MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000150 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617204740166495^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_06_K2_2.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	65.0	null	2-UNIMOD:1,19-UNIMOD:21,594-UNIMOD:21,628-UNIMOD:4,598-UNIMOD:21,4-UNIMOD:21,620-UNIMOD:21,26-UNIMOD:21,757-UNIMOD:21	0.11	65.0	12	3	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	61.0	null	118-UNIMOD:21,101-UNIMOD:21,27-UNIMOD:21	0.27	61.0	14	5	3
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	55.0	null	405-UNIMOD:21,418-UNIMOD:21,401-UNIMOD:21,332-UNIMOD:21,209-UNIMOD:21,417-UNIMOD:21,172-UNIMOD:21,411-UNIMOD:21,331-UNIMOD:21,155-UNIMOD:21	0.17	55.0	17	6	3
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	53.0	null	147-UNIMOD:21,65-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.22	53.0	4	3	2
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	53.0	null	2-UNIMOD:1,11-UNIMOD:21,630-UNIMOD:21,629-UNIMOD:21	0.09	53.0	5	2	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	115-UNIMOD:21,447-UNIMOD:4,455-UNIMOD:21,114-UNIMOD:21,70-UNIMOD:21,447-UNIMOD:385,225-UNIMOD:21,105-UNIMOD:21,231-UNIMOD:21,175-UNIMOD:21,159-UNIMOD:21,164-UNIMOD:21,158-UNIMOD:28,232-UNIMOD:21,117-UNIMOD:21	0.22	51.0	47	11	3
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	51.0	null	557-UNIMOD:21,554-UNIMOD:21,809-UNIMOD:21	0.07	51.0	9	4	3
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null	721-UNIMOD:21,727-UNIMOD:21,720-UNIMOD:21,723-UNIMOD:21	0.04	51.0	6	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	null	641-UNIMOD:21,646-UNIMOD:21,692-UNIMOD:21,696-UNIMOD:21,691-UNIMOD:21	0.08	51.0	13	2	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	824-UNIMOD:21,538-UNIMOD:21,778-UNIMOD:21,779-UNIMOD:4,780-UNIMOD:21	0.12	50.0	9	5	3
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	743-UNIMOD:21,758-UNIMOD:4,751-UNIMOD:21	0.04	50.0	15	1	0
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	null	2-UNIMOD:1,15-UNIMOD:21	0.15	49.0	6	1	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	241-UNIMOD:4,243-UNIMOD:21,234-UNIMOD:21,245-UNIMOD:21,240-UNIMOD:21	0.06	47.0	7	2	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	178-UNIMOD:21,174-UNIMOD:21,119-UNIMOD:21,134-UNIMOD:4,116-UNIMOD:21,120-UNIMOD:21,180-UNIMOD:21	0.38	47.0	7	2	0
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	227-UNIMOD:21,638-UNIMOD:21,213-UNIMOD:35,680-UNIMOD:21,219-UNIMOD:35,394-UNIMOD:21,422-UNIMOD:21,437-UNIMOD:21,401-UNIMOD:21	0.14	47.0	17	5	3
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	79-UNIMOD:21,64-UNIMOD:21,16-UNIMOD:21,29-UNIMOD:21,86-UNIMOD:21	0.65	45.0	7	4	3
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	241-UNIMOD:4,243-UNIMOD:21,295-UNIMOD:21,135-UNIMOD:21	0.11	45.0	5	3	2
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	138-UNIMOD:21,141-UNIMOD:21,154-UNIMOD:21,366-UNIMOD:21,289-UNIMOD:21,367-UNIMOD:21,295-UNIMOD:35,298-UNIMOD:21,306-UNIMOD:35,119-UNIMOD:21,370-UNIMOD:35	0.22	45.0	11	4	2
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	270-UNIMOD:4,272-UNIMOD:21,274-UNIMOD:4,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4,242-UNIMOD:4,250-UNIMOD:21,254-UNIMOD:4,243-UNIMOD:35,275-UNIMOD:21	0.22	45.0	14	3	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	102-UNIMOD:21,225-UNIMOD:21,223-UNIMOD:21,218-UNIMOD:35	0.26	45.0	8	2	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	104-UNIMOD:4,125-UNIMOD:21,237-UNIMOD:21,104-UNIMOD:385,234-UNIMOD:21,243-UNIMOD:21	0.36	44.0	26	7	1
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	202-UNIMOD:21,204-UNIMOD:21,17-UNIMOD:21,198-UNIMOD:21,30-UNIMOD:35,368-UNIMOD:21,207-UNIMOD:21,312-UNIMOD:21,286-UNIMOD:21,310-UNIMOD:35	0.18	44.0	23	6	2
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	49-UNIMOD:21,45-UNIMOD:21,238-UNIMOD:35,242-UNIMOD:21,256-UNIMOD:21,44-UNIMOD:21	0.17	44.0	12	2	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	287-UNIMOD:21,295-UNIMOD:21,443-UNIMOD:21,548-UNIMOD:21,595-UNIMOD:21,444-UNIMOD:21,454-UNIMOD:21	0.09	44.0	9	4	2
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	44.0	null	183-UNIMOD:21,197-UNIMOD:21,182-UNIMOD:35,156-UNIMOD:28,161-UNIMOD:35,165-UNIMOD:35	0.12	44.0	6	2	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	2054-UNIMOD:21,2058-UNIMOD:21	0.01	44.0	2	1	0
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	24-UNIMOD:21,33-UNIMOD:21,103-UNIMOD:21,106-UNIMOD:4,37-UNIMOD:21	0.06	44.0	4	2	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	1183-UNIMOD:21	0.03	43.0	3	1	0
PRT	sp|P48960|CD97_HUMAN	CD97 antigen OS=Homo sapiens OX=9606 GN=CD97 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	44-UNIMOD:4,57-UNIMOD:21,62-UNIMOD:4,68-UNIMOD:4,70-UNIMOD:21,61-UNIMOD:21	0.04	43.0	3	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	263-UNIMOD:21,19-UNIMOD:21,26-UNIMOD:21,205-UNIMOD:21,229-UNIMOD:21,37-UNIMOD:21,41-UNIMOD:21,272-UNIMOD:21,14-UNIMOD:21,40-UNIMOD:21,336-UNIMOD:21,337-UNIMOD:4,339-UNIMOD:4,72-UNIMOD:21,79-UNIMOD:21,94-UNIMOD:35,97-UNIMOD:35	0.33	43.0	29	12	4
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	575-UNIMOD:21	0.05	43.0	6	3	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	28-UNIMOD:21	0.16	43.0	9	2	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	34-UNIMOD:21,37-UNIMOD:21,39-UNIMOD:21	0.11	43.0	7	2	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,106-UNIMOD:21,300-UNIMOD:21,16-UNIMOD:35,305-UNIMOD:35	0.16	43.0	14	3	0
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	43.0	null	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21,1-UNIMOD:35,450-UNIMOD:21,449-UNIMOD:21,12-UNIMOD:21	0.04	43.0	39	2	0
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	792-UNIMOD:21	0.04	42.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	155-UNIMOD:21,160-UNIMOD:21,159-UNIMOD:21,162-UNIMOD:21,145-UNIMOD:28	0.07	42.0	20	3	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	373-UNIMOD:4,377-UNIMOD:21,386-UNIMOD:21,173-UNIMOD:21,179-UNIMOD:4,285-UNIMOD:21,289-UNIMOD:21,385-UNIMOD:21,264-UNIMOD:21,65-UNIMOD:21,284-UNIMOD:21	0.19	42.0	26	7	3
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	643-UNIMOD:21,85-UNIMOD:21,91-UNIMOD:21,637-UNIMOD:21,460-UNIMOD:21,86-UNIMOD:21,527-UNIMOD:21	0.14	42.0	18	7	5
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	74-UNIMOD:21,76-UNIMOD:21	0.08	41.0	10	4	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	15-UNIMOD:21,26-UNIMOD:21,9-UNIMOD:21	0.06	41.0	11	2	0
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	539-UNIMOD:21,547-UNIMOD:21,542-UNIMOD:21,519-UNIMOD:21	0.09	41.0	4	2	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	232-UNIMOD:21,241-UNIMOD:21	0.04	41.0	5	1	0
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	79-UNIMOD:4,83-UNIMOD:21,117-UNIMOD:21,113-UNIMOD:21,120-UNIMOD:35,254-UNIMOD:21,255-UNIMOD:4,251-UNIMOD:21	0.18	41.0	15	3	0
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	1-UNIMOD:1,12-UNIMOD:21,1-UNIMOD:35,192-UNIMOD:21,201-UNIMOD:21	0.22	41.0	9	3	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	102-UNIMOD:21,1012-UNIMOD:4,1014-UNIMOD:21,777-UNIMOD:21,533-UNIMOD:21	0.08	40.0	15	6	2
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	861-UNIMOD:21,859-UNIMOD:21	0.05	40.0	4	3	2
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	495-UNIMOD:4,506-UNIMOD:4,507-UNIMOD:21	0.05	40.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	40.0	null	175-UNIMOD:35,211-UNIMOD:35,563-UNIMOD:21,325-UNIMOD:21	0.22	40.0	11	6	3
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	712-UNIMOD:21,716-UNIMOD:4,691-UNIMOD:21,695-UNIMOD:21,1715-UNIMOD:21,601-UNIMOD:21,435-UNIMOD:21,1073-UNIMOD:21,1324-UNIMOD:4,1328-UNIMOD:21,669-UNIMOD:4,672-UNIMOD:21,1290-UNIMOD:35,1296-UNIMOD:4,1297-UNIMOD:21,1029-UNIMOD:21,1031-UNIMOD:21,1138-UNIMOD:21	0.12	40.0	23	12	6
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	370-UNIMOD:21	0.07	40.0	4	2	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	629-UNIMOD:21,637-UNIMOD:21	0.03	40.0	4	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	138-UNIMOD:35,214-UNIMOD:21,204-UNIMOD:21	0.18	40.0	10	4	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	359-UNIMOD:21,389-UNIMOD:21,65-UNIMOD:21	0.13	40.0	4	3	2
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	472-UNIMOD:21,425-UNIMOD:35,428-UNIMOD:21,495-UNIMOD:35	0.09	40.0	5	2	0
