1976	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3965.2	49.89462	2	1164.508247	1164.510408	K	R	286	295
PSM	IADPEHDHTGFLTEYVATR	1977	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3511.2	38.50372	4	2330.966094	2330.961009	R	W	190	209
PSM	EMQNLSFQDCYSSK	1978	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3491.2	37.98318	3	1815.685271	1815.684502	K	F	102	116
PSM	EALAEAALESPRPALVR	1979	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3545.2	39.38407	3	1871.945471	1871.950628	R	S	271	288
PSM	RQPPVSPLTLSPGPEAHQGFSR	1980	sp|Q6UUV7|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3437.3	36.59363	4	2517.152894	2517.156689	R	Q	386	408
PSM	DDGVFVQEVTQNSPAAR	1981	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3558.3	39.72298	3	1911.835571	1911.836387	R	T	29	46
PSM	SSSSESEDEDVIPATQCLTPGIR	1982	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3668.4	42.49168	4	2557.087294	2557.089109	R	T	996	1019
PSM	GYFEYIEENK	1983	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3591.3	40.53763	2	1290.574447	1290.576833	R	Y	256	266
PSM	IMGTSPLQIDR	1984	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3546.3	39.41253	2	1309.604847	1309.610139	K	A	1075	1086
PSM	SAESPTSPVTSETGSTFK	1985	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3439.3	36.64532	3	1971.776771	1971.775165	K	K	280	298
PSM	QQGFNYCTSAISSPLTK	1986	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3608.2	40.97143	3	1980.861671	1980.865244	K	S	1671	1688
PSM	KAEAAASALADADADLEER	1987	sp|O43633|CHM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3637.3	41.6925	3	1995.873371	1995.878645	K	L	197	216
PSM	EFSPFGSITSAK	1988	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3856.3	47.27098	2	1349.584847	1349.590449	K	V	313	325
PSM	AEREKTPSAETPSEPVDWTFAQR	1989	sp|O60333|KIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3611.4	41.05185	4	2791.186894	2791.189171	R	E	642	665
PSM	EAAGGNDSSGATSPINPAVALE	1990	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3760.4	44.85228	3	2106.906071	2106.910674	K	-	1236	1258
PSM	ESVPEFPLSPPK	1991	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3775.2	45.23172	3	1405.652771	1405.653049	K	K	30	42
PSM	EQFLDGDGWTSR	1992	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3576.4	40.14942	2	1409.617247	1409.621158	K	W	25	37
PSM	IMNTFSVVPSPK	1993	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3479.4	37.67647	2	1414.655247	1414.656755	R	V	163	175
PSM	NDSPTQIPVSSDVCRLTPA	1994	sp|Q8TC07|TBC15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3550.5	39.52115	3	2135.952971	2135.955850	R	-	673	692
PSM	SATLASIDAELQK	1995	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3782.3	45.41537	2	1425.671447	1425.675241	K	L	527	540
PSM	TLTIVDTGIGMTK	1996	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3699.3	43.29528	2	1428.690047	1428.693534	R	A	28	41
PSM	TSSLAPVVGTTTTTPSPSAIK	1997	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3596.5	40.67542	3	2175.009371	2175.011313	K	A	226	247
PSM	ATLPSPDKLPGFK	1998	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3609.3	41.00263	2	1449.721647	1449.726883	K	M	831	844
PSM	ILATPPQEDAPSVDIANIR	1999	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3982.3	50.25615	3	2178.991271	2178.996332	K	M	284	303
PSM	SLVSVTKEGLELPEDEEEK	2000	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3861.4	47.40405	3	2210.018771	2210.024307	K	K	405	424
PSM	DGQAMLWDLNEGK	2001	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3830.4	46.60848	2	1475.667647	1475.671479	K	H	213	226
PSM	SLPTPAVLLSPTK	2002	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3922.2	48.94868	2	1482.712247	1482.713615	K	E	632	645
PSM	EQFLDGDGWTSR	2003	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3681.5	42.8325	2	1489.583247	1489.587489	K	W	25	37
PSM	DVNSSSPVMLAFK	2004	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3605.3	40.90158	2	1489.647647	1489.652398	K	S	28	41
PSM	SDPVVSYRETVSEESNVLCLSKSPNK	2005	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3706.5	43.48407	4	3003.390094	3003.389648	K	H	573	599
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	2006	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3915.3	48.77822	4	3032.288894	3032.284194	K	I	350	377
PSM	GPVSPSVSFQPLAR	2007	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3690.6	43.07038	2	1520.731847	1520.738845	R	S	219	233
PSM	TLTIVDTGIGMTK	2008	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3639.5	41.75128	2	1524.650647	1524.654780	R	A	28	41
PSM	EGEEAGPGDPLLEAVPKTGDEK	2009	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3530.5	39.00947	3	2317.028171	2317.036268	K	D	353	375
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRK	2010	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4098.3	52.91518	4	3109.360494	3109.368258	R	A	139	166
PSM	DYEEVGVDSVEGEGEEEGEEY	2011	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3778.5	45.319	3	2347.891571	2347.897571	K	-	431	452
PSM	HSDLFSSSSPWDK	2012	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3524.2	38.84325	3	1571.628671	1571.629354	K	G	779	792
PSM	IIAFVGSPVEDNEK	2013	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3614.4	41.12627	2	1596.737247	1596.743655	R	D	109	123
PSM	DHMVSPTAVAFLER	2014	sp|O60499|STX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3855.2	47.24187	3	1651.738271	1651.742944	K	N	104	118
PSM	NLEQILNGGESPKQK	2015	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3501.2	38.24272	3	1733.836571	1733.834930	K	G	219	234
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	2016	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3769.4	45.08225	4	3497.556494	3497.569417	R	E	1323	1356
PSM	SESETESEASEITIPPSTPAVPQAPVQGEDYGK	2017	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3669.6	42.5239	4	3509.554094	3509.561066	R	G	530	563
PSM	VDIDTPDINIEGSEGK	2018	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3583.6	40.3387	2	1780.774847	1780.776806	K	F	3712	3728
PSM	KEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	2019	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	30-UNIMOD:4,32-UNIMOD:21	ms_run[1]:scan=1.1.4000.4	50.69823	4	3809.728894	3809.734297	K	K	212	250
PSM	EKEPSYPMPVQETQAPESPGENSEQALQTLSPR	2020	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3726.6	44.0047	4	3813.640094	3813.648198	R	A	135	168
PSM	EKEPSYPMPVQETQAPESPGENSEQALQTLSPR	2021	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3743.6	44.43458	4	3813.640094	3813.648198	R	A	135	168
PSM	KISLPGQMAGTPITPLK	2022	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3711.2	43.60282	3	1910.931671	1910.934189	K	D	212	229
PSM	EVDGLLTSEPMGSPVSSK	2023	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3680.3	42.79982	3	1911.849971	1911.853676	K	T	582	600
PSM	KEESEESDDDMGFGLFD	2024	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4071.4	52.34763	2	1948.747047	1948.752033	K	-	98	115
PSM	SSTPPGESYFGVSSLQLK	2025	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4023.2	51.2324	3	1962.895571	1962.897590	K	G	1041	1059
PSM	LSGSNPYTTVTPQIINSK	2026	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3523.3	38.8206	3	1998.961571	1998.966338	K	W	605	623
PSM	VAPEEHPVLLTEAPLNPK	2027	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3566.4	39.90038	3	2033.022071	2033.023459	R	A	96	114
PSM	RYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQR	2028	sp|Q4V326|GAG2E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3733.6	44.18653	4	4076.822894	4076.828548	R	Q	16	51
PSM	DMGAQYAAASPAWAAAQQR	2029	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3582.5	40.30922	3	2042.867171	2042.866975	K	S	478	497
PSM	QFTPCQLLADHANSPNKK	2030	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3484.2	37.80103	4	2227.948094	2227.948671	K	F	743	761
PSM	IADPEHDHTGFLTEYVATR	2031	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3446.2	36.82262	4	2250.997694	2250.994678	R	W	190	209
PSM	ESMCSTPAFPVSPETPYVK	2032	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3883.3	47.96488	3	2285.898371	2285.902691	K	T	839	858
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	2033	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3577.5	40.17865	4	3062.398094	3062.401610	K	S	2194	2221
PSM	TQDPAKAPNTPDILEIEFKK	2034	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3645.3	41.9009	4	2334.153694	2334.150844	K	G	210	230
PSM	DNLTLWTSENQGDEGDAGEGEN	2035	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3839.4	46.8362	3	2349.934571	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	2036	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3831.4	46.63317	3	2349.934571	2349.946922	R	-	225	247
PSM	LVGQGASAVLLDLPNSGGEAQAK	2037	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4074.4	52.42439	3	2354.086871	2354.092023	R	K	30	53
PSM	AIVDALPPPCESACTVPTDVDK	2038	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3705.5	43.45793	3	2434.078871	2434.079730	R	W	261	283
PSM	AAVPSGASTGIYEALELRDNDK	2039	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4026.2	51.30698	4	2436.058094	2436.061117	R	T	33	55
PSM	KFVEWLQNAEEESESEGEEN	2040	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3862.4	47.43648	3	2461.974071	2461.979876	K	-	400	420
PSM	ADLLLSTQPGREEGSPLELER	2041	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3867.6	47.56538	3	2469.114671	2469.118966	K	L	593	614
PSM	DGAVNGPSVVGDQTPIEPQTSIER	2042	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3525.6	38.88275	3	2545.162571	2545.169742	K	L	377	401
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	2043	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4316.2	56.10552	3	2754.226571	2754.234331	R	Y	147	174
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2044	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3834.2	46.7048	4	2881.088494	2881.094982	K	T	701	725
PSM	NEDGTWPRGPSTPKSPGASNFSTLPK	2045	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3499.5	38.20055	4	2887.258094	2887.257920	K	I	215	241
PSM	FSISPDEDSSSYSSNSDFNYSYPTK	2046	sp|Q96QD8|S38A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3870.5	47.63957	3	2903.126171	2903.133476	R	Q	9	34
PSM	IADPEHDHTGFLTEYVATRWYR	2047	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3963.2	49.8464	4	2916.172094	2916.171093	R	A	190	212
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	2048	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3576.6	40.15608	3	2964.312371	2964.313840	K	-	178	207
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	2049	sp|Q12906-4|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	29-UNIMOD:21	ms_run[1]:scan=1.1.3758.5	44.80597	5	4535.114618	4535.111625	R	Q	475	520
PSM	QSKPVTTPEEIAQVATISANGDK	2050	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3751.5	44.62817	3	2526.1235	2526.1287	K	E	158	181
PSM	ESVPEFPLSPPK	2051	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3767.3	45.0274	2	1405.649047	1405.653049	K	K	30	42
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	2052	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3981.3	50.2242	4	3523.450494	3522.472617	K	F	604	634
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	2053	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3498.4	38.17082	4	3013.321294	3013.323630	K	K	62	95
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	2054	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3718.5	43.79212	4	3393.343294	3393.345713	K	F	86	114
PSM	MDEPSPLAQPLELNQHSR	2055	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	46.95857	3	2182.9592	2182.9712	-	F	1	19
PSM	MNPVYSPGSSGVPYANAK	2056	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.3581.3	40.27595	3	1975.8383	1975.8382	-	G	1	19
PSM	AGSEECVFYTDETASPLAPDLAKASPK	2057	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,15-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3844.5	46.9719	3	3013.298171	3013.270518	R	R	610	637
PSM	ALDDFVLGSAR	2058	sp|O60831|PRAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3861.2	47.39738	2	1242.559447	1242.564569	R	L	11	22
PSM	CESAFLSK	2059	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3972.4	50.04583	2	1003.3717	1003.3717	K	R	36	44
PSM	INPDGSQSVVEVPYAR	2060	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3481.4	37.72887	3	1809.829871	1809.829845	R	S	58	74
PSM	TWTTPEVTSPPPSPR	2061	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3492.3	38.0129	3	1812.756071	1811.753248	R	T	125	140
PSM	ATSPQKSPSVPKSPTPK	2062	sp|Q9NVD7|PARVA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2866.3	21.89833	3	1937.8853	1937.8896	M	S	2	19
PSM	VGDSTPVSEKPVSAAVDANASESP	2063	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3271.6	32.32693	3	2393.064971	2393.063546	R	-	429	453
PSM	AAPEASSPPASPLQHLLPGK	2064	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3794.4	45.73062	3	2128.974971	2126.980288	K	A	686	706
PSM	RELHGQNPVVTPCNK	2065	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2784.3	19.85943	4	1827.847694	1827.845118	K	Q	147	162
PSM	SPGETSKPRPFAGGGYR	2066	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2933.2	23.61133	4	1842.845694	1842.841412	K	L	140	157
PSM	APLKPYPVSPSDK	2067	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3041.2	26.39175	3	1477.723871	1477.721798	K	V	1039	1052
PSM	SSLGPVGLDK	2068	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3250.2	31.77925	2	1051.495847	1051.495092	K	M	34	44
PSM	SGLTVPTSPK	2069	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3077.3	27.2846	2	1065.509047	1065.510742	R	G	87	97
PSM	GGSGSHNWGTVKDELTESPK	2070	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3225.2	31.1267	4	2164.951294	2164.942643	R	Y	217	237
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	2071	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3145.2	29.04245	6	3290.602941	3290.597273	K	E	178	210
PSM	SSSPLPTVQLHPQSPTAGKK	2072	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3216.3	30.89522	4	2219.042894	2219.038866	K	H	998	1018
PSM	VDALLSAQPK	2073	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3181.2	29.97708	2	1120.553047	1120.552941	K	G	950	960
PSM	YNLQEVVKSPKDPSQLNSK	2074	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3300.3	33.07168	4	2253.105694	2253.104229	K	Q	262	281
PSM	DCGSVDGVIK	2075	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3086.3	27.51713	2	1128.452447	1128.452241	K	E	26	36
PSM	NYLQSLPSK	2076	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3343.3	34.18643	2	1128.520447	1128.521641	R	T	279	288
PSM	EKTPSPKEEDEEPESPPEK	2077	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2777.3	19.71698	4	2260.961694	2260.962435	K	K	200	219
PSM	AVASPEATVSQTDENK	2078	sp|Q641Q2|WAC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2962.5	24.37007	3	1725.745871	1725.745840	K	A	495	511
PSM	DKRPLSGPDVGTPQPAGLASGAK	2079	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3167.4	29.61863	4	2298.137694	2298.136926	R	L	176	199
PSM	DTGKTPVEPEVAIHR	2080	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3040.3	26.3695	3	1727.826971	1727.824365	K	I	5	20
PSM	NSFREQLEEEEEAK	2081	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3245.2	31.64912	3	1736.785571	1736.785323	K	H	1339	1353
PSM	MDATANDVPSPYEVR	2082	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3349.3	34.33807	3	1743.717071	1743.717517	K	G	434	449
PSM	LITPAVVSER	2083	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3381.2	35.16202	2	1163.592647	1163.595140	K	L	67	77
PSM	TISPMVMDAK	2084	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3326.2	33.74508	2	1171.500047	1171.501834	K	A	793	803
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	2085	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3026.3	26.02233	5	2968.362618	2968.358028	R	L	420	447
PSM	EAALPPVSPLK	2086	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	35.84108	2	1200.614247	1200.615542	R	A	1224	1235
PSM	KIYQEEEMPESGAGSEFNRK	2087	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3161.3	29.45963	4	2408.041294	2408.035557	K	L	55	75
PSM	VQEKPDSPGGSTQIQR	2088	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2770.6	19.5514	3	1805.831171	1805.830907	R	Y	1284	1300
PSM	RTEGVGPGVPGEVEMVK	2089	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3352.2	34.4129	3	1819.851071	1819.853951	R	G	16	33
PSM	IISTTASKTETPIVSK	2090	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3038.3	26.31888	3	1834.875071	1834.873029	K	S	140	156
PSM	NLQTVNVDEN	2091	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3149.3	29.15002	2	1224.501647	1224.502362	K	-	116	126
PSM	GPTTGEGALDLSDVHSPPKSPEGK	2092	sp|O95684|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3238.4	31.4729	4	2455.129294	2455.126815	K	T	141	165
PSM	DQVANSAFVER	2093	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3064.2	26.98478	2	1234.591847	1234.594215	K	L	500	511
PSM	VLQSPATTVVR	2094	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3087.4	27.54625	2	1249.639447	1249.643153	K	T	751	762
PSM	TSSGDPPSPLVK	2095	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3007.5	25.53753	2	1263.574047	1263.574799	K	Q	80	92
PSM	DKGDEEEEGEEKLEEK	2096	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2884.4	22.36183	3	1891.817471	1891.817077	K	Q	536	552
PSM	SRLTPVSPESSSTEEK	2097	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2893.6	22.59408	3	1892.781971	1892.780585	R	S	266	282
PSM	QVVESAYEVIK	2098	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3339.3	34.08572	2	1263.666247	1263.671068	K	L	233	244
PSM	YVECSALTQK	2099	sp|P60953|CDC42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3081.5	27.39402	2	1277.542247	1277.536305	K	G	154	164
PSM	VGNESPVQELK	2100	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3046.5	26.53085	2	1278.586047	1278.585698	K	Q	46	57
PSM	GGSGSGPTIEEVD	2101	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3271.5	32.3236	2	1283.491447	1283.491857	K	-	629	642
PSM	SSPNPFVGSPPK	2102	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3229.3	31.23448	2	1292.578647	1292.580219	K	G	393	405
PSM	QHEAPSNRPLNELLTPQGPSPR	2103	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3418.2	36.12238	4	2597.181294	2597.178881	R	T	167	189
PSM	HTIIPAKSPEK	2104	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2774.2	19.64197	3	1299.660971	1299.658803	R	C	1908	1919
PSM	GNKSPSPPDGSPAATPEIR	2105	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3001.2	25.37073	3	1956.895271	1956.894236	K	V	293	312
PSM	ASPGTPLSPGSLR	2106	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3332.3	33.90498	2	1318.626047	1318.628231	R	S	33	46
PSM	EITALAPSTMK	2107	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3399.5	35.64197	2	1320.540847	1320.543772	K	I	318	329
PSM	EITALAPSTMK	2108	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3158.4	29.38535	2	1336.538247	1336.538687	K	I	318	329
PSM	FNGQATKTPEPSSPVKEPPPVLAK	2109	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3193.4	30.29702	4	2678.280094	2678.275801	R	P	632	656
PSM	TFDQLTPDESK	2110	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3118.4	28.35215	2	1359.559447	1359.559543	K	E	71	82
PSM	SSTPLHSPSPIR	2111	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2959.4	24.28947	3	1357.641071	1357.639131	R	V	283	295
PSM	HSPNLSFEPNFCQDNPRSPTSSK	2112	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3398.4	35.61245	4	2725.159294	2725.159194	K	E	107	130
PSM	ICEPGYSPTYK	2113	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3132.6	28.71712	2	1393.562847	1393.562520	K	Q	210	221
PSM	GGNFGGRSSGPYGGGGQYFAK	2114	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3312.5	33.39115	3	2099.8825	2099.8845	K	P	330	351
PSM	EMPQDLRSPARTPPSEEDSAEAER	2115	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3138.6	28.87312	4	2857.162894	2857.162699	K	L	70	94
PSM	TLRLNQPGTPTR	2116	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2953.2	24.12695	3	1432.717571	1432.718778	K	T	386	398
PSM	EMPQDLRSPARTPPSEEDSAEAER	2117	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2993.3	25.16763	4	2873.160094	2873.157614	K	L	70	94
PSM	SSTPLHSPSPIR	2118	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2979.2	24.80082	3	1437.606071	1437.605462	R	V	283	295
PSM	GSGSGGSGSDSEPDSPVFEDSK	2119	sp|P36956|SRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3088.6	27.57868	3	2163.808271	2163.811748	R	A	447	469
PSM	DKKDEEEDMSLD	2120	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2951.4	24.08182	3	1452.595871	1452.592620	K	-	396	408
PSM	CIACQAAKLSPR	2121	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2975.2	24.69725	3	1453.659671	1453.657106	K	D	678	690
PSM	ETPAATEAPSSTPK	2122	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2734.3	18.68955	2	1465.630047	1465.633770	K	A	185	199
PSM	RRGNDPLTSSPGR	2123	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2765.2	19.42642	3	1491.696071	1491.694354	R	S	18	31
PSM	AGDLLEDSPKRPK	2124	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2901.2	22.78635	3	1504.728071	1504.728674	R	E	158	171
PSM	SESPKEPEQLRK	2125	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2746.2	18.97067	3	1506.706271	1506.707938	K	L	4	16
PSM	NWMVGGEGGAGGRSP	2126	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3396.5	35.56339	2	1510.598647	1510.602427	K	-	79	94
PSM	NTNDANSCQIIIPQNQVNR	2127	sp|P31150|GDIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3338.6	34.07018	3	2278.009871	2278.016159	K	K	310	329
PSM	NIIHGSDSVESAEK	2128	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2948.4	24.01053	2	1564.676447	1564.677032	R	E	115	129
PSM	NIIHGSDSVKSAEK	2129	sp|O60361|NDK8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2794.2	20.09958	3	1563.726671	1563.729402	R	E	100	114
PSM	QSPASPPPLGGGAPVR	2130	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3205.2	30.60368	3	1566.756071	1566.755557	R	T	1444	1460
PSM	SSPGSPQSPSSGAEAADEDSNDSPASSSSRPLK	2131	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2997.5	25.27788	4	3268.372894	3268.364098	K	V	297	330
PSM	VLGTSPEAIDSAENR	2132	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3295.2	32.93896	3	1637.730371	1637.729796	R	F	1034	1049
PSM	GGKPEPPAMPQPVPTA	2133	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3294.2	32.91333	3	1652.775071	1652.763345	K	-	228	244
PSM	AGGPTTPLSPTRLSR	2134	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3239.2	31.49248	3	1669.763471	1669.759002	R	L	15	30
PSM	ESLKEEDESDDDNM	2135	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2692.2	18.24327	3	1670.608271	1670.610121	K	-	242	256
PSM	ENVNATENCISAVGK	2136	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3147.3	29.0979	3	1684.713971	1684.712766	K	I	964	979
PSM	KYEMFAQTLQQSR	2137	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3181.3	29.98042	3	1724.760971	1724.759322	R	G	754	767
PSM	AVASPEATVSQTDENK	2138	sp|Q641Q2|WAC2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2970.5	24.57822	3	1725.745871	1725.745840	K	A	495	511
PSM	EADGSETPEPFAAEAK	2139	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3239.5	31.50248	2	1727.690647	1727.692742	R	F	234	250
PSM	HAEPLTDTGSETPTAR	2140	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2859.4	21.72072	3	1761.756671	1761.757074	K	R	51	67
PSM	KPAAAAAPGTAEKLSPK	2141	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2810.2	20.4807	3	1766.834471	1766.836918	K	A	23	40
PSM	VSEEAESQQQWDTSKGEQVSQNGLPAEQGSPR	2142	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3291.6	32.84853	4	3565.560094	3565.559443	K	M	2109	2141
PSM	TAENATSGETLEENEAGD	2143	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3012.6	25.67098	2	1836.745647	1836.749725	K	-	377	395
PSM	LGAGGGSPEKSPSAQELK	2144	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2965.3	24.44127	3	1871.806271	1871.806740	R	E	13	31
PSM	DVDDGSGSPHSPHQLSSK	2145	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2739.3	18.8078	4	1928.792494	1928.790165	R	S	2022	2040
PSM	RADLNQGIGEPQSPSRR	2146	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2892.3	22.55812	4	1959.934094	1959.927602	R	V	62	79
PSM	GPPASSPAPAPKFSPVTPK	2147	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3368.2	34.82865	3	2071.878671	2071.882228	R	F	254	273
PSM	SSPASSQEGSPSGDQQFSPK	2148	sp|Q6ZW49|PAXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2936.5	23.69628	3	2086.843271	2086.848073	K	S	218	238
PSM	IASPVSRKEPPLTPVPLK	2149	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3309.3	33.30553	4	2088.078494	2088.078545	K	R	207	225
PSM	SAESPTSPVTSETGSTFKK	2150	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3246.3	31.6786	3	2099.872271	2099.870128	K	F	280	299
PSM	TVEVAEGEAVRTPQSVTAK	2151	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3164.5	29.54425	3	2130.958271	2130.959947	R	Q	132	151
PSM	AGEAAELQDAEVESSAKSGKP	2152	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3167.5	29.62197	3	2152.950671	2152.952539	K	-	657	678
PSM	AACPLDSESAEGVVPPASGGGR	2153	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3324.5	33.70284	3	2162.922971	2162.930364	K	V	2201	2223
PSM	QISSSSTGCLSSPNATVQSPK	2154	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3100.6	27.89073	3	2214.979271	2214.982793	K	H	266	287
PSM	EEDCHSPTSKPPKPDQPLK	2155	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2762.2	19.35128	4	2269.006894	2269.008614	K	V	454	473
PSM	VGDSTPVSEKPVSAAVDANASESP	2156	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3310.6	33.34132	3	2393.064971	2393.063546	R	-	429	453
PSM	ITRKPVTVSPTTPTSPTEGEAS	2157	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3009.5	25.58942	3	2415.093671	2415.097168	R	-	502	524
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	2158	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2840.4	21.23873	3	2611.084571	2611.085754	K	L	460	485
PSM	ASSDLDQASVSPSEEENSESSSESEK	2159	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3044.6	26.48315	3	2794.079771	2794.082562	K	T	173	199
PSM	QSPGHQSPLASPKVPVCQPLKEEDDDEGPVDK	2160	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,11-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3341.4	34.13967	5	3642.592618	3642.595040	K	S	265	297
PSM	SGSMEEDVDTSPGGDYYTSPSSPTSSSR	2161	sp|P08651|NFIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35,21-UNIMOD:21	ms_run[1]:scan=1.1.3227.6	31.1922	3	2978.130671	2978.128467	K	N	284	312
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	2162	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2820.4	20.74195	4	3024.351694	3024.356099	K	S	145	174
PSM	WLDDLLASPPPSGGGAR	2163	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4549.2	58.91812	3	1867.787471	1867.790696	R	R	684	701
PSM	LQEKLSPPYSSPQEFAQDVGR	2164	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3816.5	46.29275	3	2535.112271	2535.108402	R	M	747	768
PSM	GLLTPIIK	2165	sp|O00330|ODPX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3924.2	48.99075	2	933.529047	933.530021	K	D	372	380
PSM	VSFELFADKVPKTAENFR	2166	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3830.3	46.60515	4	2177.048894	2177.055822	R	A	20	38
PSM	DLNSYLEDK	2167	sp|O43324|MCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3442.2	36.71958	2	1095.505647	1095.508420	K	V	97	106
PSM	DLASPLIGRS	2168	sp|O95067|CCNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	40.14608	2	1107.530647	1107.532540	K	-	389	399
PSM	GGVVTSNPLGF	2169	sp|P49748|ACADV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4285.2	55.66933	2	1126.501447	1126.505991	R	-	645	656
PSM	EASRPPEEPSAPSPTLPAQFK	2170	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3449.3	36.90372	4	2315.0836	2315.0830	R	Q	351	372
PSM	STFVLDEFK	2171	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3955.2	49.67238	2	1164.508247	1164.510408	K	R	286	295
PSM	SADTLWDIQK	2172	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3517.2	38.66103	2	1175.580247	1175.582253	K	D	320	330
PSM	ELIFQETAR	2173	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3516.2	38.6351	2	1185.541647	1185.543105	K	F	362	371
PSM	AAALAAAVAQDPAASGAPSS	2174	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3479.2	37.6698	3	1775.806271	1775.809109	R	-	203	223
PSM	VYWDNGAQIISPHDK	2175	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3490.4	37.964	3	1821.810971	1821.808715	K	G	176	191
PSM	VSTAVLSITAK	2176	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3438.2	36.61633	2	1248.574247	1248.576787	K	A	828	839
PSM	SGEISLPIKEEPSPISK	2177	sp|Q9ULH7|MRTFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3512.4	38.53658	3	1889.937971	1889.938726	K	M	909	926
PSM	QSKPVTTPEEIAQVATISANGDK	2178	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3533.2	39.07777	4	2543.152894	2543.155746	K	E	158	181
PSM	DLKPSNLLLNTTCDLK	2179	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3717.2	43.75575	3	1923.934871	1923.937681	R	I	149	165
PSM	DAGTIAGLNVMR	2180	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	45.10217	2	1296.585647	1296.589737	K	I	186	198
PSM	DITEEIMSGAR	2181	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3748.4	44.55112	2	1300.534847	1300.537033	K	T	191	202
PSM	SAESPTSPVTSETGSTFK	2182	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3447.3	36.85157	3	1971.776771	1971.775165	K	K	280	298
PSM	SILSPGGSCGPIK	2183	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3459.3	37.16443	2	1351.618447	1351.620704	R	V	207	220
PSM	DATNVGDEGGFAPNILENK	2184	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3862.2	47.42315	3	2039.877971	2039.883731	K	E	203	222
PSM	EFSPFGTITSAK	2185	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3901.2	48.42042	2	1363.599647	1363.606099	K	V	313	325
PSM	EFSPFGTITSAK	2186	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3841.2	46.88098	2	1363.600447	1363.606099	K	V	313	325
PSM	IVSAQSLAEDDVE	2187	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3471.4	37.4706	2	1374.647247	1374.651455	R	-	133	146
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	2188	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3865.3	47.50395	5	3522.470118	3522.472617	K	F	604	634
PSM	IMNTFSVVPSPK	2189	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3495.4	38.0935	2	1414.655247	1414.656755	R	V	163	175
PSM	GFPTIYFSPANK	2190	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3938.3	49.29013	2	1420.639647	1420.642819	R	K	449	461
PSM	STAALSGEAASCSPIIMPYK	2191	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3678.3	42.74771	3	2132.947271	2132.952345	K	A	242	262
PSM	SSTVGLVTLNDMK	2192	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3750.4	44.60012	2	1443.661447	1443.668047	K	A	62	75
PSM	TQYNQVPSEDFERTPQSPTLPPAK	2193	sp|P78310|CXAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3471.5	37.47393	4	2889.266894	2889.262336	K	V	316	340
PSM	GVAQTPGSVEEDALLCGPVSK	2194	sp|Q9BQP7|MGME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	5-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3791.4	45.65275	3	2192.9965	2193.0019	R	H	64	85
PSM	DVNSSSPVMLAFK	2195	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3843.2	46.93277	3	1473.654671	1473.657483	K	S	28	41
PSM	TLVSVTKEGLELPEDEEEK	2196	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3832.3	46.65472	3	2224.028171	2224.039957	K	K	540	559
PSM	ELSESVQQQSTPVPLISPK	2197	sp|Q9ULU4|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3594.2	40.6127	3	2226.018671	2226.022212	K	R	531	550
PSM	GFSVVADTPELQR	2198	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3529.5	38.98357	2	1497.678447	1497.686475	K	I	97	110
PSM	DSAGQDINLNSPNK	2199	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3534.5	39.11348	2	1551.6527	1551.6561	M	G	2	16
PSM	TSESTGSLPSPFLR	2200	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3696.5	43.22332	2	1557.707047	1557.707604	K	A	177	191
PSM	GNPTVEVDLFTSK	2201	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3918.4	48.84893	2	1565.638247	1565.641572	R	G	16	29
PSM	GALQNIIPASTGAAK	2202	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3661.5	42.31228	2	1570.709647	1570.715740	R	A	201	216
PSM	DMSPLSETEMALGK	2203	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3999.4	50.67248	2	1603.647647	1603.651077	K	D	505	519
PSM	IDFSSIAVPGTSSPR	2204	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3900.6	48.40771	2	1612.747447	1612.749803	R	Q	94	109
PSM	AIVDALPPPCESACTVPTDVDK	2205	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3713.5	43.6636	3	2434.078871	2434.079730	R	W	261	283
PSM	MSPNETLFLESTNK	2206	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3685.4	42.94003	3	1689.728171	1689.732104	K	I	85	99
PSM	CELLSDDSLAVSSPR	2207	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3612.2	41.0699	3	1727.739071	1727.743732	K	L	292	307
PSM	LNDPFQPFPGNDSPK	2208	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3860.2	47.3715	3	1751.754671	1751.755617	K	E	802	817
PSM	NSPEDLGLSLTGDSCK	2209	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3628.5	41.47407	2	1771.729447	1771.733561	K	L	499	515
PSM	ELSPDFYQPGPDYVK	2210	sp|Q9HDC5|JPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3760.3	44.84895	3	1833.784571	1833.786248	R	Q	411	426
PSM	YMSPMEAQEFGILDK	2211	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4075.3	52.447	3	1837.767071	1837.766775	R	V	229	244
PSM	WLDDLLASPPPSGGGAR	2212	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4598.2	59.31752	3	1867.789871	1867.790696	R	R	684	701
PSM	SESAPTLHPYSPLSPK	2213	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3463.2	37.26513	3	1869.796271	1869.795113	R	G	100	116
PSM	GDVVNQDDLYQALASGK	2214	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3815.2	46.25807	3	1871.826371	1871.830239	R	I	246	263
PSM	CFSPGVIEVQEVQGKK	2215	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3514.3	38.5859	3	1883.886371	1883.885251	R	V	256	272
PSM	SLGNAPNTPDFYQQLR	2216	sp|Q13370|PDE3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3727.3	44.02045	3	1899.837971	1899.851643	R	N	554	570
PSM	SQIFSTASDNQPTVTIK	2217	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3510.6	38.4914	2	1915.889047	1915.892839	K	V	448	465
PSM	TDGFAEAIHSPQVAGVPR	2218	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3508.2	38.4259	3	1930.894571	1930.893842	R	F	2146	2164
PSM	SMDEFTASTPADLGEAGR	2219	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3572.2	40.03962	3	1933.782371	1933.776488	R	L	380	398
PSM	NASTFEDVTQVSSAYQK	2220	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3452.5	36.98865	3	1953.834971	1953.835718	K	T	320	337
PSM	SGAMSPMSWNSDASTSEAS	2221	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3790.6	45.63353	2	1981.702647	1981.707088	R	-	190	209
PSM	GTDECAIESIAVAATPIPK	2222	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3780.2	45.3604	3	2021.938871	2021.938075	R	L	444	463
PSM	DSSTCPGDYVLSVSENSR	2223	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3750.3	44.59678	3	2051.811371	2051.814331	R	V	40	58
PSM	TVDFTQDSNYLLTGGQDK	2224	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3809.3	46.1122	3	2080.897871	2080.899046	K	L	105	123
PSM	ATESGAQSAPLPMEGVDISPK	2225	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3679.5	42.78022	3	2163.969371	2163.975917	K	Q	8	29
PSM	IIEVAPQVATQNVNPTPGATS	2226	sp|P49903|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3613.6	41.10785	3	2186.057471	2186.062029	R	-	372	393
PSM	DNLTLWTSDQQDDDGGEGNN	2227	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3869.3	47.60685	3	2192.864171	2192.873028	R	-	228	248
PSM	DSFGSSQASVASSQPVSSEMYR	2228	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3503.5	38.30512	3	2385.977771	2385.978436	K	D	741	763
PSM	ADLLLSTQPGREEGSPLELER	2229	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3739.5	44.33318	3	2389.152371	2389.152635	K	L	593	614
PSM	GQIPPLVTTDCMIQDQGNASPR	2230	sp|O94855|SC24D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3801.4	45.91267	3	2477.100671	2477.108010	R	F	289	311
PSM	DNLTLWTADNAGEEGGEAPQEPQS	2231	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3880.5	47.89787	3	2528.086871	2528.093920	R	-	225	249
PSM	EATNTTSEPSAPSQDLLDLSPSPR	2232	sp|O75674|TM1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3738.4	44.30528	3	2592.153671	2592.159237	K	M	302	326
PSM	TASTPTPPQTGGGLEPQANGETPQVAVIVRPDDR	2233	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3700.6	43.33125	4	3615.658494	3615.660752	R	S	202	236
PSM	QSKPVTTPEEIAQVATISANGDK	2234	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.3707.4	43.5069	3	2446.1554	2446.1623	K	E	158	181
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2235	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4,18-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3511.6	38.51705	4	3563.472494	3562.491898	K	V	60	92
PSM	DGDSYRSPWSNKYDPPLEDGAMPSAR	2236	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3660.5	42.28642	4	2990.251294	2990.254217	R	L	67	93
PSM	AGDLLEDSPK	2237	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3107.2	28.05988	2	1123.481247	1123.479836	R	R	158	168
PSM	LTFDSSFSPNTGKK	2238	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3476.2	37.59138	3	1687.691171	1687.689585	K	N	97	111
PSM	AAPEASSPPASPLQHLLPGK	2239	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3838.3	46.81027	3	2128.978571	2126.980288	K	A	686	706
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2240	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3900.2	48.39438	4	2749.2252	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2241	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3728.6	44.05652	3	2845.1869	2845.1913	-	Y	1	25
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	2242	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3349.6	34.34807	4	2993.327294	2991.328110	R	V	221	251
PSM	SSAPTTPPSVDKVDGFSRK	2243	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3340.4	34.11465	3	2096.9722	2096.9774	M	S	2	21
PSM	SSAPTTPPSVDKVDGFSR	2244	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3514.4	38.58923	3	1968.8807	1968.8825	M	K	2	20
PSM	NVSSFPDDATSPLQENR	2245	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3457.3	37.11262	3	1956.828071	1955.826216	R	N	52	69
PSM	MPPRTPAEASSTGQTGPQSAL	2246	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3305.4	33.2035	3	2242.935971	2242.933080	K	-	238	259
PSM	CDFTEDQTAEFK	2247	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3682.6	42.86207	2	1611.5781	1611.5795	M	E	2	14
PSM	SETAPAAPAAPAPAEKTPVK	2248	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.3037.6	26.3039	3	2024.9807	2024.9815	M	K	2	22
PSM	ASGVTVNDEVIK	2249	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3546.4	39.41587	2	1352.6194	1352.6220	M	V	2	14
PSM	SDEFSLADALPEHSPAK	2250	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3992.2	50.48767	2	1934.8263	1934.8294	M	T	2	19
PSM	MQSPAVLVTSR	2251	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3747.3	44.52347	2	1309.6051	1309.6096	-	R	1	12
PSM	CESAFLSK	2252	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3132.2	28.70378	2	1020.398047	1020.398749	K	R	36	44
PSM	AASPPASASDLIEQQQK	2253	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3362.2	34.67355	3	1819.832771	1819.835324	R	R	333	350
PSM	VDGPRSPSYGR	2254	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2740.2	18.83947	3	1269.550871	1269.550315	K	S	194	205
PSM	KGQDSEPSLNLLSPHSKGSTDSGYFSR	2255	sp|P31629|ZEP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	16-UNIMOD:21,19-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.2791.6	20.04042	4	3135.3002	3133.2822	K	S	377	404
PSM	SSFYPDGGDQETAKTGK	2256	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2984.6	24.94305	3	1866.768971	1866.767304	R	F	319	336
PSM	GPPSPPAPVMHSPSRK	2257	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2968.4	24.52307	3	1800.782471	1800.778357	R	M	221	237