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	60-UNIMOD:21,64-UNIMOD:21	0.08	39.0	4	1	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	8-UNIMOD:21	0.10	39.0	2	2	2
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	2022-UNIMOD:21,2020-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	51-UNIMOD:21,54-UNIMOD:21	0.05	39.0	5	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	235-UNIMOD:35,148-UNIMOD:21	0.24	39.0	9	5	3
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	607-UNIMOD:21,598-UNIMOD:21,402-UNIMOD:21,410-UNIMOD:21,401-UNIMOD:21,296-UNIMOD:21,404-UNIMOD:21,599-UNIMOD:21	0.09	39.0	11	4	2
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	182-UNIMOD:21	0.17	39.0	2	2	2
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	344-UNIMOD:21,370-UNIMOD:21,335-UNIMOD:21,395-UNIMOD:21,359-UNIMOD:21,382-UNIMOD:35,387-UNIMOD:21,394-UNIMOD:21,338-UNIMOD:21	0.13	38.0	12	4	0
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	41-UNIMOD:21,45-UNIMOD:21,46-UNIMOD:21	0.19	38.0	3	1	0
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	308-UNIMOD:21,529-UNIMOD:21	0.11	38.0	2	2	2
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	31-UNIMOD:21,96-UNIMOD:21,103-UNIMOD:21,152-UNIMOD:21,153-UNIMOD:4	0.21	38.0	4	3	2
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	641-UNIMOD:21,668-UNIMOD:21	0.04	38.0	3	2	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	575-UNIMOD:21,400-UNIMOD:21	0.06	38.0	3	2	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	237-UNIMOD:4	0.10	38.0	4	1	0
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	270-UNIMOD:21,276-UNIMOD:21,143-UNIMOD:21,147-UNIMOD:21,76-UNIMOD:21	0.20	38.0	3	3	3
PRT	sp|Q86W56|PARG_HUMAN	Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	241-UNIMOD:4,247-UNIMOD:4,250-UNIMOD:4,261-UNIMOD:21,137-UNIMOD:21,313-UNIMOD:4,323-UNIMOD:21,302-UNIMOD:21	0.11	38.0	4	4	4
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,24-UNIMOD:21	0.07	38.0	1	1	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	426-UNIMOD:21	0.04	37.0	4	1	0
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	88-UNIMOD:21,87-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	11-UNIMOD:4,25-UNIMOD:4,28-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	296-UNIMOD:4,308-UNIMOD:21	0.05	37.0	2	2	2
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	492-UNIMOD:21,87-UNIMOD:21,99-UNIMOD:21,101-UNIMOD:4	0.06	37.0	2	2	2
PRT	sp|Q9NRR5|UBQL4_HUMAN	Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	114-UNIMOD:21,109-UNIMOD:21	0.08	37.0	2	1	0
PRT	sp|P32004|L1CAM_HUMAN	Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1248-UNIMOD:21,1247-UNIMOD:21	0.02	37.0	5	1	0
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	280-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21,278-UNIMOD:35,507-UNIMOD:21,506-UNIMOD:35,521-UNIMOD:21,1098-UNIMOD:4,1110-UNIMOD:21	0.10	37.0	12	5	3
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	670-UNIMOD:21,671-UNIMOD:21	0.04	37.0	2	1	0
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	751-UNIMOD:21,286-UNIMOD:21,749-UNIMOD:21,283-UNIMOD:21,1395-UNIMOD:21,1399-UNIMOD:4,1407-UNIMOD:4,285-UNIMOD:21,732-UNIMOD:21,640-UNIMOD:21,253-UNIMOD:21,265-UNIMOD:4,470-UNIMOD:4,483-UNIMOD:21,648-UNIMOD:21	0.09	37.0	22	10	7
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35	0.05	37.0	4	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	115-UNIMOD:21,131-UNIMOD:4,99-UNIMOD:4,104-UNIMOD:4	0.09	37.0	2	2	2
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	95-UNIMOD:21,94-UNIMOD:21,160-UNIMOD:21	0.09	36.0	3	2	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	36-UNIMOD:21,53-UNIMOD:21,39-UNIMOD:21	0.43	36.0	8	2	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	1129-UNIMOD:4,1131-UNIMOD:21,1139-UNIMOD:21,1923-UNIMOD:21,2221-UNIMOD:4,2223-UNIMOD:21,2231-UNIMOD:21,1801-UNIMOD:21	0.02	36.0	6	4	3
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	285-UNIMOD:21,286-UNIMOD:21	0.07	36.0	5	2	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	54-UNIMOD:4,60-UNIMOD:21,69-UNIMOD:21,244-UNIMOD:4,254-UNIMOD:21,213-UNIMOD:21,217-UNIMOD:21	0.11	36.0	4	3	2
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	23-UNIMOD:21,19-UNIMOD:21	0.06	36.0	2	1	0
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	139-UNIMOD:21,142-UNIMOD:21	0.10	36.0	5	2	1
PRT	sp|Q9Y6I3|EPN1_HUMAN	Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	454-UNIMOD:21,460-UNIMOD:21	0.04	36.0	4	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	38-UNIMOD:21	0.15	36.0	16	2	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	1318-UNIMOD:21,1329-UNIMOD:21,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,424-UNIMOD:21,2272-UNIMOD:21,440-UNIMOD:21,1043-UNIMOD:21,2343-UNIMOD:21,2335-UNIMOD:21,1048-UNIMOD:21,872-UNIMOD:4,876-UNIMOD:21,1396-UNIMOD:35,1404-UNIMOD:21,1413-UNIMOD:21,2449-UNIMOD:21,2453-UNIMOD:21,2100-UNIMOD:21,2104-UNIMOD:21,848-UNIMOD:21	0.09	36.0	19	14	10
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	47-UNIMOD:21	0.18	36.0	9	3	1
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	276-UNIMOD:21,257-UNIMOD:21,361-UNIMOD:21	0.07	36.0	3	3	3
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	259-UNIMOD:21,193-UNIMOD:35,198-UNIMOD:21,344-UNIMOD:21,247-UNIMOD:21,199-UNIMOD:21,225-UNIMOD:21	0.30	36.0	11	6	4
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	67-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,115-UNIMOD:21,116-UNIMOD:4,80-UNIMOD:21,442-UNIMOD:21,74-UNIMOD:21	0.15	36.0	8	3	2
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	2-UNIMOD:1,13-UNIMOD:21,10-UNIMOD:35,27-UNIMOD:21	0.03	36.0	9	3	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	2-UNIMOD:1,16-UNIMOD:21,6-UNIMOD:21,255-UNIMOD:35	0.14	36.0	5	2	0
PRT	sp|P09496-2|CLCA_HUMAN	Isoform Non-brain of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	176-UNIMOD:21	0.10	36.0	1	1	1
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,8-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4	0.15	36.0	7	1	0
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	158-UNIMOD:21	0.12	35.0	3	3	3
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	830-UNIMOD:4,837-UNIMOD:4,838-UNIMOD:21,842-UNIMOD:4,848-UNIMOD:4	0.01	35.0	4	1	0
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	576-UNIMOD:4,584-UNIMOD:21,17-UNIMOD:21	0.04	35.0	2	2	2
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	722-UNIMOD:21,713-UNIMOD:21,728-UNIMOD:21,717-UNIMOD:35,725-UNIMOD:21	0.04	35.0	11	2	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	210-UNIMOD:21,211-UNIMOD:21	0.05	35.0	7	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	220-UNIMOD:21,221-UNIMOD:21,242-UNIMOD:21	0.18	35.0	11	3	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	144-UNIMOD:21,355-UNIMOD:21,374-UNIMOD:21	0.10	35.0	4	2	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	79-UNIMOD:21,51-UNIMOD:21,64-UNIMOD:21	0.46	35.0	12	7	5
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	113-UNIMOD:4,115-UNIMOD:21	0.13	35.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	34.0	null	1125-UNIMOD:21	0.05	34.0	2	2	2
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	221-UNIMOD:21,268-UNIMOD:21,314-UNIMOD:21,333-UNIMOD:4,319-UNIMOD:21,315-UNIMOD:21	0.14	34.0	7	3	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	139-UNIMOD:21,145-UNIMOD:21,136-UNIMOD:21	0.10	34.0	20	3	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	57-UNIMOD:21,127-UNIMOD:21,129-UNIMOD:4	0.17	34.0	4	2	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	384-UNIMOD:21,189-UNIMOD:21,26-UNIMOD:21,30-UNIMOD:21	0.06	34.0	4	3	2
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1114-UNIMOD:21,552-UNIMOD:21,509-UNIMOD:21,513-UNIMOD:4,265-UNIMOD:21	0.05	34.0	5	5	5
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	14-UNIMOD:21,211-UNIMOD:21	0.10	34.0	5	2	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	445-UNIMOD:21,450-UNIMOD:21	0.01	34.0	2	1	0
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	298-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	22-UNIMOD:21,7-UNIMOD:28,20-UNIMOD:21	0.02	34.0	5	1	0
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	617-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	2319-UNIMOD:21,2327-UNIMOD:21,1533-UNIMOD:21,2372-UNIMOD:21,2378-UNIMOD:4,1946-UNIMOD:21,1453-UNIMOD:4,1459-UNIMOD:21,1084-UNIMOD:21	0.04	34.0	13	7	4