PSM	QFVFDLHSGK	2258	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=1.1.4052.2	51.9056	2	1239.5321	1239.5320	K	L	346	356
PSM	NGSLDSPGKQDTEEDEEEDEK	2259	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2909.6	23.00602	3	2430.904271	2429.923149	K	D	134	155
PSM	RGSLSNAGDPEIVKSPSDPK	2260	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2974.3	24.67503	4	2136.000094	2133.010328	R	Q	92	112
PSM	LVPVLSAK	2261	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3322.2	33.64068	2	905.497247	905.498721	K	A	270	278
PSM	VLTPTQVK	2262	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3020.2	25.86613	2	964.499247	964.499449	K	N	40	48
PSM	MLQAISPK	2263	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	27.79902	2	966.459447	966.460955	R	Q	310	318
PSM	KETPPPLVPPAAR	2264	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3168.2	29.63798	3	1451.753171	1451.753766	R	E	3	16
PSM	NIIHGSDSVESAEK	2265	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2880.3	22.25943	3	1484.708771	1484.710701	R	E	115	129
PSM	VPLSAYER	2266	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3258.2	31.98092	2	1013.457847	1013.458313	R	V	2385	2393
PSM	DVNAAIATIK	2267	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3301.2	33.0941	2	1014.570247	1014.570960	K	T	327	337
PSM	RSINKLDSPDPFK	2268	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3207.2	30.65662	3	1595.769971	1595.770873	K	L	789	802
PSM	DYDDMSPR	2269	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2940.4	23.79618	2	1077.345647	1077.347441	R	R	279	287
PSM	AQQNNVEHKVETFSGVYK	2270	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3227.2	31.17887	4	2156.986894	2156.989199	K	K	161	179
PSM	HGSYEDAVHSGALND	2271	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3049.4	26.60413	3	1650.628871	1650.631145	K	-	542	557
PSM	DANNGNLQLR	2272	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2939.4	23.7703	2	1113.551447	1113.552684	K	N	288	298
PSM	GHTDTEGRPPSPPPTSTPEK	2273	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2749.2	19.03557	4	2246.928094	2246.924624	R	C	353	373
PSM	SASVAPFTCK	2274	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3168.3	29.64132	2	1146.479047	1146.478062	K	T	1057	1067
PSM	EQGPYETYEGSPVSK	2275	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3121.3	28.42612	3	1749.715871	1749.713477	K	G	549	564
PSM	DNLTSATLPR	2276	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3322.5	33.65068	2	1166.530447	1166.533268	K	N	302	312
PSM	SWNETLTSR	2277	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3213.4	30.82028	2	1172.486847	1172.486318	K	L	33	42
PSM	TEAQDLCRASPEPPGPESSSR	2278	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3009.3	25.58275	4	2349.995694	2349.989669	R	W	663	684
PSM	LALGDDSPALK	2279	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3330.5	33.85948	2	1178.556647	1178.558421	R	E	87	98
PSM	DPNSPLYSVK	2280	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3235.2	31.38807	2	1198.526247	1198.527120	R	S	82	92
PSM	SNSPLPVPPSK	2281	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3005.2	25.4751	2	1201.573047	1201.574405	R	A	301	312
PSM	ALINSPEGAVGR	2282	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3286.4	32.71093	2	1262.600247	1262.602017	R	S	66	78
PSM	NQSPVLEPVGR	2283	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3098.4	27.83112	2	1274.601047	1274.602017	R	S	713	724
PSM	GISCMNTTLSESPFKCDPDAAR	2284	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,5-UNIMOD:35,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3387.4	35.32498	4	2552.042894	2552.038277	K	A	239	261
PSM	ELASPVSPELR	2285	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3298.3	33.02063	2	1276.606247	1276.606433	K	Q	175	186
PSM	NISSAQIVGPGPKPEASAK	2286	sp|P53990|IST1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3128.3	28.60593	3	1929.956771	1929.956108	K	L	291	310
PSM	IACRSPQPDPVGTPTIFKPQSK	2287	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3413.3	36.00095	4	2583.196894	2583.195777	K	R	2219	2241
PSM	NLQYYDISAK	2288	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3413.4	36.00428	2	1293.563047	1293.564234	K	S	143	153
PSM	GCLLYGPPGTGK	2289	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3362.5	34.68355	2	1298.569647	1298.573025	K	T	169	181
PSM	SKWDEEWDK	2290	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3310.4	33.33465	2	1301.495847	1301.496549	K	N	182	191
PSM	ISVYYNEATGGK	2291	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3145.4	29.04912	2	1300.629447	1300.629932	R	Y	47	59
PSM	RRDEDMLYSPELAQR	2292	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3311.5	33.36462	3	1957.868771	1957.871726	R	G	229	244
PSM	ACRPPGSPGRAPPPTPAPSGCDPR	2293	sp|O95685|PPR3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,7-UNIMOD:21,15-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2853.2	21.56067	4	2614.098494	2614.097143	R	L	40	64
PSM	GAGAGHPGAGGAQPPDSPAGVR	2294	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2842.4	21.28773	3	1962.866771	1962.869752	R	T	71	93
PSM	SLVESVSSSPNK	2295	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3000.5	25.35525	2	1312.589047	1312.591177	R	E	309	321
PSM	AGGPTTPLSPTR	2296	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2923.4	23.3625	2	1313.539847	1313.541799	R	L	15	27
PSM	NLSPGAVESDVR	2297	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3381.4	35.16868	2	1322.581047	1322.586761	K	G	171	183
PSM	KITIADCGQLE	2298	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3371.4	34.91287	2	1326.592047	1326.589069	K	-	155	166
PSM	AGDNIPEEQPVASTPTTVSDGENKK	2299	sp|Q9Y320|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3079.3	27.33533	4	2663.195694	2663.196351	K	D	270	295
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2300	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2777.4	19.72032	4	2673.046494	2673.045055	K	G	134	157
PSM	LDQPVSAPPSPR	2301	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2987.6	25.02215	2	1342.628247	1342.628231	K	D	235	247
PSM	NGEVVHTPETSV	2302	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3026.6	26.03233	2	1347.571647	1347.570776	K	-	454	466
PSM	DAQHYGGWEHR	2303	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2877.2	22.17883	3	1354.578371	1354.580296	K	D	559	570
PSM	REAALPPVSPLK	2304	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3217.2	30.91805	3	1356.716771	1356.716653	K	A	1223	1235
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2305	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3354.4	34.47167	4	2717.305694	2717.307830	R	R	31	56
PSM	STAQQELDGKPASPTPVIVASHTANK	2306	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3163.4	29.51455	4	2726.326094	2726.327640	R	E	847	873
PSM	SQSLPNSLDYTQTSDPGR	2307	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3414.3	36.0269	3	2044.875671	2044.873894	R	H	44	62
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	2308	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2904.4	22.87045	4	2750.186094	2750.193331	R	T	13	39
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	2309	sp|Q9NTJ3|SMC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2912.6	23.08325	4	2750.186094	2750.193331	R	T	13	39
PSM	SGSLDSELSVSPK	2310	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3326.4	33.75175	2	1384.605247	1384.612307	K	R	2718	2731
PSM	TQYNQVPSEDFERTPQSPTLPPAK	2311	sp|P78310|CXAR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3405.2	35.78843	4	2809.296894	2809.296005	K	V	316	340
PSM	INVYYNEATGGK	2312	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3174.5	29.80395	2	1407.607447	1407.607162	R	Y	47	59
PSM	GILAADESTGSIAK	2313	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3269.4	32.26847	2	1411.656247	1411.659591	K	R	29	43
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	2314	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3230.3	31.26028	4	2838.182094	2838.177635	K	M	23	49
PSM	NGEVVHTPETSV	2315	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3053.5	26.71145	2	1427.534447	1427.537107	K	-	454	466
PSM	RRSPSPYYSR	2316	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2744.2	18.92092	3	1427.578871	1427.574830	R	Y	258	268
PSM	SSDQPLTVPVSPK	2317	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3269.5	32.2718	2	1433.678447	1433.680327	K	F	728	741
PSM	GGDSIGETPTPGASK	2318	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2872.4	22.06302	2	1452.614047	1452.613369	R	R	319	334
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	2319	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.3223.5	31.08503	4	2914.286094	2914.285140	K	L	281	308
PSM	TPQAPASANLVGPR	2320	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3136.4	28.81435	2	1457.702847	1457.702793	R	S	2329	2343
PSM	EVDEQMLNVQNK	2321	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:35	ms_run[1]:scan=1.1.2933.4	23.618	2	1461.675647	1461.676959	K	N	325	337
PSM	SKPIPIMPASPQK	2322	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3178.6	29.91238	2	1472.741647	1472.746238	K	G	607	620
PSM	GTDTQTPAVLSPSK	2323	sp|P46087|NOP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3027.4	26.05058	2	1480.678047	1480.681055	K	T	722	736
PSM	DVSGPMPDSYSPR	2324	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3233.6	31.34935	2	1486.579847	1486.579961	K	Y	291	304
PSM	TTPSYVAFTDTER	2325	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3379.5	35.11957	2	1486.691047	1486.693989	R	L	37	50
PSM	GGEIQPVSVKVGDK	2326	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3106.2	28.03357	3	1491.735971	1491.733425	K	V	57	71
PSM	CTGGEVGATSALAPK	2327	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3092.5	27.6782	2	1497.650447	1497.653460	R	I	17	32
PSM	RPESPSEISPIK	2328	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3032.4	26.1743	2	1498.647447	1498.646992	K	G	218	230
PSM	SSDQPLTVPVSPK	2329	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3348.4	34.31565	2	1513.642847	1513.646658	K	F	728	741
PSM	SGSSSPDSEITELK	2330	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3325.5	33.72923	2	1515.631447	1515.634164	R	F	571	585
PSM	NRVIGSGCNLDSAR	2331	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2894.4	22.6134	3	1517.729771	1517.736873	K	F	156	170
PSM	SARDHAISLSEPR	2332	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2973.3	24.64905	3	1517.700371	1517.698771	R	M	792	805
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	2333	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3380.4	35.14252	4	3037.298894	3037.291647	K	E	117	144
PSM	GDATVSYEDPPTAK	2334	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3005.5	25.4851	2	1529.627847	1529.628685	K	A	411	425
PSM	ELSDQATASPIVAR	2335	sp|Q5JSH3|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3143.3	28.9937	3	1536.721871	1536.718503	K	T	88	102
PSM	NVFSSSGTSFSGRK	2336	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3165.3	29.5632	3	1539.671771	1539.671887	K	I	1453	1467
PSM	SLPTTVPESPNYR	2337	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3290.3	32.81199	2	1539.695247	1539.697039	R	N	766	779
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	2338	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2805.3	20.36617	4	3104.324894	3104.322430	K	S	145	174
PSM	GDRSPEPGQTWTR	2339	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2942.4	23.8483	3	1565.671871	1565.662385	K	E	90	103
PSM	NIIHGSDSVKSAEK	2340	sp|O60361|NDK8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2795.4	20.13033	2	1563.725647	1563.729402	R	E	100	114
PSM	QSPASPPPLGGGAPVR	2341	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	30.81362	3	1566.756071	1566.755557	R	T	1444	1460
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	2342	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3260.6	32.04422	4	3162.510094	3162.502310	K	E	179	210
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	2343	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3243.5	31.60692	4	3162.510094	3162.502310	K	E	179	210
PSM	VPPAPVPCPPPSPGPSAVPSSPK	2344	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4,16-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3393.6	35.488	3	2378.076971	2378.078288	K	S	366	389
PSM	WDQTADQTPGATPK	2345	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2933.6	23.62467	2	1674.631847	1674.632799	R	K	200	214
PSM	GVEPSPSPIKPGDIK	2346	sp|Q92890|UFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3254.2	31.88132	3	1679.759771	1679.757271	K	R	241	256
PSM	DVYLSPRDDGYSTK	2347	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3188.2	30.1597	3	1694.722271	1694.718897	R	D	204	218
PSM	DVYLSPRDDGYSTK	2348	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3196.3	30.37205	3	1694.722271	1694.718897	R	D	204	218
PSM	TLNAETPKSSPLPAK	2349	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2962.4	24.36673	3	1712.779571	1712.778735	R	G	208	223
PSM	ATQTPSCWAEEGAEK	2350	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3210.6	30.74892	2	1743.687047	1743.681132	K	R	201	216
PSM	IDEMPEAAVKSTANK	2351	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3051.2	26.65005	3	1762.723271	1762.724984	R	Y	30	45
PSM	TDSVIIADQTPTPTR	2352	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3265.2	32.15913	3	1773.758471	1773.758727	R	F	42	57
PSM	RTEGVGPGVPGEVEMVK	2353	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3190.3	30.21523	3	1835.848571	1835.848866	R	G	16	33
PSM	PGPTPSGTNVGSSGRSPSK	2354	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2729.2	18.583	3	1848.8399	1848.8362	M	A	2	21
PSM	GSTHPQPGVSPPAAPAAPGPK	2355	sp|O94925|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3035.3	26.24468	3	1999.945271	1999.951691	K	D	86	107
PSM	QGAIVAVTGDGVNDSPALKK	2356	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3260.4	32.03755	3	2019.004871	2019.003786	R	A	708	728
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2357	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3291.5	32.8452	4	2717.308894	2717.307830	R	R	31	56
PSM	VKLESPTVSTLTPSSPGK	2358	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3359.4	34.6025	3	2066.892971	2066.897937	R	L	290	308
PSM	KDNEESEQPPVPGTPTLR	2359	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3134.6	28.76855	3	2072.942471	2072.941580	K	N	633	651
PSM	LRPEAQPHPSAGPKPAESK	2360	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2735.2	18.70448	4	2076.016094	2076.015354	R	Q	1171	1190
PSM	SPPREGSQGELTPANSQSR	2361	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2759.3	19.26625	3	2076.918971	2076.922576	K	M	468	487
PSM	SAESPTSPVTSETGSTFKK	2362	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3254.4	31.88798	3	2099.872271	2099.870128	K	F	280	299
PSM	AEPQPLSPASSSYSVSSPR	2363	sp|P18850|ATF6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3359.5	34.60583	3	2105.863271	2105.870797	K	S	88	107
PSM	ESEDKPEIEDVGSDEEEEK	2364	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3039.6	26.35408	3	2191.914371	2191.912828	K	K	251	270
PSM	IHGVNSGSSEGAQPNTENGVPEITDAATDQGPAESPPTSPSSASR	2365	sp|Q8IWE2|NXP20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	38-UNIMOD:21	ms_run[1]:scan=1.1.3416.6	36.08705	4	4482.974894	4482.968483	R	G	162	207
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	2366	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	32.53277	3	2268.863771	2268.864409	R	S	326	351
PSM	DQQNLPYGVTPASPSGHSQGR	2367	sp|Q7KZI7|MARK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3198.5	30.43077	3	2275.001171	2275.001889	R	R	607	628
PSM	SISSPSVSSETMDKPVDLSTRK	2368	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3248.2	31.72713	4	2430.136894	2430.134936	K	E	2802	2824
PSM	GSLAEAVGSPPPAATPTPTPPTRK	2369	sp|Q9Y6I3|EPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3244.5	31.63288	3	2459.154971	2459.149873	R	T	446	470
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2370	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3267.6	32.22402	4	2717.308894	2717.307830	R	R	31	56
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	2371	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2822.4	20.79357	5	3024.356118	3024.356099	K	S	145	174
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	2372	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3261.6	32.06982	3	3093.278171	3093.277137	R	-	738	768
PSM	KLSFDFQ	2373	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3753.2	44.66812	2	963.411447	963.410300	R	-	465	472
PSM	EGEEAGPGDPLLEAVPKTGDEK	2374	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3540.2	39.25873	4	2317.034494	2317.036268	K	D	353	375
PSM	ESAFEFLSSA	2375	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4822.2	61.55843	2	1166.449847	1166.453287	K	-	325	335
PSM	DGFVTVDELK	2376	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3708.2	43.52603	2	1201.526247	1201.526786	K	D	85	95
PSM	QVPDSAATATAYLCGVK	2377	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3676.3	42.69553	3	1830.816671	1830.822317	R	A	107	124
PSM	TVFSPTLPAAR	2378	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3590.2	40.50775	2	1238.602647	1238.606039	K	S	375	386
PSM	LLLDPSSPPTK	2379	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3439.2	36.64198	2	1246.619447	1246.621021	K	A	21	32
PSM	LLSPRPSLLTPTGDPR	2380	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3665.2	42.40657	3	1878.896771	1878.900581	R	A	937	953
PSM	LDIDSPPITAR	2381	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3483.3	37.77687	2	1276.606847	1276.606433	R	N	33	44
PSM	DAGTIAGLNVLR	2382	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3917.5	48.82647	2	1278.629447	1278.633317	K	I	160	172
PSM	IETVNESWNALATPSDK	2383	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3691.2	43.08643	3	1953.865871	1953.872103	K	L	616	633
PSM	QVVESAYEVIK	2384	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3518.5	38.69663	2	1343.635647	1343.637399	K	L	233	244
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	2385	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,13-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3875.3	47.76217	5	3465.483118	3465.481982	K	A	399	429
PSM	DQPPFGDSDDSVEADKSSPGIHLER	2386	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3486.5	37.86295	4	2777.176494	2777.181763	K	S	488	513
PSM	DFTPVCTTELGR	2387	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3446.4	36.82928	2	1394.645047	1394.650015	R	A	42	54
PSM	ESVPEFPLSPPK	2388	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3748.5	44.55445	2	1405.650047	1405.653049	K	K	30	42
PSM	SIPLECPLSSPK	2389	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3505.5	38.35745	2	1406.650047	1406.651669	K	G	142	154
PSM	TLTIVDTGIGMTK	2390	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3646.4	41.92999	2	1428.689847	1428.693534	R	A	28	41
PSM	ATLPSPDKLPGFK	2391	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3593.2	40.58667	3	1449.725171	1449.726883	K	M	831	844
PSM	TSSLAPVVGTTTTTPSPSAIK	2392	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3588.6	40.46898	3	2175.009371	2175.011313	K	A	226	247
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	2393	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3715.2	43.70435	4	2908.397694	2908.396782	R	S	67	92
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2394	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3749.2	44.56887	4	2933.3700	2933.3724	K	V	8	36
PSM	GLNVIGASDQSPLQSPSNLR	2395	sp|Q9HAU0|PKHA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3796.3	45.7893	3	2211.984971	2211.992644	K	D	923	943
PSM	NLEQILNGGESPK	2396	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3756.5	44.75537	2	1477.675847	1477.681389	K	Q	219	232
PSM	ELSESVQQQSTPVPLISPK	2397	sp|Q9ULU4|PKCB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3602.3	40.82542	3	2226.018671	2226.022212	K	R	531	550
PSM	EGFSIPVSADGFK	2398	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4225.2	54.85337	2	1512.593047	1512.593894	K	F	1887	1900
PSM	TSESTGSLPSPFLR	2399	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3704.4	43.42885	2	1557.707047	1557.707604	K	A	177	191
PSM	IFVGGLSPDTPEEK	2400	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3581.6	40.28595	2	1567.713047	1567.717106	K	I	184	198
PSM	AAVPSGASTGIYEALELRDNDK	2401	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3864.4	47.48768	3	2356.083071	2356.094786	R	T	33	55
PSM	AIVDALPPPCESACTVPTDVDK	2402	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3647.5	41.95863	3	2434.075271	2434.079730	R	W	261	283
PSM	TDIQIALPSGCYGR	2403	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3727.5	44.02711	2	1629.719247	1629.722209	K	V	156	170
PSM	VLENAEGARTTPSVVAFTADGER	2404	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3508.4	38.43257	3	2469.150971	2469.153698	K	L	77	100
PSM	IFVGGLSPDTPEEK	2405	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3717.6	43.76908	2	1647.681047	1647.683437	K	I	184	198
PSM	NPEVGLKPVWYSPK	2406	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	40.56048	3	1692.828371	1692.827660	K	V	536	550
PSM	EDVKSCAEWVSLSK	2407	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3497.3	38.14168	3	1716.745871	1716.743004	K	A	96	110
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2408	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:35,32-UNIMOD:21	ms_run[1]:scan=1.1.3990.3	50.43952	4	3441.445694	3441.453053	K	-	610	647
PSM	SAMPFTASPASSTTAR	2409	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3478.6	37.65703	2	1741.675847	1741.678369	R	V	123	139
PSM	CVWSPLASPSTSILK	2410	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4634.2	59.75948	3	1804.782671	1804.787191	R	R	2169	2184
PSM	ENDFDRLVLQYAPSA	2411	sp|O14579|COPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4454.2	57.93345	3	1816.800971	1816.803295	K	-	294	309
PSM	AEEYEFLTPVEEAPK	2412	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3775.3	45.23505	3	1830.792971	1830.796479	R	G	153	168
PSM	NPDDITQEEYGEFYK	2413	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3584.5	40.36118	2	1846.789447	1846.789740	R	S	292	307
PSM	DMASPNWSILPEEER	2414	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4117.2	53.27932	3	1852.769171	1852.770281	R	N	327	342
PSM	DWILPSDYDHAEAEAR	2415	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3690.3	43.06038	3	1886.842871	1886.843506	K	H	256	272
PSM	GFSEGLWEIENNPTVK	2416	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4030.2	51.373	3	1898.838371	1898.845160	K	A	81	97
PSM	EGSVLDILKSPGFASPK	2417	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4296.2	55.79385	3	1903.869371	1903.873363	K	I	605	622
PSM	SRGPATVEDLPSAFEEK	2418	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3583.3	40.3287	3	1911.860771	1911.861539	R	A	247	264
PSM	LSPPYSSPQEFAQDVGR	2419	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3775.4	45.23838	3	1956.859871	1956.861873	K	M	751	768
PSM	SSTPPGESYFGVSSLQLK	2420	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4033.2	51.45097	3	1962.895571	1962.897590	K	G	1041	1059
PSM	FDRGYISPYFINTSK	2421	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3879.3	47.86573	3	1966.824971	1966.826747	K	G	219	234
PSM	SGAMSPMSWNSDASTSEAS	2422	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3782.6	45.42537	2	1981.702647	1981.707088	R	-	190	209
PSM	DQPAFTPSGILTPHALGSR	2423	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3956.4	49.70585	3	2123.938871	2123.944237	R	N	428	447
PSM	TDKSSASAPDVDDPEAFPALA	2424	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3890.3	48.1422	3	2182.924271	2182.930741	R	-	388	409
PSM	TDKSSASAPDVDDPEAFPALA	2425	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3887.5	48.07297	2	2182.923447	2182.930741	R	-	388	409
PSM	DNLTLWTSDQQDDDGGEGNN	2426	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3893.3	48.21635	3	2192.868971	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	2427	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3901.3	48.42375	3	2192.870471	2192.873028	R	-	228	248
PSM	ESMCSTPAFPVSPETPYVK	2428	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3872.3	47.69412	2	2285.897447	2285.902691	K	T	839	858
PSM	ESMCSTPAFPVSPETPYVK	2429	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3875.4	47.7655	3	2285.898371	2285.902691	K	T	839	858
PSM	VESPGTYQQDPWAMTDEEK	2430	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3706.6	43.4874	3	2289.914471	2289.913710	K	A	157	176
PSM	SATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGK	2431	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3605.6	40.91158	4	4597.078894	4597.086867	K	G	519	563
PSM	SGSSSPDSEITELKFPSINHD	2432	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3883.4	47.96822	3	2325.994271	2326.000217	R	-	571	592
PSM	HCGLGFSEVEDHDGEGDVAGDDDDDDDDSPDPESPDDSESDSESEKEESAEELQAAEHPDEVEDPK	2433	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	2-UNIMOD:4,29-UNIMOD:21	ms_run[1]:scan=1.1.3668.6	42.49835	6	7236.6822	7236.7042	R	N	99	165
PSM	ISPLSSPCSSPLQGTPASSLVSK	2434	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4,10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3809.5	46.11887	3	2459.102471	2459.105625	K	I	519	542
PSM	APVPEPGLDLSLSPRPDSPQPR	2435	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3803.3	45.97088	3	2484.140471	2484.145122	R	H	35	57
PSM	GGPGSAVSPYPTFNPSSDVAALHK	2436	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3844.4	46.96523	3	2515.073771	2515.082187	K	A	30	54
PSM	VMTIPYQPMPASSPVICAGGQDR	2437	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3665.6	42.4199	3	2570.128271	2570.136868	R	C	178	201
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	2438	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3646.5	41.93332	3	2573.996471	2573.998594	R	G	239	267
PSM	DLPTIPGVTSPSSDEPPMEASQSHLR	2439	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3886.5	48.0482	3	2827.266971	2827.273555	R	N	74	100
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2440	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3731.6	44.13435	3	2933.364371	2933.372935	K	V	8	36
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	2441	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	39.56638	5	2989.538618	2989.541321	K	G	202	228
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2442	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3860.6	47.38483	3	3013.3282	3013.3392	K	V	8	36
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2443	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3852.5	47.17707	3	3013.328171	3013.339266	K	V	8	36
PSM	IADPEHDHTGFLTEYVATRWYR	2444	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3885.3	48.01365	4	2836.201294	2836.204762	R	A	190	212
PSM	EGPYSISVLYGDEEVPRSPFK	2445	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4005.4	50.77778	3	2448.119171	2448.125024	R	V	1516	1537
PSM	MDSAGQDINLNSPNK	2446	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	30.99722	3	1740.7040	1740.7021	-	G	1	16
PSM	ATGANATPLDFPSK	2447	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3595.4	40.64537	2	1510.6662	1510.6700	M	K	2	16
PSM	ATAEVLNIGKK	2448	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3519.3	38.71662	2	1264.6385	1264.6423	M	L	2	13
PSM	NREPLMPSPQFIK	2449	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3588.3	40.45898	3	1636.788671	1635.784415	K	S	246	259
PSM	NREPLMPSPQFIK	2450	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3580.2	40.24718	3	1636.788671	1635.784415	K	S	246	259
PSM	NSLDCEIVSAK	2451	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3217.4	30.92472	2	1314.552247	1314.552684	K	S	423	434
PSM	MDEPSPLAQPLELNQHSR	2452	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3654.3	42.12557	3	2198.9614	2198.9662	-	F	1	19
PSM	MEPSSLELPADTVQR	2453	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.4109.2	53.13323	3	1793.7860	1793.7902	-	I	1	16
PSM	SETAPAAPAAPAPAEKTPVK	2454	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.3045.5	26.50545	3	2024.9807	2024.9815	M	K	2	22
PSM	SDAAVDTSSEITTK	2455	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3169.6	29.67753	2	1545.6417	1545.6442	M	D	2	16
PSM	AENVVEPGPPSAK	2456	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3250.5	31.78925	2	1415.6332	1415.6329	M	R	2	15
PSM	MDVLVSECSAR	2457	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4039.2	51.60438	2	1387.5581	1387.5508	-	L	1	12
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	2458	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3188.5	30.1697	4	3147.2476	3147.2495	-	T	1	27
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	2459	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3363.5	34.70953	4	3131.2515	3131.2545	-	T	1	27
PSM	SDEFSLADALPEHSPAK	2460	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3990.2	50.43285	3	1934.8307	1934.8294	M	T	2	19
PSM	GMGPGTPAGYGR	2461	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3000.3	25.34858	2	1199.480647	1199.479459	R	G	682	694
PSM	CESAFLSK	2462	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3124.2	28.50073	2	1020.398047	1020.398749	K	R	36	44
PSM	CESAFLSK	2463	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3962.2	49.81765	2	1003.3717	1003.3717	K	R	36	44
PSM	QMNMSPPPGNAGPVIMSIEEK	2464	sp|Q86U42|PABP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3961.3	49.79835	3	2306.0292	2306.0142	K	M	146	167
PSM	LITPAVVSER	2465	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3373.3	34.96015	2	1163.592647	1163.595140	K	L	67	77
PSM	WADPQISESNFSPK	2466	sp|Q9BW91|NUDT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3616.3	41.18207	2	1684.707647	1684.713418	R	F	110	124
PSM	LYGPSSVSFADDFVRSSK	2467	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3967.2	49.94683	3	2120.883371	2120.885719	R	Q	134	152
PSM	NGVIQHTGAAAEEFNDDTD	2468	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3264.4	32.14003	3	2082.817871	2082.816773	R	-	646	665
PSM	AAGGDHGSPDSYRSPLASR	2469	sp|P30566|PUR8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3123.6	28.4883	3	2101.8290	2101.8251	M	Y	2	21
PSM	WNSVSPASAGK	2470	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3035.2	26.24135	2	1262.473847	1262.473385	K	R	304	315
PSM	LGAPALTSR	2471	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3074.2	27.20763	2	964.474447	964.474297	R	Q	426	435
PSM	HYGGLTGLNKAETAAK	2472	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3156.2	29.32717	3	1789.782371	1789.780132	R	H	91	107
PSM	TWTTPEVTSPPPSPR	2473	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3476.4	37.59805	3	1812.756071	1811.753248	R	T	125	140
PSM	LDIDSPPITAR	2474	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3526.4	38.90215	2	1356.568447	1356.572764	R	N	33	44
PSM	LRLSPSPTSQR	2475	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3013.2	25.68375	3	1400.624471	1400.621446	R	S	387	398
PSM	LQAANAEDIKSGK	2476	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2836.2	21.13407	3	1423.668671	1423.670825	K	L	72	85
PSM	SAITPGGLR	2477	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3093.2	27.69448	2	950.458447	950.458647	R	L	417	426
PSM	DCLNVLNK	2478	sp|Q99471|PFD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3161.2	29.4563	2	974.486447	974.485516	K	S	48	56
PSM	APLKPYPVSPSDK	2479	sp|P41252|SYIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3049.3	26.6008	3	1477.723871	1477.721798	K	V	1039	1052
PSM	FANLTPSR	2480	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3111.2	28.16398	2	984.443447	984.442997	K	T	2050	2058
PSM	SCNCLLLK	2481	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3143.2	28.99037	2	1006.493847	1006.493973	K	V	336	344
PSM	AQGEPVAGHESPKIPYEK	2482	sp|O94979|SC31A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3050.3	26.62683	4	2015.938494	2015.935372	R	Q	789	807
PSM	TPESSHEGLITDPHSPSR	2483	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2940.3	23.79285	4	2025.884094	2025.879314	R	F	719	737
PSM	DWDDDQND	2484	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2968.2	24.5164	2	1021.324047	1021.326098	K	-	541	549
PSM	NGRVEIIANDQGNR	2485	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2899.3	22.7379	3	1554.784871	1554.786266	K	I	47	61
PSM	GPPASSPAPAPKFSPVTPK	2486	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3354.2	34.465	4	2071.878494	2071.882228	R	F	254	273
PSM	DGGFCEVCK	2487	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2960.3	24.3117	2	1070.413647	1070.416116	K	K	405	414
PSM	ALENVLSGKA	2488	sp|O43678|NDUA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3378.2	35.08395	2	1080.521647	1080.521641	R	-	90	100
PSM	DYDDMSPR	2489	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2636.3	17.58492	2	1093.341447	1093.342356	R	R	279	287
PSM	ASAVSELSPR	2490	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2990.2	25.08673	2	1095.496847	1095.496155	R	E	236	246
PSM	MSGFIYQGK	2491	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3417.2	36.098	2	1109.462047	1109.461683	R	I	487	496
PSM	DNVVCLSPK	2492	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3165.4	29.56653	2	1110.476447	1110.478062	K	L	252	261
PSM	YLRYTPQP	2493	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3200.4	30.47973	2	1116.502447	1116.500512	K	-	217	225
PSM	VGSLTPPSSPK	2494	sp|Q2M2I8|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2960.4	24.31503	2	1148.544047	1148.547856	K	T	616	627
PSM	HSDSGTSEASLSPPSSPPSRPR	2495	sp|Q7Z4S6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2974.4	24.67837	4	2315.018894	2315.017933	K	N	1260	1282
PSM	DNLTSATLPR	2496	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3314.3	33.4364	2	1166.530447	1166.533268	K	N	302	312
PSM	DNLTSATLPR	2497	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3330.4	33.85615	2	1166.530447	1166.533268	K	N	302	312
PSM	AAISQLRSPR	2498	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2885.2	22.38287	2	1177.596247	1177.596872	K	V	352	362
PSM	NDSVIVADQTPTPTR	2499	sp|P15336|ATF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3133.3	28.7328	3	1772.747171	1772.738326	R	F	60	75
PSM	LPDLSPVENK	2500	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3382.4	35.19415	2	1190.554247	1190.558421	K	E	2101	2111
PSM	LQKLESPVAH	2501	sp|Q86TM6|SYVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2891.2	22.52913	3	1200.591671	1200.590389	R	-	608	618
PSM	GGSGSGPTIEEVD	2502	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3116.2	28.29382	2	1203.524847	1203.525526	K	-	629	642
PSM	DITSDTSGDFR	2503	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3153.3	29.25272	2	1212.526847	1212.525861	K	N	167	178
PSM	VTLTSEEEAR	2504	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3050.4	26.63017	2	1213.519247	1213.522763	K	L	306	316
PSM	GKYSDDTPLPTPSYK	2505	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3158.3	29.38202	3	1827.735071	1827.736929	R	Y	259	274
PSM	VKAQTPPGPSLSGSKSPCPQEK	2506	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.2918.5	23.23657	4	2439.088894	2439.090643	K	S	999	1021
PSM	SISSPSVSSETMDKPVDLSTRK	2507	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3108.3	28.08863	4	2446.130894	2446.129851	K	E	2802	2824
PSM	GVLLYGPPGTGK	2508	sp|Q8NB90|AFG2H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3390.2	35.39653	2	1237.605847	1237.610790	R	T	389	401
PSM	EITALAPSTMK	2509	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3362.3	34.67688	2	1240.574247	1240.577441	K	I	318	329
PSM	EVLDEDTDEEKETLK	2510	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3134.3	28.75855	3	1871.794271	1871.792516	K	N	990	1005
PSM	TSSGDPPSPLVK	2511	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2990.4	25.0934	2	1263.575047	1263.574799	K	Q	80	92
PSM	DCAVKPCQSDEVPDGIKSASYK	2512	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3173.4	29.77498	4	2533.087694	2533.086607	R	Y	98	120
PSM	TSVQTEDDQLIAGQSAR	2513	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3216.4	30.89855	3	1897.843271	1897.841866	R	A	654	671
PSM	LSASTASELSPK	2514	sp|Q3KQU3|MA7D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3018.5	25.82407	2	1269.583447	1269.585364	R	S	451	463
PSM	LSLEGDHSTPPSAYGSVK	2515	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3279.3	32.5261	3	1923.860171	1923.861539	K	A	11	29
PSM	GGSGSGPTIEEVD	2516	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3240.3	31.5218	2	1283.492847	1283.491857	K	-	629	642
PSM	WPTETDVSSAK	2517	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3194.6	30.33043	2	1299.540047	1299.538413	R	N	322	333
PSM	NCNDFQYESK	2518	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4	ms_run[1]:scan=1.1.2930.3	23.53985	2	1303.506847	1303.513916	K	V	111	121
PSM	VNTPTTTVYR	2519	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2987.5	25.01882	2	1310.530447	1310.530900	K	C	244	254
PSM	NSNPALNDNLEK	2520	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2955.5	24.18898	2	1327.635647	1327.636808	K	G	120	132
PSM	GPPASSPAPAPKFSPVTPK	2521	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3281.6	32.58738	3	1991.918471	1991.915897	R	F	254	273
PSM	QRTNPSPTNPFSSDLQK	2522	sp|P49757|NUMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3308.4	33.28235	3	1995.905471	1995.905135	K	T	629	646
PSM	YALYDATYETK	2523	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3331.2	33.87598	2	1336.618047	1336.618698	R	E	82	93
PSM	NGEVVHTPETSV	2524	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3018.6	25.8274	2	1347.571647	1347.570776	K	-	454	466
PSM	NLYPSSSPYTR	2525	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3252.3	31.83445	2	1363.583447	1363.580947	K	N	275	286
PSM	NGTSGSDSPGQAVEAEEIVK	2526	sp|Q05D32|CTSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3407.3	35.84442	3	2053.890071	2053.884125	K	Q	158	178
PSM	DLLHPSPEEEK	2527	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3177.4	29.87983	2	1372.588647	1372.591177	K	R	6	17
PSM	IACKSPPPESVDTPTSTK	2528	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2840.3	21.2354	3	2073.871571	2073.873106	K	Q	1127	1145
PSM	SGGLQTPECLSR	2529	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3122.4	28.45495	2	1383.588447	1383.585381	R	E	431	443
PSM	SSDASTAQPPESQPLPASQTPASNQPK	2530	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3027.3	26.04725	4	2800.255294	2800.255263	K	R	97	124
PSM	IIYGGSVTGATCK	2531	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3149.5	29.15668	2	1405.631047	1405.631268	R	E	244	257
PSM	RYPSSISSSPQK	2532	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2813.3	20.56073	3	1415.644871	1415.644610	R	D	601	613
PSM	NTGIICTIGPASR	2533	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3391.5	35.43232	2	1438.670647	1438.663965	R	S	44	57
PSM	SGPKPFSAPKPQTSPSPK	2534	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2902.4	22.81882	4	1916.940494	1916.939729	R	R	295	313
PSM	GGDSIGETPTPGASK	2535	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2864.4	21.84985	2	1452.614047	1452.613369	R	R	319	334
PSM	ATESGAQSAPLPMEGVDISPK	2536	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3376.5	35.04298	3	2179.956971	2179.970832	K	Q	8	29
PSM	AQTPPGPSLSGSKSPCPQEK	2537	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2968.5	24.5264	3	2211.923771	2211.927266	K	S	1001	1021
PSM	HEQNIDCGGGYVK	2538	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2845.3	21.36052	3	1475.646371	1475.646327	K	L	99	112
PSM	SPPKSPEEEGAVSS	2539	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2749.3	19.04557	2	1479.610047	1479.613035	K	-	208	222
PSM	NDSLVTPSPQQAR	2540	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2983.6	24.91743	2	1491.668847	1491.671887	R	V	144	157
PSM	DVSGPMPDSYSPR	2541	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2993.4	25.17097	2	1502.573647	1502.574876	K	Y	291	304