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	506-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:1,14-UNIMOD:21,1-UNIMOD:35,2-UNIMOD:1,6-UNIMOD:21	0.09	34.0	7	2	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1469-UNIMOD:21,1018-UNIMOD:21	0.02	34.0	2	2	2
PRT	sp|Q92575|UBXN4_HUMAN	UBX domain-containing protein 4 OS=Homo sapiens OX=9606 GN=UBXN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	129-UNIMOD:21,144-UNIMOD:4,120-UNIMOD:21	0.07	33.0	3	1	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	67-UNIMOD:21,60-UNIMOD:21,104-UNIMOD:21	0.10	33.0	6	3	2
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	623-UNIMOD:21,612-UNIMOD:21,618-UNIMOD:21,1023-UNIMOD:21,1027-UNIMOD:4,1034-UNIMOD:21,608-UNIMOD:21,1028-UNIMOD:21	0.03	33.0	12	4	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1267-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	515-UNIMOD:21,521-UNIMOD:21,774-UNIMOD:21,782-UNIMOD:21,788-UNIMOD:21,631-UNIMOD:21,526-UNIMOD:21	0.07	33.0	7	5	3
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	408-UNIMOD:21,370-UNIMOD:21,493-UNIMOD:35	0.09	33.0	9	5	2
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	186-UNIMOD:35,190-UNIMOD:21,193-UNIMOD:21	0.03	33.0	5	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	5762-UNIMOD:21,41-UNIMOD:21,4430-UNIMOD:21,4564-UNIMOD:21,511-UNIMOD:21,502-UNIMOD:35,4100-UNIMOD:21,93-UNIMOD:21,3426-UNIMOD:21,3716-UNIMOD:21,177-UNIMOD:21,3417-UNIMOD:35	0.03	33.0	20	12	6
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	57-UNIMOD:21,65-UNIMOD:21,93-UNIMOD:21,28-UNIMOD:21	0.32	33.0	5	3	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	680-UNIMOD:4,688-UNIMOD:21,692-UNIMOD:4,737-UNIMOD:21,744-UNIMOD:4,880-UNIMOD:21,898-UNIMOD:21,547-UNIMOD:21,883-UNIMOD:21,891-UNIMOD:21,954-UNIMOD:21	0.07	33.0	12	8	4
PRT	sp|Q9UBV2|SE1L1_HUMAN	Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	96-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	390-UNIMOD:21,396-UNIMOD:21,662-UNIMOD:21	0.05	33.0	4	2	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	248-UNIMOD:21	0.10	33.0	6	1	0
PRT	sp|Q13409-2|DC1I2_HUMAN	Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	73-UNIMOD:21,81-UNIMOD:21,83-UNIMOD:21,80-UNIMOD:35,84-UNIMOD:21	0.04	33.0	3	1	0
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	494-UNIMOD:21,493-UNIMOD:21,532-UNIMOD:21,537-UNIMOD:21,534-UNIMOD:21,442-UNIMOD:4,444-UNIMOD:21	0.09	33.0	6	3	1
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,8-UNIMOD:21,14-UNIMOD:4,18-UNIMOD:4,52-UNIMOD:21,58-UNIMOD:21	0.25	33.0	2	2	2
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	132-UNIMOD:21,138-UNIMOD:4,51-UNIMOD:21,53-UNIMOD:21,128-UNIMOD:21,135-UNIMOD:21,136-UNIMOD:21,139-UNIMOD:21,55-UNIMOD:21	0.10	32.0	8	3	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	187-UNIMOD:21,1980-UNIMOD:21,2105-UNIMOD:21,792-UNIMOD:21,776-UNIMOD:35,779-UNIMOD:21,2186-UNIMOD:21,1974-UNIMOD:21,1988-UNIMOD:21	0.05	32.0	8	7	6
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	9-UNIMOD:21,50-UNIMOD:21	0.06	32.0	2	2	2
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	439-UNIMOD:21	0.04	32.0	4	1	0
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	108-UNIMOD:4,118-UNIMOD:21	0.04	32.0	3	2	1
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	129-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	496-UNIMOD:4,498-UNIMOD:4,504-UNIMOD:21,1330-UNIMOD:21,1348-UNIMOD:21,1475-UNIMOD:21	0.04	32.0	4	3	2
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	466-UNIMOD:35,467-UNIMOD:21,453-UNIMOD:21,454-UNIMOD:21,859-UNIMOD:21,477-UNIMOD:21,462-UNIMOD:21,416-UNIMOD:21	0.07	32.0	11	4	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	441-UNIMOD:21,426-UNIMOD:35	0.05	32.0	2	1	0
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.18	32.0	2	1	0
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	2083-UNIMOD:21,569-UNIMOD:21,122-UNIMOD:21,129-UNIMOD:21,2054-UNIMOD:21,2081-UNIMOD:21	0.03	32.0	6	4	2
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	190-UNIMOD:21,193-UNIMOD:21	0.05	32.0	9	2	0
PRT	sp|Q13438|OS9_HUMAN	Protein OS-9 OS=Homo sapiens OX=9606 GN=OS9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	653-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	120-UNIMOD:21,135-UNIMOD:21,112-UNIMOD:21	0.05	32.0	5	3	1
PRT	sp|P50542|PEX5_HUMAN	Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	317-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	69-UNIMOD:21	0.05	32.0	3	1	0
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	157-UNIMOD:21,170-UNIMOD:21,504-UNIMOD:4,509-UNIMOD:21,159-UNIMOD:21	0.08	32.0	6	2	0
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	228-UNIMOD:21,226-UNIMOD:21,722-UNIMOD:21,81-UNIMOD:21	0.07	32.0	6	4	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	2-UNIMOD:1,3-UNIMOD:21,156-UNIMOD:21,160-UNIMOD:21,139-UNIMOD:4,8-UNIMOD:21	0.37	32.0	11	5	3
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	122-UNIMOD:21	0.04	32.0	3	2	1
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,21-UNIMOD:21	0.18	32.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	360-UNIMOD:385,360-UNIMOD:4,362-UNIMOD:21,366-UNIMOD:4,583-UNIMOD:21	0.12	31.0	5	4	3
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	2410-UNIMOD:21,2412-UNIMOD:35	0.00	31.0	2	1	0
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	583-UNIMOD:21,587-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	36-UNIMOD:21,196-UNIMOD:21,194-UNIMOD:21	0.29	31.0	5	4	3
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	56-UNIMOD:21	0.06	31.0	2	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	443-UNIMOD:21,434-UNIMOD:35,131-UNIMOD:28,136-UNIMOD:21,141-UNIMOD:21,456-UNIMOD:21,437-UNIMOD:21,115-UNIMOD:21,120-UNIMOD:21	0.18	31.0	14	6	4
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	106-UNIMOD:21,108-UNIMOD:4,303-UNIMOD:21,85-UNIMOD:21,84-UNIMOD:21	0.10	31.0	5	3	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.20	31.0	1	1	1
PRT	sp|O15439|MRP4_HUMAN	Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	646-UNIMOD:21	0.01	31.0	2	2	2
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	294-UNIMOD:21,304-UNIMOD:21,301-UNIMOD:21,296-UNIMOD:21	0.06	31.0	6	2	1
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	357-UNIMOD:21,367-UNIMOD:21,363-UNIMOD:21,369-UNIMOD:21,368-UNIMOD:21	0.04	31.0	5	1	0
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	147-UNIMOD:21	0.13	31.0	1	1	1
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	155-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	272-UNIMOD:21,274-UNIMOD:4,277-UNIMOD:4,249-UNIMOD:4,250-UNIMOD:21,251-UNIMOD:4,182-UNIMOD:21,305-UNIMOD:21	0.18	31.0	5	4	3
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	988-UNIMOD:21,990-UNIMOD:21,991-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	246-UNIMOD:21,251-UNIMOD:21,237-UNIMOD:21,242-UNIMOD:4	0.08	31.0	4	2	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	62-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	152-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	231-UNIMOD:21,233-UNIMOD:35,277-UNIMOD:21,276-UNIMOD:21	0.19	31.0	9	3	1
PRT	sp|O15357|SHIP2_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	154-UNIMOD:21,165-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	51-UNIMOD:21,44-UNIMOD:21	0.08	31.0	4	1	0
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	165-UNIMOD:21,163-UNIMOD:21	0.10	31.0	2	2	2
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	2	2	2
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	88-UNIMOD:21,311-UNIMOD:21,319-UNIMOD:21,327-UNIMOD:21	0.05	31.0	2	2	2
PRT	sp|Q9BVK6|TMED9_HUMAN	Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	80-UNIMOD:21,72-UNIMOD:28,85-UNIMOD:35	0.11	31.0	6	1	0
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	261-UNIMOD:21,6-UNIMOD:21,337-UNIMOD:21,365-UNIMOD:21	0.23	31.0	5	4	3
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	152-UNIMOD:21,165-UNIMOD:21,382-UNIMOD:21,383-UNIMOD:21,398-UNIMOD:21,222-UNIMOD:21	0.17	31.0	7	5	3
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,8-UNIMOD:21,302-UNIMOD:21,80-UNIMOD:21,82-UNIMOD:21	0.09	31.0	7	4	2
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,21-UNIMOD:21,44-UNIMOD:21,43-UNIMOD:21	0.24	31.0	5	3	2
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35,551-UNIMOD:21,35-UNIMOD:21	0.07	31.0	13	3	2
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	0.07	31.0	3	1	0
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1-UNIMOD:1,14-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,8-UNIMOD:21,15-UNIMOD:4	0.07	31.0	2	1	0
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,15-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	495-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	142-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:4,11-UNIMOD:21,7-UNIMOD:21	0.09	30.0	6	1	0
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	157-UNIMOD:21	0.09	30.0	2	2	2
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	16-UNIMOD:21	0.05	30.0	2	2	2
PRT	sp|Q9NZT2|OGFR_HUMAN	Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	674-UNIMOD:21,403-UNIMOD:21,315-UNIMOD:21,484-UNIMOD:21	0.14	30.0	5	4	3
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	359-UNIMOD:4,361-UNIMOD:21,341-UNIMOD:21,358-UNIMOD:21,375-UNIMOD:4,371-UNIMOD:35	0.13	30.0	5	3	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	819-UNIMOD:21,823-UNIMOD:21	0.03	30.0	3	1	0
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	120-UNIMOD:21,163-UNIMOD:21	0.14	30.0	7	2	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	181-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	391-UNIMOD:21,394-UNIMOD:21,410-UNIMOD:21,411-UNIMOD:21,412-UNIMOD:21	0.07	30.0	3	2	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	393-UNIMOD:21,415-UNIMOD:21	0.07	30.0	3	2	1
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	10-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	643-UNIMOD:4,658-UNIMOD:21,1141-UNIMOD:21,1144-UNIMOD:4,1151-UNIMOD:4,1153-UNIMOD:4,1162-UNIMOD:4,1237-UNIMOD:21,643-UNIMOD:385	0.04	30.0	5	3	2
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	482-UNIMOD:21,124-UNIMOD:21	0.06	30.0	2	2	2
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	427-UNIMOD:21,432-UNIMOD:21,117-UNIMOD:21	0.05	30.0	2	2	2
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	245-UNIMOD:21,254-UNIMOD:4,257-UNIMOD:21,420-UNIMOD:21,428-UNIMOD:21,436-UNIMOD:21,439-UNIMOD:4,416-UNIMOD:21	0.07	30.0	6	3	2
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	259-UNIMOD:21,286-UNIMOD:21,334-UNIMOD:21	0.09	30.0	6	4	2
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	38-UNIMOD:21,66-UNIMOD:21,631-UNIMOD:21,636-UNIMOD:21	0.11	30.0	7	5	3
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,8-UNIMOD:21,308-UNIMOD:4,343-UNIMOD:21	0.09	30.0	2	2	2
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	309-UNIMOD:4,320-UNIMOD:21,323-UNIMOD:21,232-UNIMOD:21,234-UNIMOD:4	0.03	30.0	4	2	1
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,10-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	30.0	2	1	0
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	146-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	87-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q9Y320|TMX2_HUMAN	Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	282-UNIMOD:21,283-UNIMOD:21	0.09	29.0	2	1	0
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21	0.04	29.0	3	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	9-UNIMOD:21,7-UNIMOD:21	0.17	29.0	6	2	0
PRT	sp|P55327|TPD52_HUMAN	Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	171-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	181-UNIMOD:21,171-UNIMOD:4	0.05	29.0	3	2	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	268-UNIMOD:35,275-UNIMOD:21	0.04	29.0	4	2	0
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	31-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	126-UNIMOD:21,122-UNIMOD:21,129-UNIMOD:21	0.22	29.0	2	1	0
PRT	sp|O75496|GEMI_HUMAN	Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	63-UNIMOD:21	0.12	29.0	1	1	1
PRT	sp|P04920|B3A2_HUMAN	Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	113-UNIMOD:21,115-UNIMOD:21,118-UNIMOD:21,141-UNIMOD:21,147-UNIMOD:21,170-UNIMOD:21,169-UNIMOD:21,183-UNIMOD:21,148-UNIMOD:21,151-UNIMOD:21,144-UNIMOD:21	0.06	29.0	8	4	1
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	160-UNIMOD:21	0.08	29.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	27-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.06	29.0	6	3	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	791-UNIMOD:21,703-UNIMOD:21,706-UNIMOD:4	0.06	29.0	3	2	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	188-UNIMOD:21,194-UNIMOD:21	0.04	29.0	4	1	0
PRT	sp|Q6XQN6|PNCB_HUMAN	Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	533-UNIMOD:4,537-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	219-UNIMOD:21	0.05	29.0	7	4	2
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	552-UNIMOD:21,223-UNIMOD:21,235-UNIMOD:4	0.02	29.0	2	2	2
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	319-UNIMOD:21,18-UNIMOD:21,237-UNIMOD:21	0.17	29.0	8	5	2
PRT	sp|P57076|CF298_HUMAN	Cilia- and flagella-associated protein 298 OS=Homo sapiens OX=9606 GN=CFAP298 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	267-UNIMOD:21	0.08	29.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	330-UNIMOD:21,328-UNIMOD:35	0.05	29.0	2	1	0
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	779-UNIMOD:21,778-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	108-UNIMOD:35	0.16	29.0	3	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	128-UNIMOD:21,140-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	128-UNIMOD:21,35-UNIMOD:21	0.12	29.0	3	3	3
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	29.0	2	1	0
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	106-UNIMOD:21	0.02	28.0	3	1	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	65-UNIMOD:21,89-UNIMOD:21	0.17	28.0	5	4	3
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	293-UNIMOD:21	0.05	28.0	3	2	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	320-UNIMOD:21,162-UNIMOD:21,164-UNIMOD:4,168-UNIMOD:21,302-UNIMOD:21	0.16	28.0	7	5	4
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	257-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	78-UNIMOD:21	0.17	28.0	1	1	1
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	163-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	199-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	620-UNIMOD:21,626-UNIMOD:21,621-UNIMOD:21,628-UNIMOD:21	0.03	28.0	5	1	0
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	149-UNIMOD:21,153-UNIMOD:21	0.07	28.0	2	1	0
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	65-UNIMOD:21,68-UNIMOD:21,63-UNIMOD:21	0.02	28.0	4	1	0
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	473-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q15311|RBP1_HUMAN	RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	99-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	199-UNIMOD:21,200-UNIMOD:21	0.11	28.0	6	2	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	28.0	null	212-UNIMOD:21,192-UNIMOD:21,86-UNIMOD:21,87-UNIMOD:21,94-UNIMOD:21,205-UNIMOD:21,89-UNIMOD:21	0.08	28.0	10	5	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	37-UNIMOD:21,41-UNIMOD:21,202-UNIMOD:21,205-UNIMOD:21,49-UNIMOD:4,55-UNIMOD:21	0.11	28.0	12	4	2
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	112-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	135-UNIMOD:21	0.10	28.0	1	1	1
PRT	sp|Q15155|NOMO1_HUMAN	Nodal modulator 1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	825-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	412-UNIMOD:21,414-UNIMOD:21	0.05	28.0	4	2	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	25-UNIMOD:21,38-UNIMOD:21,16-UNIMOD:21	0.26	28.0	21	5	2
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	145-UNIMOD:21	0.14	28.0	6	3	1
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	62-UNIMOD:21,87-UNIMOD:21,61-UNIMOD:21	0.07	28.0	6	2	1
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	52-UNIMOD:21	0.10	28.0	1	1	1
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	387-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	143-UNIMOD:21,148-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	352-UNIMOD:21,359-UNIMOD:21,364-UNIMOD:35	0.05	28.0	2	1	0
PRT	sp|Q9NX14|NDUBB_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	53-UNIMOD:21,52-UNIMOD:21	0.16	28.0	3	1	0
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1310-UNIMOD:21,132-UNIMOD:21	0.02	28.0	2	2	2
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	229-UNIMOD:4,237-UNIMOD:21,234-UNIMOD:21,243-UNIMOD:21,239-UNIMOD:21	0.13	28.0	6	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	692-UNIMOD:21,100-UNIMOD:21,184-UNIMOD:21	0.09	28.0	4	3	2
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	90-UNIMOD:21,76-UNIMOD:21,204-UNIMOD:21,206-UNIMOD:4	0.16	28.0	3	3	3