PSM	AGDLLEDSPKRPK	2542	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2893.4	22.58742	3	1504.728071	1504.728674	R	E	158	171
PSM	SLYASSPGGVYATR	2543	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3325.4	33.7259	2	1507.669847	1507.670825	R	S	51	65
PSM	EFGSLPTTPSEQR	2544	sp|O15400|STX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3328.5	33.80768	2	1527.661647	1527.660654	K	Q	72	85
PSM	GDATVSYEDPPTAK	2545	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3013.6	25.69708	2	1529.627847	1529.628685	K	A	411	425
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	2546	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3189.2	30.18595	5	2692.296118	2692.288766	R	Q	24	52
PSM	ELQAAGKSPEDLER	2547	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2995.2	25.21612	3	1621.731671	1621.734881	K	L	448	462
PSM	EVVKPVPITSPAVSK	2548	sp|Q96HC4|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3146.2	29.06863	3	1629.875471	1629.874276	K	V	102	117
PSM	VIGSGCNLDSARFR	2549	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3233.2	31.33602	3	1630.731071	1630.728691	R	Y	158	172
PSM	SSGGREDLESSGLQR	2550	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2913.4	23.10325	3	1656.711071	1656.710458	K	R	70	85
PSM	SAPASPTHPGLMSPR	2551	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3142.2	28.96372	3	1664.680271	1664.678309	R	S	416	431
PSM	RITSPLMEPSSIEK	2552	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3355.3	34.49477	3	1666.797671	1666.800124	K	I	53	67
PSM	ENVNATENCISAVGK	2553	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3149.2	29.14668	3	1684.713971	1684.712766	K	I	964	979
PSM	TLNAETPKSSPLPAK	2554	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2954.3	24.15632	3	1712.779571	1712.778735	R	G	208	223
PSM	EQGPYETYEGSPVSK	2555	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3127.6	28.59083	2	1749.712047	1749.713477	K	G	549	564
PSM	DKPHVNVGTIGHVDHGK	2556	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2862.2	21.7915	4	1808.927694	1808.928179	R	T	54	71
PSM	TSSVSNPQDSVGSPCSR	2557	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2876.4	22.15977	3	1843.739471	1843.740772	K	V	94	111
PSM	TPEPSSPVKEPPPVLAK	2558	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3135.3	28.78422	3	1851.930971	1851.938332	K	P	639	656
PSM	EVNVSPCPTQPCQLSK	2559	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3140.4	28.9175	3	1922.829371	1922.826750	K	G	36	52
PSM	KPVTVSPTTPTSPTEGEAS	2560	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3004.6	25.46248	3	1964.896871	1964.897984	R	-	505	524
PSM	SVSTPSEAGSQDSGDGAVGSR	2561	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2829.2	20.95935	3	2029.820171	2029.822587	K	T	92	113
PSM	TVEVAEGEAVRTPQSVTAK	2562	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3096.5	27.78235	3	2050.992371	2050.993616	R	Q	132	151
PSM	DKSPVREPIDNLTPEER	2563	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3218.6	30.95793	3	2073.970271	2073.973214	K	D	134	151
PSM	SAESPTSPVTSETGSTFKK	2564	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3262.5	32.09485	2	2099.875447	2099.870128	K	F	280	299
PSM	EYIPGQPPLSQSSDSSPTR	2565	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3377.5	35.0687	3	2124.936071	2124.936495	K	N	871	890
PSM	EKTPSPKEEDEEPESPPEK	2566	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2769.3	19.5163	4	2260.961694	2260.962435	K	K	200	219
PSM	TEAQDLCRASPEPPGPESSSR	2567	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3005.6	25.48843	3	2349.989171	2349.989669	R	W	663	684
PSM	SISSPSVSSETMDKPVDLSTRK	2568	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3256.2	31.93098	4	2430.136894	2430.134936	K	E	2802	2824
PSM	SWDSSSPVDRPEPEAASPTTR	2569	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3232.4	31.31543	3	2430.976271	2430.973030	R	T	354	375
PSM	GISCMNTTLSESPFKCDPDAAR	2570	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3386.4	35.29888	3	2552.035271	2552.038277	K	A	239	261
PSM	DSLIDSLT	2571	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3925.2	49.0179	2	862.427447	862.428378	R	-	238	246
PSM	DLTDYLMK	2572	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3830.2	46.60182	2	997.475247	997.479034	R	I	186	194
PSM	MLTFNPNK	2573	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3448.2	36.8742	2	1043.450847	1043.451119	R	R	310	318
PSM	QMPSESLDPAFSPR	2574	sp|Q15018|ABRX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3599.2	40.74325	3	1640.690471	1640.690574	R	M	269	283
PSM	ALLLLCGEDD	2575	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3956.3	49.70252	2	1117.530447	1117.532526	K	-	311	321
PSM	GTPLISPLIK	2576	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3824.2	46.45635	2	1117.614447	1117.614813	R	W	826	836
PSM	DQLIYNLLK	2577	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3987.2	50.376	2	1118.632047	1118.633560	K	E	6	15
PSM	SPWSNKYDPPLEDGAMPSAR	2578	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3586.2	40.40345	4	2296.981694	2296.982399	R	L	73	93
PSM	ESAFEFLSSA	2579	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4868.2	61.95383	2	1166.449847	1166.453287	K	-	325	335
PSM	ENSREALAEAALESPRPALVR	2580	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3478.3	37.64703	4	2358.169694	2358.169288	K	S	267	288
PSM	DLLTPCYSR	2581	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3444.3	36.77435	2	1203.499647	1203.499526	K	Q	304	313
PSM	GVLLFGPPGTGK	2582	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3889.2	48.10977	2	1221.610647	1221.615876	K	T	211	223
PSM	KLSSWDQAETPGHTPSLRWDETPGR	2583	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3671.2	42.56263	5	3090.268618	3090.267512	K	A	214	239
PSM	NTLNGDLASATIPEESR	2584	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3532.4	39.05813	3	1866.831371	1866.836052	K	L	266	283
PSM	GRPSSPRTPLYLQPDAYGSLDR	2585	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3659.3	42.2543	4	2605.167694	2605.172733	K	A	116	138
PSM	GISCMNTTLSESPFKCDPDAAR	2586	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:4,7-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3670.6	42.55015	4	2616.012494	2616.009693	K	A	239	261
PSM	DVLSVAFSSDNR	2587	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3693.3	43.13862	2	1308.628447	1308.630994	K	Q	107	119
PSM	ADLINNLGTIAK	2588	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3659.4	42.25763	2	1321.658847	1321.664283	K	F	96	108
PSM	SGFGEISSPVIR	2589	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3622.3	41.31925	2	1327.615247	1327.617332	R	E	4	16
PSM	EDFDSLLQSAK	2590	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3783.3	45.44108	2	1331.564047	1331.564628	K	K	288	299
PSM	NDPFTSDPFTK	2591	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3859.3	47.34867	2	1347.532447	1347.538413	K	N	684	695
PSM	RYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQR	2592	sp|Q4V326|GAG2E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3728.3	44.04652	6	4076.8202	4076.8280	R	Q	16	51
PSM	DINTFLGTPVQK	2593	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3702.3	43.37333	2	1411.671647	1411.674847	K	L	1794	1806
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	2594	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3551.5	39.54675	4	2833.347294	2833.352672	K	S	362	389
PSM	WPDPEDLLTPR	2595	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4128.3	53.427	2	1417.626047	1417.627897	R	W	39	50
PSM	GFPTIYFSPANK	2596	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3928.2	49.08216	2	1420.639647	1420.642819	R	K	449	461
PSM	GFPTIYFSPANK	2597	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3919.2	48.87117	2	1420.640047	1420.642819	R	K	449	461
PSM	QREEYQPATPGLGMFVEVKDPEDK	2598	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3755.5	44.72963	4	2842.286894	2842.288477	K	V	72	96
PSM	QREEYQPATPGLGMFVEVKDPEDK	2599	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3600.5	40.77983	4	2858.279294	2858.283392	K	V	72	96
PSM	LDYDEDASAMLK	2600	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3645.5	41.90757	2	1449.571047	1449.573478	K	E	211	223
PSM	SLVSVTKEGLELPEDEEEK	2601	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3869.4	47.61018	3	2210.018771	2210.024307	K	K	405	424
PSM	GNPTVEVDLFTSK	2602	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3776.6	45.27068	2	1485.668447	1485.675241	R	G	16	29
PSM	GALQNIIPASTGAAK	2603	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3512.5	38.53992	2	1490.744847	1490.749409	R	A	201	216
PSM	QASPNIVIALSGNK	2604	sp|P20339|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3713.4	43.66027	2	1490.743447	1490.749409	R	A	121	135
PSM	DFTVASPAEFVTR	2605	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3961.2	49.79168	2	1518.672647	1518.675576	R	F	99	112
PSM	DNALLSAIEESRK	2606	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3891.2	48.16148	3	1524.720371	1524.718503	K	R	107	120
PSM	DTPENNPDTPFDFTPENYK	2607	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3873.4	47.71368	3	2319.914471	2319.920904	R	R	43	62
PSM	EAAFGGGLLSPGPEAT	2608	sp|Q01201|RELB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4057.2	51.99267	2	1552.679247	1552.681055	R	-	564	580
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	2609	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3475.5	37.57558	4	3114.464894	3114.465924	K	R	65	93
PSM	QDLESSVQSSPHDSIAIIPPPQSTKPGR	2610	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3538.4	39.21415	4	3130.428494	3130.437341	K	G	414	442
PSM	GALQNIIPASTGAAK	2611	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3677.4	42.72505	2	1570.709647	1570.715740	R	A	201	216
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	2612	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3569.4	39.9728	4	3194.430494	3194.432255	K	R	65	93
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	2613	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3589.4	40.4888	4	3199.392094	3199.394275	K	N	213	241
PSM	QAGGFLGPPPPSGKFS	2614	sp|Q9UM00|TMCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3602.4	40.82875	2	1622.744047	1622.749409	K	-	224	240
PSM	SASSYSDIEEIATPDSSAPSSPK	2615	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3547.6	39.44795	3	2484.975371	2484.982258	K	L	1233	1256
PSM	GVLFGVPGAFTPGCSK	2616	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4136.4	53.57644	2	1672.762047	1672.768430	K	T	87	103
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	2617	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3716.4	43.73675	4	3393.343294	3393.345713	K	F	86	114
PSM	VTNGAFTGEISPGMIK	2618	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3534.2	39.10349	3	1716.774971	1716.779389	K	D	107	123
PSM	VTNGAFTGEISPGMIK	2619	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3543.2	39.33433	3	1716.775871	1716.779389	K	D	107	123
PSM	NWTEDMEGGISSPVK	2620	sp|P08651|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3646.3	41.92665	3	1728.705671	1728.706618	R	K	312	327
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRKAER	2621	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3920.3	48.9071	4	3465.543694	3465.549076	R	T	139	169
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	2622	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3594.5	40.6227	4	3464.568894	3464.574823	K	E	218	249
PSM	NQVALNPQNTVFDAK	2623	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3436.4	36.57138	2	1737.804447	1737.808715	K	R	57	72
PSM	MESLSSHRIDEDGENTQIEDTEPMSPVLNSK	2624	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3533.6	39.0911	4	3567.527294	3567.538239	K	F	528	559
PSM	EALAEAALESPRPALVR	2625	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3537.2	39.18158	3	1871.945471	1871.950628	R	S	271	288
PSM	DLDLLASVPSPSSSGSRK	2626	sp|Q8WU79|SMAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3727.2	44.01712	3	1894.902371	1894.903738	K	V	210	228
PSM	SATSSSPGSPLHSLETSL	2627	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4112.2	53.22023	3	1916.775071	1916.780585	K	-	1203	1221
PSM	SVPTSTVFYPSDGVATEK	2628	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3621.3	41.2945	3	1963.875971	1963.881605	R	A	439	457
PSM	GPSLDIDTPDVNIEGPEGK	2629	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3751.6	44.6315	2	2031.895447	2031.903797	K	L	4423	4442
PSM	SIYDDISSPGLGSTPLTSR	2630	sp|Q8NFH5|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3910.3	48.66003	3	2044.931771	2044.935432	R	R	93	112
PSM	QITVNDLPVGRSVDETLR	2631	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3686.2	42.95273	3	2091.033371	2091.036149	R	L	141	159
PSM	DNLTLWTSDQQDEEAGEGN	2632	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3838.2	46.8036	3	2120.870171	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDEEAGEGN	2633	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3854.4	47.22205	3	2120.870171	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	2634	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3909.2	48.62732	3	2192.870471	2192.873028	R	-	228	248
PSM	IADPEHDHTGFLTEYVATR	2635	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3445.3	36.79977	4	2250.997694	2250.994678	R	W	190	209
PSM	AAVPSGASTGIYEALELRDNDK	2636	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3702.5	43.38	3	2276.126771	2276.128455	R	T	33	55
PSM	SIQTPQSHGTLTAELWDNK	2637	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3841.5	46.89098	3	2284.971371	2284.976659	K	V	1977	1996
PSM	IADYEAASAVPGVAAEQPGVSPSGS	2638	sp|Q9Y5J6|T10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3716.2	43.73008	3	2409.069371	2409.073716	R	-	79	104
PSM	TEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQR	2639	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:4,36-UNIMOD:21	ms_run[1]:scan=1.1.3633.6	41.60023	4	4845.134894	4845.146130	K	E	1088	1139
PSM	ELGGLEGDPSPEEDEGIQKASPLTHSPPDEL	2640	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3790.4	45.62687	4	3322.471294	3322.476608	K	-	248	279
PSM	GISCMNTTLSESPFKCDPDAAR	2641	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:4,7-UNIMOD:21,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3667.5	42.46912	3	2616.002471	2616.009693	K	A	239	261
PSM	ETYTDDLPPPPVPPPAIKSPTAQSK	2642	sp|Q9Y6N7|ROBO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3604.5	40.884	4	2725.318094	2725.325180	R	T	1474	1499
PSM	MESHSEDEDLAGAVGGLGWNSRSPR	2643	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3644.3	41.87502	4	2736.160494	2736.159922	R	T	49	74
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	2644	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3479.6	37.68313	3	2845.275971	2845.280749	R	R	67	93
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2645	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3604.6	40.88733	3	2897.083271	2897.089897	K	T	701	725
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	2646	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3801.6	45.91933	3	2963.264171	2963.274343	R	T	88	114
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	2647	sp|Q12906-7|ILF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3749.4	44.57553	5	4535.1141	4535.1111	R	Q	475	520
PSM	IADPEHDHTGFLTEYVATRWYR	2648	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4010.3	50.90118	4	2916.171694	2916.171093	R	A	190	212
PSM	TSPSSPAPLPHQEATPR	2649	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2981.5	24.86267	3	1931.820671	1931.817974	R	A	169	186
PSM	TMIISPERLDPFADGGKTPDPK	2650	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4098.2	52.90518	4	2544.127294	2544.137259	R	M	125	147
PSM	AESSESFTMASSPAQRR	2651	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3287.3	32.73372	3	1962.8155	1962.8137	M	R	2	19
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTK	2652	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,29-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=1.1.3594.6	40.62603	4	3691.6059	3691.6092	M	S	2	41
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTK	2653	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,16-UNIMOD:21,29-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=1.1.3718.6	43.79545	4	3771.5760	3771.5756	M	S	2	41
PSM	SMGTGDTPGLEVPSSPLRK	2654	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,4-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	35.3773	3	2103.894371	2103.894904	R	A	381	400
PSM	ATNFLAHEK	2655	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3476.3	37.59472	2	1151.4999	1151.5007	M	I	2	11
PSM	QLSSGVSEIR	2656	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3546.2	39.4092	2	1137.5019	1137.5062	R	H	80	90
PSM	YQLDPTASISAK	2657	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3382.5	35.19748	2	1372.625447	1372.627563	K	V	236	248
PSM	ASGVAVSDGVIK	2658	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3674.4	42.64667	2	1303.5423	1303.5457	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2659	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3999.5	50.67582	3	2829.1942	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2660	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3655.5	42.15714	3	2765.2213	2765.2250	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2661	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3740.6	44.36092	3	2845.1884	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2662	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3905.2	48.52365	4	2749.2252	2749.2301	-	Y	1	25
PSM	DCDRAIEINPDSAQPYK	2663	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3323.5	33.67677	3	2070.870671	2070.871786	R	W	170	187
PSM	MTEWETAAPAVAETPDIK	2664	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3900.3	48.39772	3	2096.8960	2096.9008	-	L	1	19
PSM	FCFTPHTEEGCLSER	2665	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3488.4	37.9121	3	1948.746071	1948.748500	K	A	1117	1132
PSM	AQETNQTPGPMLCSTGCGFYGNPR	2666	sp|O76080|ZFAN5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3884.5	47.99592	3	2764.1006	2764.1076	M	T	2	26
PSM	AENVVEPGPPSAKRPK	2667	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3010.4	25.61227	3	1796.8829	1796.8817	M	L	2	18
PSM	AAASPLRDCQAWK	2668	sp|Q5R3I4|TTC38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3472.4	37.49577	2	1594.6923	1594.6958	M	D	2	15
PSM	AAAMDVDTPSGTNSGAGKK	2669	sp|P62877|RBX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3060.2	26.88453	3	1898.8090	1898.8076	M	R	2	21
PSM	QLLKSPELPSPQAEK	2670	sp|Q9H078|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3403.2	35.7361	3	1823.844071	1823.847148	K	R	659	674
PSM	SSDASQGVITTPPPPSMPHK	2671	sp|Q9UEY8|ADDG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3304.5	33.1812	3	2154.9650	2154.9652	M	E	2	22
PSM	SRKESYSVYVYK	2672	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3186.5	30.1182	3	1667.703071	1667.699756	R	V	33	45
PSM	SAHVTVSGGTPKGEAVLGTHK	2673	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3004.2	25.44915	4	2192.000894	2192.002814	K	L	305	326
PSM	LQPQEISPPPTANLDR	2674	sp|Q05397|FAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3431.4	36.44203	3	1934.854571	1934.854025	K	S	904	920
PSM	KGQDSEPSLNLLSPHSKGSTDSGYFSR	2675	sp|P31629|ZEP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	5-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.2824.2	20.85128	4	3055.3302	3053.3162	K	S	377	404
PSM	SDQQAQVHQLLTPASAISNK	2676	sp|Q8NDV7|TNR6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3450.3	36.93002	3	2295.028871	2295.029757	R	E	1033	1053
PSM	RTGMESQPFLNMKFETDYFVK	2677	sp|Q8NFM7|I17RD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:35,12-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=1.1.2638.2	17.63433	5	2680.176118	2679.175028	K	V	142	163
PSM	WNSVSPASAGK	2678	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3043.3	26.44722	2	1262.473847	1262.473385	K	R	304	315