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	2-UNIMOD:1,9-UNIMOD:21,22-UNIMOD:4,73-UNIMOD:4,76-UNIMOD:21	0.30	28.0	2	2	2
PRT	sp|Q92879|CELF1_HUMAN	CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	168-UNIMOD:35,177-UNIMOD:4,179-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	161-UNIMOD:4	0.07	27.0	2	2	2
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	138-UNIMOD:21,141-UNIMOD:21	0.06	27.0	3	3	3
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	46-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q96BD0|SO4A1_HUMAN	Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	37-UNIMOD:21,40-UNIMOD:21	0.02	27.0	4	2	1
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	856-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1942-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	160-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	107-UNIMOD:21,104-UNIMOD:21	0.04	27.0	3	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	3	2	1
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:21	0.18	27.0	3	2	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	110-UNIMOD:21,291-UNIMOD:21,297-UNIMOD:4,290-UNIMOD:21,303-UNIMOD:21,350-UNIMOD:21,221-UNIMOD:21	0.12	27.0	7	4	2
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	226-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	313-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	143-UNIMOD:21,146-UNIMOD:21,311-UNIMOD:21,308-UNIMOD:21	0.05	27.0	7	2	0
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	144-UNIMOD:21,149-UNIMOD:21,148-UNIMOD:21,150-UNIMOD:21,134-UNIMOD:21	0.14	27.0	5	1	0
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	415-UNIMOD:21,331-UNIMOD:21,346-UNIMOD:4	0.04	27.0	2	2	2
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	973-UNIMOD:21,1117-UNIMOD:21,1116-UNIMOD:21,1081-UNIMOD:21	0.05	27.0	4	3	2
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	462-UNIMOD:21,473-UNIMOD:21,461-UNIMOD:21	0.05	27.0	3	1	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	324-UNIMOD:21,334-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|P37275|ZEB1_HUMAN	Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	679-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	169-UNIMOD:21	0.11	27.0	2	1	0
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	90-UNIMOD:21,128-UNIMOD:21,187-UNIMOD:21,134-UNIMOD:21	0.17	27.0	6	3	1
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	237-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	47-UNIMOD:21,222-UNIMOD:21	0.15	27.0	3	2	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2626-UNIMOD:21,2639-UNIMOD:21,2628-UNIMOD:21,2805-UNIMOD:21,1894-UNIMOD:21,1144-UNIMOD:21,1890-UNIMOD:21,2804-UNIMOD:21,2813-UNIMOD:35	0.02	27.0	10	5	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	317-UNIMOD:21,505-UNIMOD:21,391-UNIMOD:21,625-UNIMOD:35	0.12	27.0	11	7	4
PRT	sp|O95197|RTN3_HUMAN	Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	246-UNIMOD:21,2-UNIMOD:1,30-UNIMOD:21,34-UNIMOD:4,229-UNIMOD:21	0.07	27.0	5	3	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2169-UNIMOD:4,2172-UNIMOD:21,2176-UNIMOD:21,2157-UNIMOD:21,2161-UNIMOD:21,1616-UNIMOD:21,1619-UNIMOD:4	0.02	27.0	3	3	3
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	614-UNIMOD:21,619-UNIMOD:21,1113-UNIMOD:21,209-UNIMOD:21,1057-UNIMOD:21,1064-UNIMOD:21,1065-UNIMOD:4	0.04	27.0	4	4	4
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	612-UNIMOD:21,616-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1203-UNIMOD:21,1211-UNIMOD:21,1208-UNIMOD:21,1218-UNIMOD:21	0.02	27.0	6	1	0
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	335-UNIMOD:21	0.05	27.0	3	2	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	56-UNIMOD:21,439-UNIMOD:21,94-UNIMOD:21,51-UNIMOD:21,361-UNIMOD:21	0.27	27.0	12	7	4
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	321-UNIMOD:4,329-UNIMOD:21,331-UNIMOD:4,448-UNIMOD:4,458-UNIMOD:21	0.10	27.0	2	2	2
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	341-UNIMOD:4,342-UNIMOD:4,352-UNIMOD:21,354-UNIMOD:4,1294-UNIMOD:21,1677-UNIMOD:4,1682-UNIMOD:21,2726-UNIMOD:21	0.03	27.0	4	4	4
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,14-UNIMOD:21,123-UNIMOD:35,133-UNIMOD:21	0.28	27.0	2	2	2
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,12-UNIMOD:21	0.14	27.0	1	1	1
PRT	sp|A6NKF1|SAC31_HUMAN	SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	402-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	61-UNIMOD:35,66-UNIMOD:21,633-UNIMOD:21,163-UNIMOD:21,621-UNIMOD:35,641-UNIMOD:21,64-UNIMOD:21,549-UNIMOD:35,617-UNIMOD:35,638-UNIMOD:21	0.16	26.0	18	6	2
PRT	sp|Q86TS9|RM52_HUMAN	39S ribosomal protein L52, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	118-UNIMOD:21,115-UNIMOD:21	0.10	26.0	3	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	173-UNIMOD:4,183-UNIMOD:21,152-UNIMOD:21,32-UNIMOD:21	0.30	26.0	6	4	2
PRT	sp|Q66K74|MAP1S_HUMAN	Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	753-UNIMOD:35,759-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	460-UNIMOD:21,463-UNIMOD:21,464-UNIMOD:21	0.03	26.0	5	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	234-UNIMOD:4,835-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	171-UNIMOD:21,143-UNIMOD:21	0.10	26.0	2	2	2
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	96-UNIMOD:21,50-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	455-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	475-UNIMOD:21,480-UNIMOD:35,143-UNIMOD:21,144-UNIMOD:21	0.06	26.0	3	2	1
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	158-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	41-UNIMOD:21,165-UNIMOD:21,40-UNIMOD:21,33-UNIMOD:35	0.13	26.0	8	3	2
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	211-UNIMOD:4,216-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	114-UNIMOD:21,123-UNIMOD:4,438-UNIMOD:21,436-UNIMOD:21	0.07	26.0	6	2	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	248-UNIMOD:21,253-UNIMOD:21,243-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	85-UNIMOD:21,116-UNIMOD:21,87-UNIMOD:21	0.07	26.0	4	3	2
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	273-UNIMOD:21,270-UNIMOD:21,830-UNIMOD:21,836-UNIMOD:21	0.04	26.0	3	2	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	567-UNIMOD:21,110-UNIMOD:21,113-UNIMOD:21,306-UNIMOD:21,120-UNIMOD:21,126-UNIMOD:21,123-UNIMOD:21,335-UNIMOD:21	0.11	26.0	8	5	2
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	184-UNIMOD:21,189-UNIMOD:21	0.06	26.0	3	1	0
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	59-UNIMOD:21,50-UNIMOD:21	0.13	26.0	2	1	0
PRT	sp|Q13620|CUL4B_HUMAN	Cullin-4B OS=Homo sapiens OX=9606 GN=CUL4B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	134-UNIMOD:35,146-UNIMOD:21,144-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	210-UNIMOD:21,215-UNIMOD:4	0.01	26.0	2	1	0
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	172-UNIMOD:21,166-UNIMOD:21,164-UNIMOD:35,168-UNIMOD:21	0.03	26.0	11	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	315-UNIMOD:21,322-UNIMOD:21	0.02	26.0	5	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	412-UNIMOD:4,460-UNIMOD:21,468-UNIMOD:21,285-UNIMOD:21,290-UNIMOD:21	0.09	26.0	6	5	4
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	34-UNIMOD:21,52-UNIMOD:21,53-UNIMOD:21,105-UNIMOD:4	0.10	26.0	6	4	3
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	97-UNIMOD:21,100-UNIMOD:21,30-UNIMOD:21,37-UNIMOD:21	0.23	26.0	5	2	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	540-UNIMOD:4,542-UNIMOD:21,551-UNIMOD:21,561-UNIMOD:21,565-UNIMOD:21,539-UNIMOD:21,550-UNIMOD:21,554-UNIMOD:21,458-UNIMOD:21,546-UNIMOD:21,556-UNIMOD:21	0.07	26.0	8	3	2
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	133-UNIMOD:21,137-UNIMOD:21,132-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	111-UNIMOD:21,594-UNIMOD:21	0.03	26.0	6	2	0
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	488-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21	0.05	26.0	3	2	1
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	8-UNIMOD:4,12-UNIMOD:21,17-UNIMOD:4	0.03	26.0	2	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	260-UNIMOD:4,271-UNIMOD:21,273-UNIMOD:21,282-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	433-UNIMOD:21,439-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	462-UNIMOD:21,469-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q9C0E8|LNP_HUMAN	Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	182-UNIMOD:21,194-UNIMOD:21	0.06	26.0	4	1	0
PRT	sp|Q7Z434-4|MAVS_HUMAN	Isoform 4 of Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	11-UNIMOD:21,24-UNIMOD:21,6-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|Q9UHX3|AGRE2_HUMAN	Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	85-UNIMOD:4,94-UNIMOD:4,96-UNIMOD:4,97-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q9BW85|YJU2_HUMAN	Splicing factor YJU2 OS=Homo sapiens OX=9606 GN=YJU2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	301-UNIMOD:21	0.10	26.0	1	1	1
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	100-UNIMOD:4,127-UNIMOD:21,132-UNIMOD:21	0.37	26.0	2	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	234-UNIMOD:21,388-UNIMOD:21,394-UNIMOD:21	0.12	26.0	6	5	4
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	85-UNIMOD:21	0.05	26.0	3	2	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	292-UNIMOD:4,303-UNIMOD:21,185-UNIMOD:21	0.04	26.0	2	2	2
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,13-UNIMOD:21,8-UNIMOD:21	0.14	26.0	3	1	0
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,7-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P62310|LSM3_HUMAN	U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,10-UNIMOD:21	0.22	26.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	81-UNIMOD:21,284-UNIMOD:21,283-UNIMOD:35	0.06	25.0	4	3	2
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	226-UNIMOD:21,229-UNIMOD:21,225-UNIMOD:21	0.03	25.0	3	2	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1414-UNIMOD:21,395-UNIMOD:4,398-UNIMOD:4,400-UNIMOD:4,401-UNIMOD:21,410-UNIMOD:4	0.03	25.0	2	2	2
PRT	sp|Q969J3|BORC5_HUMAN	BLOC-1-related complex subunit 5 OS=Homo sapiens OX=9606 GN=BORCS5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	75-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	738-UNIMOD:21,734-UNIMOD:21	0.02	25.0	4	1	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1264-UNIMOD:21,1268-UNIMOD:21,399-UNIMOD:21,1266-UNIMOD:21,1240-UNIMOD:4,1245-UNIMOD:21,1247-UNIMOD:21,1255-UNIMOD:21	0.05	25.0	7	3	1
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	346-UNIMOD:21,338-UNIMOD:21	0.03	25.0	7	2	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	104-UNIMOD:21,232-UNIMOD:4,234-UNIMOD:21,107-UNIMOD:21	0.10	25.0	6	3	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	301-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	174-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	443-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	725-UNIMOD:21,721-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	161-UNIMOD:21,163-UNIMOD:4,167-UNIMOD:21	0.05	25.0	5	3	1
PRT	sp|O95359|TACC2_HUMAN	Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	2203-UNIMOD:4,2218-UNIMOD:21,2567-UNIMOD:21,2573-UNIMOD:4,2317-UNIMOD:21,2321-UNIMOD:21,2359-UNIMOD:21,2374-UNIMOD:4,2238-UNIMOD:21,2256-UNIMOD:21	0.04	25.0	8	6	4
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	223-UNIMOD:21,227-UNIMOD:21,207-UNIMOD:21,211-UNIMOD:21,328-UNIMOD:21,142-UNIMOD:21,129-UNIMOD:21	0.06	25.0	8	7	6
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	586-UNIMOD:21,613-UNIMOD:35,616-UNIMOD:21	0.05	25.0	4	2	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	13-UNIMOD:21,17-UNIMOD:21	0.05	25.0	3	2	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	513-UNIMOD:21,515-UNIMOD:21,518-UNIMOD:21,516-UNIMOD:21,510-UNIMOD:21	0.04	25.0	10	2	0
PRT	sp|P52701|MSH6_HUMAN	DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	292-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	90-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	2155-UNIMOD:21,361-UNIMOD:21	0.01	25.0	3	2	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	33-UNIMOD:21,36-UNIMOD:35	0.05	25.0	3	1	0
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	52-UNIMOD:21,191-UNIMOD:21,198-UNIMOD:21	0.07	25.0	3	3	3
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1721-UNIMOD:21,1727-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.23	25.0	3	2	1
PRT	sp|O60499|STX10_HUMAN	Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	108-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	52-UNIMOD:21,60-UNIMOD:21,42-UNIMOD:21	0.13	25.0	4	2	0
PRT	sp|Q53H80|AKIR2_HUMAN	Akirin-2 OS=Homo sapiens OX=9606 GN=AKIRIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	18-UNIMOD:21,21-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	251-UNIMOD:21,320-UNIMOD:21,325-UNIMOD:21,326-UNIMOD:21,327-UNIMOD:35	0.14	25.0	11	4	2
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	3	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	2202-UNIMOD:4,2204-UNIMOD:21,827-UNIMOD:21,831-UNIMOD:21,207-UNIMOD:21,212-UNIMOD:4,1118-UNIMOD:4,1120-UNIMOD:21,1127-UNIMOD:4	0.03	25.0	6	4	3
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	2-UNIMOD:1	0.18	25.0	2	2	2
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	704-UNIMOD:21,714-UNIMOD:21,815-UNIMOD:21,816-UNIMOD:4,828-UNIMOD:21	0.04	25.0	2	2	2
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	385-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	862-UNIMOD:21,865-UNIMOD:21,673-UNIMOD:21,675-UNIMOD:4,1319-UNIMOD:21,864-UNIMOD:21	0.03	24.0	5	3	2
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	335-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	412-UNIMOD:4,417-UNIMOD:21,420-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	17-UNIMOD:21	0.21	24.0	1	1	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	101-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	93-UNIMOD:21,94-UNIMOD:21,90-UNIMOD:21	0.06	24.0	5	2	0
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	118-UNIMOD:4,124-UNIMOD:21,260-UNIMOD:21,644-UNIMOD:21,811-UNIMOD:4,813-UNIMOD:21,818-UNIMOD:21	0.07	24.0	5	4	3
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	227-UNIMOD:21,226-UNIMOD:21	0.05	24.0	3	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	296-UNIMOD:35,301-UNIMOD:21,299-UNIMOD:21	0.01	24.0	5	1	0
PRT	sp|Q15599|NHRF2_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	43-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P07711|CATL1_HUMAN	Cathepsin L1 OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	322-UNIMOD:4,326-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	110-UNIMOD:21	0.11	24.0	1	1	1
PRT	sp|Q5PRF9|SMAG2_HUMAN	Protein Smaug homolog 2 OS=Homo sapiens OX=9606 GN=SAMD4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	275-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	972-UNIMOD:4,974-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	37-UNIMOD:21,32-UNIMOD:21,138-UNIMOD:21,150-UNIMOD:21	0.09	24.0	4	2	1
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	212-UNIMOD:21,211-UNIMOD:21	0.09	24.0	4	2	0
PRT	sp|Q13951-2|PEBB_HUMAN	Isoform 2 of Core-binding factor subunit beta OS=Homo sapiens OX=9606 GN=CBFB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	173-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	358-UNIMOD:21,364-UNIMOD:21	0.06	24.0	2	1	0
PRT	sp|O60353|FZD6_HUMAN	Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	615-UNIMOD:4,620-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	174-UNIMOD:21,56-UNIMOD:21,179-UNIMOD:21	0.15	24.0	3	2	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	259-UNIMOD:21,267-UNIMOD:21,270-UNIMOD:21,306-UNIMOD:21,308-UNIMOD:21,274-UNIMOD:21,179-UNIMOD:21,183-UNIMOD:21,182-UNIMOD:21,344-UNIMOD:21	0.15	24.0	13	5	2
PRT	sp|Q9Y6Y0|NS1BP_HUMAN	Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	274-UNIMOD:4,277-UNIMOD:21,271-UNIMOD:21,284-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q9Y6Q9|NCOA3_HUMAN	Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	716-UNIMOD:4,728-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	73-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	65-UNIMOD:21,71-UNIMOD:4	0.04	24.0	2	1	0
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	129-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	239-UNIMOD:21,241-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	229-UNIMOD:21	0.02	24.0	4	2	0
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	24.0	null	114-UNIMOD:21,272-UNIMOD:21,140-UNIMOD:21	0.16	24.0	4	4	4
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	47-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	9-UNIMOD:21	0.15	24.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	40-UNIMOD:21,39-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	842-UNIMOD:4,843-UNIMOD:21,853-UNIMOD:21,841-UNIMOD:35,844-UNIMOD:21	0.01	24.0	3	1	0