PSM	VDLEPVSPR	2679	sp|Q9HCH0|NCK5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3170.2	29.69002	2	1091.500047	1090.505991	R	S	757	766
PSM	LSLEGDHSTPPSAYGSVK	2680	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3271.4	32.32027	3	1923.860171	1923.861539	K	A	11	29
PSM	YQNHSSKSSGRSGR	2681	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3466.5	37.34908	2	1632.698247	1629.700896	R	S	97	111
PSM	RKEDEVEEWQHR	2682	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2870.2	21.99847	4	1639.774094	1639.770282	R	A	437	449
PSM	FSPVTPK	2683	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2974.2	24.6717	2	854.395047	854.393921	K	F	266	273
PSM	NIILEEGK	2684	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3083.2	27.43618	2	914.508247	914.507297	K	E	46	54
PSM	DISLSDYK	2685	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3271.2	32.3136	2	939.453847	939.454927	K	G	28	36
PSM	DVNVNFEK	2686	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3101.2	27.90327	2	963.464047	963.466161	K	S	26	34
PSM	AGFAGDDAPR	2687	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2857.2	21.6627	2	975.441447	975.441009	K	A	21	31
PSM	GNLTPLTGR	2688	sp|O75683|SURF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3102.2	27.92883	2	1007.481047	1007.480111	K	N	226	235
PSM	AMAPTSPQI	2689	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3095.2	27.7468	2	1010.415647	1010.414399	K	-	259	268
PSM	DWDDDQND	2690	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2976.2	24.72305	2	1021.324047	1021.326098	K	-	541	549
PSM	CMMAQYNRHDSPEDVK	2691	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2970.2	24.56822	4	2059.796494	2059.795132	R	R	471	487
PSM	GLTSVINQK	2692	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3391.2	35.42232	2	1038.510047	1038.511076	R	L	300	309
PSM	IESPKLER	2693	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2854.2	21.58588	3	1050.514571	1050.511076	K	T	807	815
PSM	ENLSAAFSR	2694	sp|P15170-2|ERF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3382.3	35.19081	2	1073.454647	1073.454290	R	Q	59	68
PSM	DVNAAIATIK	2695	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3208.2	30.68283	2	1094.539047	1094.537291	K	T	327	337
PSM	GFVEIQTPK	2696	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3366.4	34.78358	2	1097.512047	1097.515827	K	I	214	223
PSM	HFKDEDEDEDVASPDGLGR	2697	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3097.5	27.80902	4	2209.881694	2209.880102	K	L	537	556
PSM	LVEPGSPAEK	2698	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2817.3	20.66545	2	1105.504047	1105.505657	R	A	41	51
PSM	SPGAPGPLTLK	2699	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3328.3	33.80102	2	1116.556047	1116.558027	R	E	344	355
PSM	RGGSGSHNWGTVKDELTESPK	2700	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3141.2	28.93787	4	2321.048094	2321.043754	K	Y	216	237
PSM	GNDPLTSSPGR	2701	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2909.4	22.99935	2	1179.491447	1179.492132	R	S	20	31
PSM	YLSEVASGDNK	2702	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2876.3	22.15643	2	1181.551047	1181.556432	R	Q	130	141
PSM	TPEGRASPAPGSGHPEGPGAHLDMNSLDR	2703	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3185.3	30.08442	5	2989.3191	2989.3133	K	A	85	114
PSM	EAALPPVSPLK	2704	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3391.3	35.42565	2	1200.614247	1200.615542	R	A	1224	1235
PSM	EAALPPVSPLK	2705	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3424.4	36.27255	2	1200.616847	1200.615542	R	A	1224	1235
PSM	SNSPLPVPPSK	2706	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3013.3	25.68708	2	1201.573047	1201.574405	R	A	301	312
PSM	LEGQGDVPTPK	2707	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2937.3	23.71545	2	1219.547247	1219.548584	K	Q	257	268
PSM	EGTCQRGDQCCYSHSPPTPR	2708	sp|Q9NXH9|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.2775.4	19.67033	4	2471.938894	2471.940628	K	V	611	631
PSM	ERDHSPTPSVFNSDEERYR	2709	sp|Q6UN15|FIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3169.4	29.67087	4	2479.981294	2479.979513	R	Y	488	507
PSM	GEAAAERPGEAAVASSPSK	2710	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2769.4	19.51963	3	1863.838271	1863.836387	K	A	12	31
PSM	TSSGDPPSPLVK	2711	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2999.4	25.32628	2	1263.575047	1263.574799	K	Q	80	92
PSM	LSASTASELSPK	2712	sp|Q3KQU3|MA7D1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3026.5	26.029	2	1269.583447	1269.585364	R	S	451	463
PSM	KINEELESQYQQSMDSKLSGR	2713	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3362.4	34.68022	4	2549.1302	2549.1462	K	Y	75	96
PSM	LMIEMDGTENK	2714	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3305.3	33.20016	2	1279.577647	1279.578824	K	S	93	104
PSM	YCRPESQEHPEADPGSAAPYLK	2715	sp|P40763|STAT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3144.4	29.02307	4	2581.098894	2581.094469	K	T	686	708
PSM	CSGPGLSPGMVR	2716	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3283.2	32.62695	2	1296.535647	1296.535594	K	A	1453	1465
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	2717	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2840.2	21.23207	4	2611.084494	2611.085754	K	L	460	485
PSM	APASVLPAATPR	2718	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3190.5	30.2219	2	1309.581647	1309.583269	R	Q	45	57
PSM	SLVESVSSSPNK	2719	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3008.5	25.56355	2	1312.589047	1312.591177	R	E	309	321
PSM	ADSGPTQPPLSLSPAPETK	2720	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3411.3	35.94883	3	1971.922571	1971.919054	R	R	2071	2090
PSM	GVNTVFHCASPPPSSNNK	2721	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3089.6	27.6051	3	1991.853671	1991.856076	K	E	97	115
PSM	EQISDIDDAVR	2722	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3408.4	35.87358	2	1339.567447	1339.565691	K	K	115	126
PSM	AEPAAPPAAPSTPAPPPAVPK	2723	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3204.5	30.5877	3	2013.000971	2012.997244	K	E	506	527
PSM	SMGTGDTPGLEVPSSPLRK	2724	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3307.3	33.25373	3	2023.927271	2023.928573	R	A	381	400
PSM	DGFPSGTPALNAK	2725	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3320.5	33.59915	2	1353.594047	1353.596597	K	G	148	161
PSM	GEPNVSYICSR	2726	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3170.4	29.69668	2	1360.549247	1360.548267	R	Y	273	284
PSM	GEPNVSYICSR	2727	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3143.5	29.00037	2	1360.550847	1360.548267	R	Y	273	284
PSM	SSPSARPPDVPGQQPQAAKSPSPVQGK	2728	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2942.6	23.85497	4	2777.348894	2777.349772	R	K	82	109
PSM	ICEPGYSPTYK	2729	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3140.5	28.92083	2	1393.562847	1393.562520	K	Q	210	221
PSM	ASPGTPLSPGSLR	2730	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3398.5	35.61578	2	1398.592447	1398.594562	R	S	33	46
PSM	ASPGTPLSPGSLR	2731	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3390.5	35.40653	2	1398.592447	1398.594562	R	S	33	46
PSM	IIYGGSVTGATCK	2732	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3141.5	28.94787	2	1405.631047	1405.631268	R	E	244	257
PSM	KLECLPPEPSPDDPESVK	2733	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3287.6	32.74372	3	2115.944471	2115.943554	R	I	346	364
PSM	KLECLPPEPSPDDPESVK	2734	sp|Q96CS3|FAF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3279.4	32.52943	3	2115.944471	2115.943554	R	I	346	364
PSM	DTPTSAGPNSFNK	2735	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2957.6	24.24407	2	1414.579847	1414.576590	R	G	138	151
PSM	AQTPPGPSLSGSKSPCPQEK	2736	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2925.4	23.41437	3	2131.956671	2131.960935	K	S	1001	1021
PSM	EAVREGSPANWK	2737	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2942.3	23.84497	3	1422.629771	1422.629294	K	R	227	239
PSM	NGEVVHTPETSV	2738	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3045.6	26.50878	2	1427.534447	1427.537107	K	-	454	466
PSM	LHNGDLCSPKRSPTSSAIPLQSPR	2739	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,14-UNIMOD:21,15-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3209.4	30.71492	4	2857.240494	2857.238461	K	N	1234	1258
PSM	QISSSSTGCLSSPNATVQSPKHEWK	2740	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:4,11-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3189.3	30.18928	4	2875.222894	2875.224905	K	I	266	291
PSM	SCFESSPDPELK	2741	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3212.6	30.80048	2	1474.569847	1474.568728	R	S	871	883
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	2742	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3313.6	33.42082	4	2957.319294	2957.325316	K	E	117	144
PSM	IIYGGSVTGATCK	2743	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3192.5	30.27465	2	1485.595047	1485.597599	R	E	244	257
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	2744	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3162.5	29.49213	4	2988.444894	2988.448149	K	H	206	232
PSM	MPPRTPAEASSTGQTGPQSAL	2745	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3273.5	32.37618	3	2242.934771	2242.933080	K	-	238	259
PSM	SLAGSSGPGASSGTSGDHGELVVR	2746	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3151.5	29.20765	3	2264.008871	2264.007034	K	I	60	84
PSM	SLAGSSGPGASSGTSGDHGELVVR	2747	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3159.4	29.41162	3	2264.009171	2264.007034	K	I	60	84
PSM	SSDQPLTVPVSPK	2748	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3332.5	33.91165	2	1513.642847	1513.646658	K	F	728	741
PSM	ASEAASPLPDSPGDK	2749	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2927.6	23.47232	2	1520.638247	1520.639584	K	L	1144	1159
PSM	YRDVAECGPQQELDLNSPRNTTLER	2750	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3397.4	35.58655	4	3040.370494	3040.370978	K	Q	102	127
PSM	DTASLSTTPSESPR	2751	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2925.6	23.42103	2	1527.644047	1527.645398	R	A	259	273
PSM	SPVSTRPLPSASQK	2752	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2864.3	21.84652	3	1533.756071	1533.755223	R	A	216	230
PSM	PCSEETPAISPSK	2753	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2853.3	21.564	2	1561.5743	1561.5767	M	R	2	15
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	2754	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	32-UNIMOD:21	ms_run[1]:scan=1.1.3380.6	35.14919	6	4716.098541	4716.094806	K	A	530	573
PSM	FLMECRNSPVTK	2755	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2917.3	23.20338	3	1576.676171	1576.677901	K	T	58	70
PSM	FLMECRNSPVTK	2756	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2925.3	23.41103	3	1576.676171	1576.677901	K	T	58	70
PSM	DFTVSAMHGDMDQK	2757	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3291.2	32.8352	3	1580.664071	1580.659928	R	E	296	310
PSM	ELTSTCSPIISKPK	2758	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3073.2	27.18343	3	1639.790471	1639.789226	K	P	774	788
PSM	ESEPESPMDVDNSK	2759	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2956.6	24.2183	2	1642.606447	1642.606963	K	N	297	311
PSM	DMESPTKLDVTLAK	2760	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3310.2	33.32798	3	1642.751471	1642.752506	K	D	277	291
PSM	VGDSTPVSEKPVSAAVDANASESP	2761	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	34.24315	3	2473.023971	2473.029877	R	-	429	453
PSM	GGKPEPPAMPQPVPTA	2762	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3284.6	32.66572	2	1652.762247	1652.763345	K	-	228	244
PSM	ESVPEFPLSPPKKK	2763	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3322.3	33.64402	3	1661.842571	1661.842975	K	D	30	44
PSM	HHCPNTPIILVGTK	2764	sp|P63000|RAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3110.3	28.14162	3	1665.810071	1665.806213	R	L	103	117
PSM	VQAYEEPSVASSPNGK	2765	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3029.4	26.09987	2	1741.754447	1741.756011	R	E	719	735
PSM	TDSVIIADQTPTPTR	2766	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3289.3	32.78607	3	1773.758471	1773.758727	R	F	42	57
PSM	HIAEEADRKYEEVAR	2767	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2938.2	23.73797	4	1814.894894	1814.891125	K	K	154	169
PSM	QNTLVNNVSSPLPGEGK	2768	sp|Q15771|RAB30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	34.26485	3	1832.868071	1832.866958	R	S	176	193
PSM	RTEGVGPGVPGEVEMVK	2769	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3182.5	30.0131	3	1835.847971	1835.848866	R	G	16	33
PSM	VPSEGPKETPSSANGPSR	2770	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2737.3	18.76442	3	1875.833171	1875.836387	R	E	54	72
PSM	YNDWSDDDDDSNESK	2771	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3008.4	25.56022	3	1883.602271	1883.600692	R	S	57	72
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	2772	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3073.6	27.19677	4	3793.544894	3793.546038	K	R	142	179
PSM	RRWDQTADQTPGATPK	2773	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2900.6	22.77393	3	1986.831071	1986.835021	K	K	198	214
PSM	EQNPPPARSEDMPFSPK	2774	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3185.5	30.09108	3	2005.859771	2005.860493	K	A	251	268
PSM	FIHQQPQSSSPVYGSSAK	2775	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2961.6	24.34797	3	2026.912571	2026.914971	R	T	76	94
PSM	AACPLDSESAEGVVPPASGGGR	2776	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3332.4	33.90832	3	2162.922971	2162.930364	K	V	2201	2223
PSM	ETCVSGEDPTQGADLSPDEK	2777	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3136.5	28.81768	3	2213.872571	2213.867154	K	V	468	488
PSM	QQQLEEEAAKPPEPEKPVSPPPIESK	2778	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3231.5	31.29322	4	2961.436894	2961.437250	K	H	197	223
PSM	KYEDICPSTHNMDVPNIK	2779	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3321.5	33.62512	3	2239.958771	2239.964306	K	R	68	86
PSM	DTCYSPKPSVYLSTPSSASK	2780	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3368.4	34.83532	3	2253.992171	2253.986482	K	A	538	558
PSM	GHASAPYFGKEEPSVAPSSTGK	2781	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3171.3	29.71943	4	2362.991694	2362.987224	K	T	131	153
PSM	EHYPVSSPSSPSPPAQPGGVSR	2782	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3104.5	27.99127	3	2378.992871	2378.993372	K	N	2036	2058
PSM	DAAASASTPAQAPTSDSPVAEDASR	2783	sp|P55789|ALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3033.5	26.20223	3	2452.037771	2452.039122	R	R	43	68
PSM	IVRGDQPAASGDSDDDEPPPLPR	2784	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3171.4	29.72277	4	2483.100894	2483.096577	K	L	45	68
PSM	ASPEPQRENASPAPGTTAEEAMSR	2785	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3096.6	27.78568	3	2563.095971	2563.101011	R	G	963	987
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2786	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2813.6	20.57073	4	2753.014894	2753.011386	K	G	134	157
PSM	APTTVEDRVGDSTPVSEKPVSAAVDANASESP	2787	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3360.6	34.63523	4	3262.484894	3262.487842	K	-	421	453
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	2788	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	37-UNIMOD:35	ms_run[1]:scan=1.1.3036.5	26.27593	4	4447.606894	4447.605628	K	A	139	177
PSM	APNTPDILEIEFKK	2789	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3802.2	45.93196	3	1693.837871	1693.832805	K	G	216	230
PSM	DLSLDDFK	2790	sp|P30048|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3674.2	42.64	2	951.452447	951.454927	K	G	84	92
PSM	QFSQYIK	2791	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3482.2	37.74795	2	992.435847	992.436849	K	N	222	229
PSM	GLESAFTEK	2792	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3576.2	40.14275	2	1060.446247	1060.447807	K	V	1291	1300
PSM	KQSLGELIGTLNAAK	2793	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	47.21538	3	1621.840571	1621.844038	R	V	56	71
PSM	EIIDLVLDR	2794	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3985.2	50.32372	2	1084.610647	1084.612825	K	I	113	122
PSM	EGMTAFVEK	2795	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3433.2	36.48618	2	1090.439247	1090.440614	K	R	274	283
PSM	SCEGQNPELLPKTPISPLK	2796	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3626.4	41.42143	4	2267.034494	2267.031003	K	T	308	327
PSM	VDIDTPDIDIHGPEGK	2797	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3479.3	37.67313	3	1799.801771	1799.797876	K	L	4096	4112
PSM	VDIDTPDIDIHGPEGK	2798	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3471.3	37.46727	3	1799.801771	1799.797876	K	L	4096	4112
PSM	DLLTPCYSR	2799	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3452.3	36.98198	2	1203.499647	1203.499526	K	Q	304	313
PSM	SVDFDSLTVR	2800	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3745.2	44.47066	2	1217.532047	1217.532934	K	T	458	468
PSM	LLLDPSSPPTK	2801	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3431.3	36.4387	2	1246.619447	1246.621021	K	A	21	32
PSM	SGEISLPIKEEPSPISK	2802	sp|Q9ULH7|MRTFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3504.2	38.3213	3	1889.937971	1889.938726	K	M	909	926
PSM	DNLTLWTADNAGEEGGEAPQEPQS	2803	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3889.3	48.1131	4	2528.092494	2528.093920	R	-	225	249
PSM	MSASDPNSSIFLTDTAK	2804	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3778.3	45.31233	3	1943.762171	1943.762492	K	Q	350	367
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	2805	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3435.2	36.53852	4	2619.212094	2619.213536	R	D	175	200
PSM	LDNVPHTPSSYIETLPK	2806	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3672.5	42.59827	3	1989.940271	1989.944874	R	A	45	62
PSM	EFSPFGTITSAK	2807	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3833.3	46.67963	2	1363.600447	1363.606099	K	V	313	325
PSM	VLTPELYAELR	2808	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4046.2	51.77455	2	1382.678247	1382.684684	K	A	33	44
PSM	QMGSPTGSLPLVM	2809	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4494.2	58.32052	2	1396.6084470956603	1396.6131752980002	R	H	196	209
PSM	DINTFVGTPVEK	2810	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3466.3	37.34241	2	1398.644047	1398.643213	K	L	1916	1928
PSM	GLFSANDWQCK	2811	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3873.3	47.71035	2	1404.550447	1404.553352	R	T	62	73
PSM	EFVSISSPAHVAT	2812	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3516.5	38.6451	2	1423.640847	1423.638462	R	-	894	907
PSM	EGFSIPVSADGFK	2813	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3955.5	49.68238	2	1432.625247	1432.627563	K	F	1887	1900
PSM	IMNTFSVVPSPK	2814	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3807.3	46.06195	2	1478.623847	1478.628171	R	V	163	175
PSM	IMNTFSVVPSPK	2815	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3799.4	45.86033	2	1478.623847	1478.628171	R	V	163	175
PSM	VMVTDADRSILSPGGSCGPIK	2816	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3570.3	39.99389	3	2239.027271	2239.037806	R	V	199	220
PSM	NCTCGLAEELEK	2817	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3487.4	37.89182	2	1502.575047	1502.578247	K	E	248	260
PSM	GQASSPTPEPGVGAGDLPGPTSAPVPSGSQSGGR	2818	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3485.5	37.83681	4	3138.419694	3138.425516	K	G	960	994
PSM	AVFVDLEPTVIDEVRTGTYR	2819	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4064.5	52.17868	3	2359.145171	2359.146093	R	Q	65	85
PSM	MLAESDESGDEESVSQTDKTELQNTLR	2820	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3681.6	42.83583	4	3171.279294	3171.283996	K	T	186	213
PSM	DMSPLSETEMALGK	2821	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4070.2	52.31585	3	1587.653471	1587.656162	K	D	505	519