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	425-UNIMOD:21,428-UNIMOD:21,440-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	12-UNIMOD:21,25-UNIMOD:21,8-UNIMOD:21,24-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1500-UNIMOD:4,1519-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,19-UNIMOD:21,21-UNIMOD:4	0.10	24.0	1	1	1
PRT	sp|A1KXE4|F168B_HUMAN	Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	0.10	24.0	2	1	0
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,4-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,9-UNIMOD:21,1-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,11-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	69-UNIMOD:21	0.09	23.0	2	1	0
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	265-UNIMOD:21,281-UNIMOD:21	0.07	23.0	3	2	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O00115|DNS2A_HUMAN	Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	70-UNIMOD:21	0.04	23.0	4	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	863-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9BQE4|SELS_HUMAN	Selenoprotein S OS=Homo sapiens OX=9606 GN=SELENOS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	140-UNIMOD:21,144-UNIMOD:21	0.10	23.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	178-UNIMOD:21,181-UNIMOD:21,2719-UNIMOD:21	0.00	23.0	6	2	0
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	52-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q9UM00|TMCO1_HUMAN	Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	235-UNIMOD:21,224-UNIMOD:28	0.07	23.0	4	2	1
PRT	sp|Q96JP5|ZFP91_HUMAN	E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	101-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	37-UNIMOD:21,9-UNIMOD:21,119-UNIMOD:21,39-UNIMOD:21	0.19	23.0	7	4	2
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	363-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	173-UNIMOD:4,181-UNIMOD:21,194-UNIMOD:4,177-UNIMOD:21	0.10	23.0	2	1	0
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1006-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	23.0	null	232-UNIMOD:21,235-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	46-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	559-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	62-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|O95361|TRI16_HUMAN	Tripartite motif-containing protein 16 OS=Homo sapiens OX=9606 GN=TRIM16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	29-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1290-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	133-UNIMOD:21,137-UNIMOD:21,107-UNIMOD:21,114-UNIMOD:21	0.21	23.0	3	2	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1094-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	35-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q9NVA1|UQCC1_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens OX=9606 GN=UQCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	291-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	465-UNIMOD:21,11-UNIMOD:21	0.05	23.0	2	2	2
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	81-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	55-UNIMOD:21,60-UNIMOD:4,67-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q96G28|CFA36_HUMAN	Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	83-UNIMOD:4,85-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	23.0	3	1	0
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	314-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	159-UNIMOD:21,161-UNIMOD:4,57-UNIMOD:21,65-UNIMOD:4,142-UNIMOD:21,181-UNIMOD:21,185-UNIMOD:21,187-UNIMOD:21,160-UNIMOD:21	0.17	23.0	5	4	3
PRT	sp|P41236|IPP2_HUMAN	Protein phosphatase inhibitor 2 OS=Homo sapiens OX=9606 GN=PPP1R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	73-UNIMOD:21,86-UNIMOD:4	0.18	23.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	88-UNIMOD:21,93-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	426-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	745-UNIMOD:21,747-UNIMOD:4,756-UNIMOD:21,395-UNIMOD:21	0.04	23.0	3	3	3
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	85-UNIMOD:21	0.11	23.0	2	1	0
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	363-UNIMOD:21	0.04	23.0	3	1	0
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	189-UNIMOD:21,194-UNIMOD:4,179-UNIMOD:35,190-UNIMOD:21	0.07	23.0	3	1	0
PRT	sp|P46063|RECQ1_HUMAN	ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	49-UNIMOD:4,63-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q93015-2|NAA80_HUMAN	Isoform 2 of N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	1-UNIMOD:1,7-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	310-UNIMOD:21,308-UNIMOD:21,307-UNIMOD:21,427-UNIMOD:4,431-UNIMOD:21	0.07	22.0	7	3	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	97-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	552-UNIMOD:21,169-UNIMOD:21,106-UNIMOD:21	0.04	22.0	4	3	2
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	20-UNIMOD:21,23-UNIMOD:21,19-UNIMOD:21	0.03	22.0	4	2	1
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	160-UNIMOD:21	0.07	22.0	3	2	1
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	461-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	330-UNIMOD:35	0.03	22.0	2	1	0
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	384-UNIMOD:21	0.01	22.0	3	2	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	56-UNIMOD:21,55-UNIMOD:21	0.07	22.0	3	2	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	72-UNIMOD:21,544-UNIMOD:21,548-UNIMOD:21,460-UNIMOD:21	0.08	22.0	3	3	3
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	730-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	22.0	3	2	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	591-UNIMOD:4,595-UNIMOD:21,567-UNIMOD:4	0.05	22.0	3	3	3
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	549-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2042-UNIMOD:21,2044-UNIMOD:21,2041-UNIMOD:21,2045-UNIMOD:21	0.01	22.0	3	1	0
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	433-UNIMOD:21,437-UNIMOD:21,434-UNIMOD:21,436-UNIMOD:21	0.01	22.0	4	1	0
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	433-UNIMOD:21,451-UNIMOD:21,432-UNIMOD:21,222-UNIMOD:21,225-UNIMOD:21,219-UNIMOD:35	0.11	22.0	10	4	1
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	115-UNIMOD:21,119-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	248-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	242-UNIMOD:21,249-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	170-UNIMOD:21,175-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1245-UNIMOD:21,1252-UNIMOD:21,1253-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	432-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	386-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	256-UNIMOD:4,258-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	761-UNIMOD:21,765-UNIMOD:21,757-UNIMOD:35,2-UNIMOD:1,13-UNIMOD:21	0.04	22.0	3	2	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	596-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	7-UNIMOD:21	0.18	22.0	2	2	2
PRT	sp|P42702|LIFR_HUMAN	Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1059-UNIMOD:21,1061-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1019-UNIMOD:21,466-UNIMOD:21,470-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|Q9H8W4|PKHF2_HUMAN	Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens OX=9606 GN=PLEKHF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	233-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	146-UNIMOD:21,145-UNIMOD:21	0.17	22.0	3	2	1
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,18-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	275-UNIMOD:35,281-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q15011|HERP1_HUMAN	Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Homo sapiens OX=9606 GN=HERPUD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1,16-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	94-UNIMOD:21,105-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	43-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	53-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	487-UNIMOD:35,488-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	82-UNIMOD:21,80-UNIMOD:28,83-UNIMOD:21,176-UNIMOD:21,184-UNIMOD:21	0.25	21.0	9	3	0