PSM	DMSPLSETEMALGK	2822	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3974.4	50.098	2	1603.648447	1603.651077	K	D	505	519
PSM	GDLNDCFIPCTPK	2823	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3601.5	40.80633	2	1615.635247	1615.641181	R	G	138	151
PSM	GVLFGVPGAFTPGCSK	2824	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4150.2	53.77197	3	1672.764071	1672.768430	K	T	87	103
PSM	NLEQILNGGESPKQK	2825	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3493.4	38.04228	3	1733.836571	1733.834930	K	G	219	234
PSM	ISLPGQMAGTPITPLK	2826	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3945.4	49.45737	3	1782.834071	1782.839226	K	D	213	229
PSM	VFVGGLSPDTSEEQIK	2827	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3627.2	41.43935	3	1784.817071	1784.823362	K	E	235	251
PSM	TITLEVEPSDTIENVK	2828	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3625.5	41.4	2	1786.918847	1786.920025	K	A	12	28
PSM	MYFPDVEFDIKSPK	2829	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4035.2	51.50602	3	1794.787871	1794.793976	K	F	5088	5102
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	2830	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3570.6	40.00388	4	3596.724494	3596.728741	K	-	244	278
PSM	DMYTICQSAGLDGLAK	2831	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3874.3	47.73635	3	1821.767471	1821.767838	R	K	522	538
PSM	SSASAPDVDDPEAFPALA	2832	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4220.2	54.73752	2	1838.753847	1838.761156	K	-	391	409
PSM	EVDGLLTSEPMGSPVSSK	2833	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3672.3	42.5916	3	1911.849971	1911.853676	K	T	582	600
PSM	SATSSSPGSPLHSLETSL	2834	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4104.2	53.01455	3	1916.775071	1916.780585	K	-	1203	1221
PSM	SATSSSPGSPLHSLETSL	2835	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4416.2	57.584	3	1916.777471	1916.780585	K	-	1203	1221
PSM	TDGFAEAIHSPQVAGVPR	2836	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3492.4	38.01623	3	1930.894571	1930.893842	R	F	2146	2164
PSM	YADLTEDQLPSCESLK	2837	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3614.6	41.13293	2	1947.813647	1947.817291	R	D	142	158
PSM	QIQTEAAQLLTSFSEKN	2838	sp|Q96DB5|RMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3999.2	50.66582	3	1986.930371	1986.929953	K	-	298	315
PSM	AIGGEFSDTNAAVEGTPLPK	2839	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3540.5	39.26873	3	2052.933371	2052.940517	K	A	242	262
PSM	GSGGLFSPSTAHVPDGALGQR	2840	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3678.2	42.74438	3	2089.953671	2089.958233	R	D	1023	1044
PSM	DQPAFTPSGILTPHALGSR	2841	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3946.4	49.48342	3	2123.938871	2123.944237	R	N	428	447
PSM	LNSPTDSTPALLSATVTPQK	2842	sp|Q9H4X1|RGCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3757.5	44.78085	3	2199.992171	2200.006562	K	A	95	115
PSM	NALESYAFNMKSAVEDEGLK	2843	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4106.4	53.05964	3	2295.005771	2295.013030	K	G	540	560
PSM	EASRPPEEPSAPSPTLPAQFK	2844	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3441.4	36.6997	3	2315.079371	2315.083493	R	Q	351	372
PSM	DNLTLWTSENQGDEGDAGEGEN	2845	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3847.4	47.04192	3	2349.936971	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	2846	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3917.6	48.8298	3	2407.983371	2407.988786	R	-	223	246
PSM	SAMDSPVPASMFAPEPSSPGAAR	2847	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3994.2	50.5396	3	2418.960071	2418.962665	R	A	8	31
PSM	DNLTLWTSDSAGEECDAAEGAEN	2848	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3909.3	48.63065	3	2453.973371	2453.976507	R	-	223	246
PSM	EATNTTSEPSAPSQDLLDLSPSPR	2849	sp|O75674|TM1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3781.5	45.39637	3	2592.154571	2592.159237	K	M	302	326
PSM	ALVEFESNPEETREPGSPPSVQR	2850	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3468.5	37.3988	3	2634.197771	2634.196291	R	A	31	54
PSM	IDEDGENTQIEDTEPMSPVLNSK	2851	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3602.6	40.83541	3	2640.105671	2640.114989	R	F	536	559
PSM	SDSYSQSLKSPLNDMSDDDDDDDSSD	2852	sp|Q9H8W4|PKHF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3635.6	41.6506	3	2932.023971	2932.023727	R	-	224	250
PSM	DGDSYDPYDFSDTEEEMPQVHTPKTADSQETK	2853	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3783.6	45.45108	4	3821.442894	3821.448889	K	E	701	733
PSM	TVIIEQSWGSPK	2854	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3526.6	38.90882	2	1423.670447	1423.674847	R	V	61	73
PSM	FSSPTEELDYR	2855	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3417.4	36.10467	2	1423.569447	1422.570442	K	N	2510	2521
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2856	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2847.4	21.42188	3	2674.029971	2673.045055	K	G	134	157
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2857	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3517.6	38.67437	5	3563.477118	3562.491898	K	V	60	92
PSM	AAPEASSPPASPLQHLLPGK	2858	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3661.3	42.30562	3	2047.011371	2047.013957	K	A	686	706
PSM	ASGVAVSDGVIK	2859	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3682.5	42.85873	2	1303.5423	1303.5457	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2860	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.3687.6	42.9923	3	2765.2180	2765.2250	-	Y	1	25
PSM	VPTANVSVVDLTCRLEK	2861	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	12-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3588.5	40.46565	3	1979.9722	1979.9746	R	P	235	252
PSM	ASGADSKGDDLSTAILK	2862	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3553.3	39.59253	3	1769.8063	1769.8079	M	Q	2	19
PSM	QFSQYIK	2863	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4267.2	55.44047	2	975.4075	975.4098	K	N	222	229
PSM	MPPRTPAEASSTGQTGPQSAL	2864	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3130.6	28.666	3	2258.925371	2258.927995	K	-	238	259
PSM	HLAEHSPYYEAMK	2865	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3004.3	25.45248	3	1654.687871	1654.685094	R	K	506	519
PSM	LGMLSPEGTCK	2866	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3316.2	33.4854	2	1271.530047	1271.529111	R	A	203	214
PSM	CTGGEVGATSALAPK	2867	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3495.5	38.09683	2	1480.6382	1480.6262	R	I	17	32
PSM	ATSEEDVSIKSPICEK	2868	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3092.3	27.67153	3	1871.820371	1871.822376	K	Q	1606	1622
PSM	SETAPAAPAAPAPAEKTPVKK	2869	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.2928.6	23.49812	3	2153.0743	2153.0764	M	K	2	23
PSM	HETTASFLTDSLDK	2870	sp|O43572|AKA10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3426.4	36.32043	2	1644.719647	1643.707998	K	R	192	206
PSM	ADKPDMGEIASFDK	2871	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3570.4	39.99722	2	1564.7039	1564.7074	M	A	2	16
PSM	TTGTPPDSSLVTYELHSRPEQDK	2872	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3450.2	36.92668	4	2637.189694	2637.195957	K	F	195	218
PSM	YSLADQTSGDQSPLPPCTPTPPCAEMR	2873	sp|Q06124|PTN11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.3676.5	42.70222	4	3135.236894	3135.242606	K	E	547	574
PSM	YSLADQTSGDQSPLPPCTPTPPCAEMREDSAR	2874	sp|Q06124|PTN11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.3545.6	39.3974	4	3693.471694	3693.482395	K	V	547	579
PSM	EAQERLTGDAFR	2875	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3089.3	27.5951	3	1471.646771	1471.645672	K	K	153	165
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	2876	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	39.67783	4	2961.171694	2961.178529	R	V	870	899
PSM	MLQAISPK	2877	sp|P49585|PCY1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2926.3	23.43968	2	982.449247	982.455870	R	Q	310	318
PSM	TPKATVGGLSPSK	2878	sp|Q9P218|COKA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2897.5	22.69318	2	1481.609447	1481.596945	K	G	77	90
PSM	TLASEWLGSPGTLGGTSTSALTTTSPSTTLVSEETNTHHSTSGK	2879	sp|Q8WXI7|MUC16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21,41-UNIMOD:21	ms_run[1]:scan=1.1.3065.5	27.01917	6	4552.092141	4549.042239	K	E	384	428
PSM	MPPRTPAEASSTGQTGPQSAL	2880	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3268.5	32.24653	3	2242.934771	2242.933080	K	-	238	259
PSM	GLTSVINQK	2881	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3366.3	34.78025	2	1038.509847	1038.511076	R	L	300	309
PSM	KSMETHIMHTFK	2882	sp|Q969G6|RIFK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,3-UNIMOD:35	ms_run[1]:scan=1.1.4057.3	51.99933	2	1584.686647	1584.682986	K	E	76	88
PSM	KPDQHFKPYLTPDLPK	2883	sp|O14638|ENPP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4127.2	53.40155	3	2083.980971	2082.958096	R	R	431	447
PSM	YNWSAK	2884	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3049.2	26.59747	2	847.326247	847.326570	K	A	47	53
PSM	SSTPLHSPSPIR	2885	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2967.2	24.49057	3	1357.641071	1357.639131	R	V	283	295
PSM	DGLILTSR	2886	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3379.2	35.10957	2	953.458247	953.458313	K	G	149	157
PSM	FANLTPSR	2887	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3103.2	27.9553	2	984.443447	984.442997	K	T	2050	2058
PSM	AMAPTSPQI	2888	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	33.51138	2	994.419247	994.419484	K	-	259	268
PSM	DYSSGFGGK	2889	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3002.2	25.39685	2	996.357847	996.358992	K	Y	153	162
PSM	DAIHFYNK	2890	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3081.4	27.39068	2	1006.486247	1006.487230	K	S	318	326
PSM	DGLTDVYNK	2891	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3126.2	28.55243	2	1023.487647	1023.487290	K	I	182	191
PSM	ALTSPSWGK	2892	sp|Q10571|MN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3234.2	31.3621	2	1025.460247	1025.458313	K	G	1004	1013
PSM	FYEQFSK	2893	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3182.2	30.0031	2	1027.405847	1027.405214	K	N	437	444
PSM	IESPKLER	2894	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2846.2	21.38295	3	1050.514571	1050.511076	K	T	807	815
PSM	TAAYGHFGR	2895	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2967.4	24.49723	2	1058.433447	1058.433495	R	D	374	383
PSM	DGEIVGLSGR	2896	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3272.4	32.34692	2	1081.479247	1081.480505	K	V	86	96
PSM	EFHLNESGDPSSKSTEIK	2897	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3214.2	30.84002	4	2163.881694	2163.876276	K	W	155	173
PSM	SAFSGGYYR	2898	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3202.3	30.52877	2	1086.418647	1086.417176	K	G	43	52
PSM	SCNCLLLK	2899	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3340.2	34.10798	2	1086.459247	1086.460304	K	V	336	344
PSM	TTIFSPEGR	2900	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3392.3	35.45215	2	1086.476247	1086.474691	R	L	9	18
PSM	GVVFDVTSGK	2901	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3400.2	35.65815	2	1087.492447	1087.495092	K	E	70	80
PSM	FFVSSSQGR	2902	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3179.2	29.92483	2	1093.457047	1093.459375	R	S	274	283
PSM	GFVEIQTPK	2903	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3358.2	34.56947	2	1097.512047	1097.515827	K	I	214	223
PSM	YNLKSPAVK	2904	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2931.4	23.56922	2	1098.547047	1098.547462	R	R	5	14
PSM	TAGNSEFLGK	2905	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3096.2	27.77235	2	1102.471047	1102.469606	K	T	32	42
PSM	DFSPEALKK	2906	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3131.2	28.67798	2	1113.511247	1113.510742	K	A	181	190
PSM	WLKSPTTPIDPEK	2907	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3402.3	35.71285	3	1670.738771	1670.735807	K	Q	859	872
PSM	SYDLTPVDK	2908	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3172.2	29.74207	2	1116.472047	1116.474022	K	F	316	325
PSM	ADDTDSQSWRSPLK	2909	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3176.3	29.85042	3	1684.708271	1684.709395	R	A	1464	1478
PSM	MSGFIYQGK	2910	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3211.2	30.76157	2	1125.458847	1125.456598	R	I	487	496
PSM	GQAAVQQLQAEGLSPR	2911	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3338.3	34.06018	3	1731.829571	1731.830513	R	F	43	59
PSM	QLSSGVSEIR	2912	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3166.2	29.5861	2	1154.532047	1154.533268	R	H	80	90
PSM	VLLPEYGGTK	2913	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3404.2	35.76255	2	1155.558447	1155.557692	K	V	71	81
PSM	VQAYEEPSVASSPNGK	2914	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3033.2	26.19223	3	1741.758371	1741.756011	R	E	719	735
PSM	SCAHDWVYE	2915	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3237.2	31.44035	2	1165.451847	1165.449859	K	-	129	138
PSM	ADTSQEICSPRLPISASHSSK	2916	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3214.3	30.84335	4	2350.063694	2350.062440	K	T	1020	1041
PSM	SSDEENGPPSSPDLDR	2917	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2950.3	24.05225	3	1780.679171	1780.678883	R	I	202	218
PSM	ENMEAISPLK	2918	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3321.2	33.61512	2	1210.529447	1210.530491	R	N	80	90
PSM	AIPGDQHPESPVHTEPMGIQGR	2919	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3151.2	29.19765	4	2432.098494	2432.094409	R	G	784	806
PSM	EAPEGWQTPK	2920	sp|Q9NWT8|AKIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3075.3	27.23522	2	1221.506047	1221.506719	K	I	184	194
PSM	SASVAPFTCK	2921	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3220.3	31.00055	2	1226.442447	1226.444393	K	T	1057	1067
PSM	SASVAPFTCK	2922	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3133.5	28.73947	2	1226.447047	1226.444393	K	T	1057	1067
PSM	RDYDDMSPR	2923	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2837.4	21.16623	2	1233.445247	1233.448553	R	R	278	287
PSM	QLVRGEPNVSYICSR	2924	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3267.3	32.21402	3	1856.860571	1856.860433	K	Y	269	284
PSM	EITALAPSTMK	2925	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3281.5	32.58405	2	1240.575447	1240.577441	K	I	318	329
PSM	VIGSGCNLDSAR	2926	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2937.4	23.71878	2	1247.588447	1247.592835	R	F	158	170
PSM	EQVANSAFVER	2927	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3026.4	26.02567	2	1248.609447	1248.609865	K	V	365	376
PSM	RDYDDMSPR	2928	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.2568.2	16.96952	2	1249.439647	1249.443468	R	R	278	287
PSM	GGETPGSEQWK	2929	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2965.4	24.4446	2	1254.490447	1254.491798	K	F	223	234
PSM	DLSPQHMVVR	2930	sp|P49590|SYHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3210.2	30.73558	3	1260.575771	1260.568608	R	E	65	75
PSM	SSPNPFVGSPPK	2931	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3323.2	33.66677	2	1292.577847	1292.580219	K	G	393	405
PSM	EAMEDGEIDGNK	2932	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2867.5	21.93055	2	1306.535247	1306.534711	K	V	628	640
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	2933	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3350.4	34.36775	4	2621.139694	2621.141158	K	I	50	74
PSM	DKDAYSSFGSR	2934	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3029.2	26.0932	2	1311.512247	1311.513261	K	S	65	76
PSM	TLNMTTSPEEK	2935	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2985.4	24.96352	2	1329.552447	1329.552349	K	R	326	337
PSM	LNQPGTPTRTAV	2936	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2941.4	23.82235	2	1333.638447	1333.639131	R	-	389	401
PSM	ELASPVSPELR	2937	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3373.5	34.96682	2	1356.572847	1356.572764	K	Q	175	186
PSM	EAGVEMGDEDDLSTPNEK	2938	sp|P14868|SYDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.2986.4	24.98912	3	2030.773571	2030.766378	R	L	357	375
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2939	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3300.5	33.07835	4	2717.310894	2717.307830	R	R	31	56
PSM	GEPNVSYICSR	2940	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3160.3	29.43412	2	1360.548847	1360.548267	R	Y	273	284
PSM	ALPSLNTGSSSPR	2941	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3221.5	31.0326	2	1365.625647	1365.628960	R	G	317	330
PSM	TAASGVEANSRPLDHAQPPSSLVIDK	2942	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3367.4	34.80997	4	2739.322094	2739.322889	K	E	167	193
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	2943	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3091.5	27.65267	4	2769.238094	2769.239553	K	V	100	125
PSM	TSGSGFHREGNTTEDDFPSSPGNGNK	2944	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2981.6	24.866	4	2774.125294	2774.120560	R	S	287	313
PSM	LNQPGTPTRTAV	2945	sp|P36507|MP2K2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2949.6	24.03657	2	1413.602847	1413.605462	R	-	389	401
PSM	SAGLEQPTDPVAR	2946	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3126.6	28.56577	2	1419.638447	1419.639524	K	D	361	374
PSM	NSEPAGLETPEAK	2947	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2943.6	23.881	2	1421.607447	1421.607556	R	V	890	903
PSM	TADSVSPLEPPTK	2948	sp|Q9UMZ2|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3156.5	29.33717	2	1420.647247	1420.648692	K	D	575	588
PSM	DTASLSTTPSESPRAQATSR	2949	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2946.6	23.9589	3	2141.958071	2141.959021	R	L	259	279
PSM	TYLVNSSDSGSSQTESPSSK	2950	sp|Q9H079|KTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3000.6	25.35858	3	2139.892871	2139.884519	R	Y	120	140
PSM	GGGGNFGPGPGSNFR	2951	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3258.3	31.98425	2	1456.589847	1456.588492	R	G	214	229
PSM	EAAGEGPALYEDPPDQKTSPSGKPATLK	2952	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3168.4	29.64465	4	2933.366494	2933.369564	K	I	36	64
PSM	SPPKSPEEEGAVSS	2953	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2759.5	19.27625	2	1479.610047	1479.613035	K	-	208	222
PSM	VLVERSAAETVTK	2954	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2983.5	24.9141	2	1481.745447	1481.749075	R	G	16	29
PSM	NWMVGGEGGAGGRSP	2955	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3404.5	35.77255	2	1510.598647	1510.602427	K	-	79	94
PSM	SSSPVQVEEEPVR	2956	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3052.5	26.68585	2	1521.668847	1521.671219	R	L	116	129
PSM	ESAAPASPAPSPAPSPTPAPPQK	2957	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2955.6	24.19232	3	2312.010371	2312.012710	K	E	538	561
PSM	LGNNEACSSCHCSPVGSLSTQCDSYGR	2958	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3202.6	30.53877	4	3082.172894	3082.167470	R	C	389	416
PSM	AKPAMPQDSVPSPR	2959	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2977.2	24.74903	3	1559.716571	1559.716729	K	S	470	484
PSM	NDAPTPGTSTTPGLR	2960	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2988.6	25.0479	2	1563.691047	1563.693017	R	S	324	339
PSM	ATLLEDQQDPSPSS	2961	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3280.4	32.5552	2	1566.642847	1566.645063	K	-	968	982
PSM	YAGGNPVCVRPTPK	2962	sp|Q15004|PAF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2988.2	25.03457	3	1594.733471	1594.732714	K	W	47	61
PSM	ETPHSPGVEDAPIAK	2963	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2970.4	24.57488	3	1626.730271	1626.729068	R	V	486	501
PSM	ETPHSPGVEDAPIAK	2964	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2962.3	24.3634	3	1626.730271	1626.729068	R	V	486	501
PSM	IIAEGANGPTTPEADK	2965	sp|P00367|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2933.5	23.62133	2	1662.748047	1662.750197	K	I	400	416
PSM	GGKPEPPAMPQPVPTA	2966	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.2985.3	24.96018	3	1668.764171	1668.758260	K	-	228	244
PSM	ATAGDTHLGGEDFDNR	2967	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3009.2	25.57942	3	1674.730871	1674.723391	K	L	221	237
PSM	LESPTVSTLTPSSPGK	2968	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3340.3	34.11132	3	1679.801171	1679.801898	K	L	292	308
PSM	NLDIERPTYTNLNR	2969	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=1.1.3306.4	33.2308	3	1717.8712	1717.8742	R	L	216	230
PSM	RNSNSPPSPSSMNQR	2970	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2791.4	20.03375	3	1737.722771	1737.725396	R	R	453	468
PSM	LKGEATVSFDDPPSAK	2971	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3182.3	30.00643	3	1740.796571	1740.797147	K	A	333	349
PSM	SAPPTRGPPPSYGGSSR	2972	sp|P38159|RBMX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2802.5	20.30547	3	1749.784871	1749.783563	R	Y	293	310
PSM	IISTTASKTETPIVSK	2973	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2957.4	24.2374	3	1754.904971	1754.906698	K	S	140	156
PSM	NHSGSRTPPVALNSSR	2974	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2809.4	20.46192	3	1758.814271	1758.816260	R	M	2098	2114
PSM	SGKYDLDFKSPDDPSR	2975	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3222.6	31.06247	2	1905.810847	1905.814588	R	Y	254	270
PSM	RNREEEWDPEYTPK	2976	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3142.3	28.96705	3	1927.815371	1927.810172	K	S	863	877
PSM	HVSPAGAAVGIPLSEDEAK	2977	sp|P31939|PUR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3389.2	35.37063	3	1926.903371	1926.908823	K	V	267	286
PSM	IACKSPQPDPVDTPASTK	2978	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.2882.3	22.31302	3	1990.908971	1990.907109	K	Q	2340	2358
PSM	NGNTNSLNLSSPNPMENK	2979	sp|Q9UPQ9|TNR6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3367.3	34.80663	3	2009.856671	2009.851385	K	G	375	393
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	2980	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3384.6	35.25337	3	3037.292171	3037.291647	K	E	117	144
PSM	SPAVATSTAAPPPPSSPLPSK	2981	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3133.6	28.7428	2	2038.995447	2038.997638	K	S	439	460
PSM	GPPASSPAPAPKFSPVTPK	2982	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3344.3	34.21118	3	2071.878671	2071.882228	R	F	254	273
PSM	ITITNDQNRLTPEEIER	2983	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3370.3	34.88423	3	2121.007571	2121.010328	K	M	524	541
PSM	ETESAPGSPRAVTPVPTKTEEVSNLK	2984	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3180.5	29.96093	4	2883.330894	2883.330416	K	T	514	540
PSM	AQCETLSPDGLPEEQPQTTK	2985	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3304.6	33.18453	3	2307.992471	2307.993023	R	L	3656	3676
PSM	GGAPDPSPGATATPGAPAQPSSPDAR	2986	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3011.6	25.64482	3	2409.057971	2409.059798	R	R	505	531
PSM	DCAVKPCQSDEVPDGIKSASYK	2987	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3181.5	29.98708	4	2533.087694	2533.086607	R	Y	98	120
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	2988	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3250.6	31.79258	5	3704.522118	3704.512278	K	-	158	196
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	2989	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	32-UNIMOD:21	ms_run[1]:scan=1.1.3385.6	35.27945	5	4716.099118	4716.094806	K	A	530	573
PSM	QFSQYIK	2990	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3490.2	37.95733	2	992.435847	992.436849	K	N	222	229
PSM	WLCPLSGK	2991	sp|Q9BXP5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3552.2	39.56305	2	1039.453847	1039.456204	K	K	713	721
PSM	WLCPLSGK	2992	sp|Q9BXP5|SRRT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	39.77177	2	1039.453847	1039.456204	K	K	713	721
PSM	NSPFQIPPPSPDSK	2993	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3449.2	36.90038	3	1589.710871	1589.712689	R	K	570	584
PSM	ALLYLCGGDD	2994	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3782.2	45.41203	2	1095.487647	1095.490661	K	-	330	340
PSM	GEFSASPMLK	2995	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	37.1867	2	1145.479647	1145.482813	R	S	1119	1129
PSM	FEDENFILK	2996	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3587.2	40.42967	2	1153.562047	1153.565540	K	H	83	92
PSM	AAVPSGASTGIYEALELRDNDK	2997	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3859.2	47.34533	4	2356.090894	2356.094786	R	T	33	55
PSM	ENSREALAEAALESPRPALVR	2998	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3486.2	37.85295	4	2358.169694	2358.169288	K	S	267	288
PSM	ELIFQETAR	2999	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3524.3	38.84658	2	1185.541647	1185.543105	K	F	362	371
PSM	DAGTIAGLNVLR	3000	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3706.2	43.47407	2	1198.663247	1198.666986	K	I	160	172
PSM	GVLLFGPPGTGK	3001	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3879.2	47.8624	2	1221.611447	1221.615876	K	T	211	223
PSM	TLTPISAAYAR	3002	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3433.5	36.49618	2	1242.600647	1242.600954	K	A	295	306
PSM	LLSPRPSLLTPTGDPR	3003	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3673.2	42.61385	3	1878.896771	1878.900581	R	A	937	953
PSM	NIEDVIAQGIGK	3004	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3870.2	47.62957	2	1255.673447	1255.677216	K	L	50	62
PSM	APSEEDSLSSVPISPYKDEPWK	3005	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3766.3	45.00212	4	2540.134094	2540.135982	K	Y	36	58
PSM	APSEEDSLSSVPISPYKDEPWK	3006	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3774.4	45.21255	4	2540.134094	2540.135982	K	Y	36	58
PSM	IACRSPQPDPVGTPTIFKPQSK	3007	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3432.4	36.46705	4	2583.200494	2583.195777	K	R	2219	2241
PSM	DSPSVWAAVPGK	3008	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3603.4	40.85473	2	1292.576447	1292.580219	K	T	27	39
PSM	DITEEIMSGAR	3009	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3739.2	44.32318	2	1300.534847	1300.537033	K	T	191	202
PSM	GRPSSPRTPLYLQPDAYGSLDR	3010	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3651.3	42.05148	4	2605.167694	2605.172733	K	A	116	138
PSM	LDNVPHTPSSYIETLPK	3011	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3696.4	43.21998	3	1989.940271	1989.944874	R	A	45	62
PSM	GLGLSPDLVVCR	3012	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3868.2	47.57738	2	1364.650447	1364.652338	R	C	206	218
PSM	SFSTALYGESDL	3013	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4339.4	56.54697	2	1368.545847	1368.548644	K	-	900	912
PSM	EMFPYEASTPTGISASCR	3014	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3730.3	44.09872	3	2082.838271	2082.842794	K	R	347	365
PSM	VNQSALEAVTPSPSFQQR	3015	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3457.5	37.11928	3	2117.920271	2117.918416	R	H	390	408
PSM	EFSPFGTITSAK	3016	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4060.2	52.06945	2	1443.568247	1443.572430	K	V	313	325
PSM	ELAEQLGLSTGEK	3017	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3489.5	37.94133	2	1453.667447	1453.670156	K	E	181	194
PSM	DNLTLWTSDQQDDDGGEGNN	3018	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3947.2	49.50262	3	2192.869271	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	3019	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3938.4	49.29347	3	2192.869271	2192.873028	R	-	228	248
PSM	LTFDSSFSPNTGK	3020	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3572.4	40.04628	2	1479.626247	1479.628291	K	K	97	110
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	3021	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3790.3	45.62354	4	2963.267694	2963.274343	R	T	88	114
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	3022	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3567.3	39.92457	4	2964.314094	2964.313840	K	-	178	207
PSM	GALQNIIPASTGAAK	3023	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3544.4	39.36592	2	1490.744847	1490.749409	R	A	201	216
PSM	DQLLLGPTYATPK	3024	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3712.4	43.63493	2	1495.721047	1495.732362	K	V	349	362
PSM	TLTIVDTGIGMTK	3025	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3871.3	47.66183	2	1508.657047	1508.659865	R	A	28	41
PSM	LTFDTTFSPNTGK	3026	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3662.5	42.3393	2	1507.657047	1507.659591	K	K	108	121
PSM	SCEGQNPELLPKTPISPLK	3027	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3643.5	41.8557	3	2267.026571	2267.031003	K	T	308	327
PSM	ESVPEFPLSPPKK	3028	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3512.2	38.52991	3	1533.749171	1533.748012	K	K	30	43
PSM	LQALVNSLCAGQSP	3029	sp|Q6XQN6|PNCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3794.5	45.73395	2	1536.695247	1536.700745	R	-	525	539
PSM	IQEWIPPSTPYK	3030	sp|Q9UI09|NDUAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3589.3	40.48547	2	1537.719047	1537.721798	K	-	134	146
PSM	DQGTYEDYVEGLR	3031	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3684.4	42.90688	2	1543.675047	1543.679067	K	V	82	95
PSM	AASQLAVPSTPLSPHSAASGTAAGSQPSSPR	3032	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,13-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3481.5	37.7322	4	3127.344094	3127.341406	R	Y	299	330
PSM	TLEAEFNSPSPPTPEPGEGPR	3033	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3555.4	39.64842	3	2367.956471	2367.966154	K	K	525	546
PSM	SSQAQAQELETKAELLQSDENGIPSSPQK	3034	sp|Q14542|S29A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3605.4	40.90491	4	3192.474494	3192.482362	K	V	227	256
PSM	IDFSSIAVPGTSSPR	3035	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3908.4	48.6082	2	1612.747447	1612.749803	R	Q	94	109
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	3036	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3594.3	40.61603	4	3246.382894	3246.383770	K	V	233	262
PSM	QMPSESLDPAFSPR	3037	sp|Q15018|ABRX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3591.2	40.5343	3	1640.690471	1640.690574	R	M	269	283
PSM	FVLSSGKFYGDEEK	3038	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3506.3	38.37678	3	1684.739771	1684.738570	K	D	49	63
PSM	APNTPDILEIEFKK	3039	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3778.2	45.309	3	1693.834871	1693.832805	K	G	216	230
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	3040	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:35,29-UNIMOD:21	ms_run[1]:scan=1.1.3998.3	50.6531	4	3441.445694	3441.453053	K	-	610	647
PSM	NTPASASLEGLAQTAGR	3041	sp|Q96Q45|TM237_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3695.2	43.18747	3	1722.793271	1722.793793	K	R	43	60
PSM	EATNTTSEPSAPSQDLLDLSPSPR	3042	sp|O75674|TM1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3789.4	45.59997	3	2592.154571	2592.159237	K	M	302	326
PSM	SESETESEASEITIPPSTPAVPQAPVQGEDYGK	3043	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3695.5	43.2008	4	3509.5535	3509.5605	R	G	530	563
PSM	DGPNALTPPPTTPEWIK	3044	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3851.3	47.14103	3	1912.887671	1912.897196	R	F	75	92
PSM	LSPPYSSPQEFAQDVGR	3045	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3765.3	44.97607	3	1956.859871	1956.861873	K	M	751	768
PSM	KEESEESDDDMGFGLFD	3046	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3780.6	45.37373	2	1964.742247	1964.746948	K	-	98	115
PSM	DLGLPTEAYISVEEVHDDGTPTSK	3047	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4036.2	51.52833	4	2652.1808	2652.1839	K	T	130	154
PSM	GLSLVDKENTPPALSGTR	3048	sp|P31350|RIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3480.6	37.70903	3	2013.915671	2013.917353	K	V	24	42
PSM	EQFLDGDGWTSRWIESK	3049	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4010.2	50.89452	3	2132.925671	2132.920451	K	H	25	42
PSM	GSGGLFSPSTAHVPDGALGQR	3050	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3796.2	45.7793	3	2169.920171	2169.924564	R	D	1023	1044
PSM	IGGDAATTVNNSTPDFGFGGQK	3051	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3634.3	41.61507	3	2232.970571	2232.968857	K	R	88	110
PSM	QLSSTSPLAPYPTSQMVSSDR	3052	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3632.3	41.56552	3	2331.044171	2331.045393	R	S	408	429
PSM	GVVPLAGTNGETTTQGLDGLSER	3053	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3759.4	44.82747	3	2351.097071	2351.100600	K	C	112	135
PSM	NSTLSDSGMIDNLPDSPDEVAK	3054	sp|Q9P0V3|SH3B4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3761.5	44.88063	3	2384.001371	2384.009067	R	E	116	138
PSM	DNLTLWTSDSAGEECDAAEGAEN	3055	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3937.4	49.27403	3	2453.973371	2453.976507	R	-	223	246
PSM	GISCMNTTLSESPFKCDPDAAR	3056	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3575.4	40.1231	3	2536.038971	2536.043362	K	A	239	261
PSM	QSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDR	3057	sp|Q92734|TFG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,6-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=1.1.3804.5	45.99322	6	5110.3292	5109.3272	K	S	156	204
PSM	SSSSESEDEDVIPATQCLTPGIR	3058	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3657.4	42.20523	3	2557.082771	2557.089109	R	T	996	1019
PSM	SMVSPVPSPTGTISVPNSCPASPR	3059	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3792.6	45.68515	3	2584.101671	2584.110393	R	G	236	260
PSM	FQSCLSPEEPAPESPQVPEAPGGSAV	3060	sp|Q99576|T22D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3810.5	46.14393	3	2746.176371	2746.183344	K	-	109	135
PSM	IADPEHDHTGFLTEYVATRWYR	3061	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3883.2	47.96155	5	2836.206618	2836.204762	R	A	190	212
PSM	GVVDSEDLPLNISR	3062	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3831.5	46.6365	2	1592.738047	1592.744718	R	E	387	401
PSM	SAESPTSPVTSETGSTFK	3063	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3472.3	37.49243	3	1972.779971	1971.775165	K	K	280	298
PSM	DLTDYLMK	3064	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:35	ms_run[1]:scan=1.1.3560.2	39.76843	2	1013.466447	1013.473949	R	I	186	194
PSM	EITALAPSTMK	3065	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3150.3	29.17552	2	1336.538247	1336.538687	K	I	318	329
PSM	SAVGFEYQGK	3066	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3192.4	30.27132	2	1164.484247	1164.485256	K	T	135	145
PSM	LELQGPRGSPNAR	3067	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2967.3	24.4939	3	1473.709271	1473.708941	R	S	555	568
PSM	CSGPGLSPGMVR	3068	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3626.5	41.42477	2	1279.5105	1279.5085	K	A	1453	1465
PSM	NGSLDSPGKQDTEEDEEEDEKDK	3069	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2842.5	21.29107	4	2674.029694	2673.045055	K	G	134	157
PSM	NGSLDSPGKQDTEEDEEEDEK	3070	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2816.3	20.64012	4	2429.922894	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	3071	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2822.5	20.7969	4	2594.070494	2593.078724	K	G	134	157
PSM	CESAPGCGVWQRPVIDNPNYK	3072	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3814.4	46.24023	3	2509.0502	2509.0551	R	G	360	381
PSM	TASTPTPPQTGGGLEPQANGETPQVAVIVRPDDR	3073	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3730.6	44.10872	4	3616.6432	3615.6602	R	S	202	236
PSM	IDEMPEAAVKSTANK	3074	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2911.4	23.05123	3	1698.750371	1698.753568	R	Y	30	45
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	3075	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3749.5	44.57887	3	2845.1887	2845.1913	-	Y	1	25
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDK	3076	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3532.6	39.0648	5	4593.1012	4593.1142	M	K	2	53
PSM	AMLDSGIYPPGSPGK	3077	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3522.6	38.80515	2	1568.710047	1568.694597	R	-	122	137
PSM	AAHSEGNTTAGLDMR	3078	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2905.4	22.89595	3	1610.654771	1609.655585	R	E	467	482
PSM	MMCGAPSATQPATAETQHIADQVR	3079	sp|P04080|CYTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4,7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3630.4	41.52008	3	2788.1090	2788.1052	-	S	1	25
PSM	MQELTLSPGPAK	3080	sp|Q93015-2|NAA80_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3474.2	37.5397	2	1408.6263	1408.6304	-	L	1	13
PSM	AHSPVQSGLPGMQNLK	3081	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3587.4	40.43633	3	1784.8192	1784.8275	M	A	2	18
PSM	KTGEAYVQFEEPEMANQALLK	3082	sp|Q12849|GRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2691.2	18.21873	4	2411.1782	2411.1672	R	H	289	310
PSM	SPLKEFDK	3083	sp|Q15049|MLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3771.2	45.14122	2	1043.4892	1042.4732	R	E	357	365
PSM	SPQLSLSPRPASPK	3084	sp|O95785|WIZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3201.3	30.50287	3	1623.743471	1623.742289	K	A	1006	1020
PSM	YSLADQTSGDQSPLPPCTPTPPCAEMREDSAR	3085	sp|Q06124|PTN11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.3553.6	39.60253	4	3693.471694	3693.482395	K	V	547	579
PSM	DVDASPSPLSVQDLK	3086	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3651.5	42.05815	2	1649.751647	1649.754948	R	G	405	420
PSM	LTSTATKDPEGFVGHPVNAFK	3087	sp|P13674|P4HA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3425.4	36.29645	4	2377.0872	2375.0592	R	L	66	87
PSM	TVQEADEDGDGAVSFVEFTKSLEK	3088	sp|O43745|CHP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2638.2	17.63433	5	2680.1756	2680.1788	R	M	160	184
PSM	QNSLHGSFHSADVLK	3089	sp|Q9NSY1|BMP2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,10-UNIMOD:21	ms_run[1]:scan=1.1.3817.3	46.31067	2	1701.7602	1701.7502	R	M	1105	1120
PSM	ARTEKEEK	3090	sp|Q3MHD2|LSM12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2636.2	17.57492	2	1069.4797	1069.4800	K	L	91	99
PSM	QEDEQDTDYDHVADGGLQADPGEGEQQCGEASSPEQVPVRAEEAR	3091	sp|Q14761|PTCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,7-UNIMOD:21,28-UNIMOD:4,33-UNIMOD:21	ms_run[1]:scan=1.1.3151.6	29.21098	6	5041.0212	5040.9772	R	D	107	152
PSM	DTSLLASATDPEPCSSPHRPQMVSPVSK	3092	sp|Q6PL24|TMED8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:4,15-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3555.3	39.64508	4	3153.352494	3153.354933	K	D	48	76
PSM	DPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK	3093	sp|Q16720|AT2B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21,17-UNIMOD:35,33-UNIMOD:21	ms_run[1]:scan=1.1.3508.6	38.43923	5	4725.1662	4724.1452	K	K	258	302
PSM	EKEEHTQEEGTVPSRTIEEEK	3094	sp|P41162|ETV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2566.2	16.93813	5	2565.127118	2564.127937	R	G	399	420
PSM	TVEEEESNFSSPLMLWLQQEQK	3095	sp|Q03164|KMT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2580.2	17.09705	4	2811.186094	2811.175161	K	R	3634	3656
PSM	TPKATVGGLSPSK	3096	sp|Q9P218|COKA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2889.5	22.48785	2	1481.609447	1481.596945	K	G	77	90
PSM	AGGPATPLSPTRLSR	3097	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3231.3	31.28655	3	1639.744871	1639.748437	R	L	29	44
PSM	CPNLTHLNLSGNK	3098	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3277.2	32.47033	3	1546.697771	1546.696328	K	I	87	100
PSM	DTCYSPKPSVYLSTPSSASK	3099	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3429.4	36.39297	3	2333.953871	2333.952813	K	A	538	558
PSM	DPMLLSGTHVMEGSGRMLVTAVGVNSQTGIIFTLLGAGGEEEEK	3100	sp|Q01814|AT2B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:35,17-UNIMOD:35,20-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3508.6	38.43923	5	4725.164618	4722.166929	K	K	255	299
PSM	PVTTPEEIAQVATISANGDK	3101	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3765.4	44.9794	3	2199.992171	2199.970177	K	E	161	181