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	69-UNIMOD:21,71-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	226-UNIMOD:21,275-UNIMOD:21,292-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q8NEZ2|VP37A_HUMAN	Vacuolar protein sorting-associated protein 37A OS=Homo sapiens OX=9606 GN=VPS37A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	14-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	244-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	177-UNIMOD:21,172-UNIMOD:21,176-UNIMOD:21,224-UNIMOD:21,222-UNIMOD:28	0.08	21.0	4	2	0
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	394-UNIMOD:21,398-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	490-UNIMOD:4,493-UNIMOD:21,715-UNIMOD:4,718-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q6UW78|UQCC3_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	92-UNIMOD:21,81-UNIMOD:35	0.17	21.0	2	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1505-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|Q13637|RAB32_HUMAN	Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	154-UNIMOD:21,162-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	95-UNIMOD:21,99-UNIMOD:21,164-UNIMOD:21,166-UNIMOD:4,88-UNIMOD:21	0.13	21.0	4	2	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	224-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	105-UNIMOD:21,108-UNIMOD:4,106-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	201-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	663-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1000-UNIMOD:21,1011-UNIMOD:21,989-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q8IXK0|PHC2_HUMAN	Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	740-UNIMOD:4,751-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	103-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9UNF1|MAGD2_HUMAN	Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	157-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	249-UNIMOD:21,244-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	198-UNIMOD:21,1231-UNIMOD:21,205-UNIMOD:21,211-UNIMOD:21,197-UNIMOD:35	0.04	21.0	8	3	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	297-UNIMOD:21,300-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|O14773|TPP1_HUMAN	Tripeptidyl-peptidase 1 OS=Homo sapiens OX=9606 GN=TPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	73-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	203-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	647-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	34-UNIMOD:21,30-UNIMOD:21,38-UNIMOD:35	0.03	21.0	5	1	0
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	44-UNIMOD:21,47-UNIMOD:4,91-UNIMOD:4	0.12	21.0	3	2	1
PRT	sp|Q6NXT4|ZNT6_HUMAN	Zinc transporter 6 OS=Homo sapiens OX=9606 GN=SLC30A6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	375-UNIMOD:21,382-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:21,100-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	149-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	33-UNIMOD:21,38-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|P54750|PDE1A_HUMAN	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	485-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	108-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|O75674|TM1L1_HUMAN	TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	321-UNIMOD:21,323-UNIMOD:21	0.05	21.0	3	1	0
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	2747-UNIMOD:21,2888-UNIMOD:21,1722-UNIMOD:21	0.02	21.0	4	3	2
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	422-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|P78344|IF4G2_HUMAN	Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,3-UNIMOD:21,32-UNIMOD:21,42-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21,9-UNIMOD:21	0.26	21.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	87-UNIMOD:385,87-UNIMOD:4,96-UNIMOD:21	0.06	21.0	2	1	0
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	272-UNIMOD:4,273-UNIMOD:21,275-UNIMOD:21,378-UNIMOD:21,407-UNIMOD:21	0.04	20.0	4	3	2
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	36-UNIMOD:4,38-UNIMOD:21,36-UNIMOD:385	0.06	20.0	3	1	0
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	654-UNIMOD:4,656-UNIMOD:21,663-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	20.0	null	30-UNIMOD:21,28-UNIMOD:21,161-UNIMOD:21,169-UNIMOD:21	0.14	20.0	3	2	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	460-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P40763|STAT3_HUMAN	Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	687-UNIMOD:4,701-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	296-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	173-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	189-UNIMOD:21,193-UNIMOD:21	0.09	20.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	346-UNIMOD:21,349-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P15559|NQO1_HUMAN	NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	109-UNIMOD:21,112-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	341-UNIMOD:21,344-UNIMOD:21,335-UNIMOD:21	0.07	20.0	5	1	0
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	481-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	327-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	208-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	240-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	121-UNIMOD:4,128-UNIMOD:4,129-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	719-UNIMOD:21,635-UNIMOD:21,641-UNIMOD:21	0.02	20.0	3	2	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	228-UNIMOD:21,117-UNIMOD:21,230-UNIMOD:21	0.11	20.0	3	2	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2029-UNIMOD:21,2032-UNIMOD:21,1261-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	255-UNIMOD:21,688-UNIMOD:21	0.04	20.0	3	2	1
PRT	sp|Q9H079|KTBL1_HUMAN	KATNB1-like protein 1 OS=Homo sapiens OX=9606 GN=KATNBL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	135-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	619-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2138-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	57-UNIMOD:21,74-UNIMOD:4,76-UNIMOD:4,86-UNIMOD:4,62-UNIMOD:21	0.11	20.0	2	1	0
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	333-UNIMOD:21,137-UNIMOD:4,139-UNIMOD:21	0.09	20.0	4	2	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	119-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	128-UNIMOD:21	0.09	20.0	2	1	0
PRT	sp|P84074|HPCA_HUMAN	Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens OX=9606 GN=HPCA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	185-UNIMOD:4,189-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9BQP7|MGME1_HUMAN	Mitochondrial genome maintenance exonuclease 1 OS=Homo sapiens OX=9606 GN=MGME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	71-UNIMOD:21,79-UNIMOD:4	0.06	20.0	1	1	1
PRT	sp|Q9UNW1|MINP1_HUMAN	Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	44-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	106-UNIMOD:21	0.04	20.0	2	1	0
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	666-UNIMOD:21,665-UNIMOD:35	0.02	20.0	2	1	0
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	527-UNIMOD:4,529-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	280-UNIMOD:21,46-UNIMOD:21,186-UNIMOD:21	0.12	20.0	3	3	3
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	88-UNIMOD:21,277-UNIMOD:21	0.10	20.0	2	2	2
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	252-UNIMOD:21,253-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.19	20.0	1	1	1
PRT	sp|Q8NDV7|TNR6A_HUMAN	Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1044-UNIMOD:21,1047-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9P0V3|SH3B4_HUMAN	SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	131-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	202-UNIMOD:4,210-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	413-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	526-UNIMOD:4,528-UNIMOD:21,533-UNIMOD:21,524-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	226-UNIMOD:21,269-UNIMOD:21,272-UNIMOD:21	0.10	20.0	3	2	1
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1,8-UNIMOD:21,1-UNIMOD:35	0.08	20.0	3	1	0
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	92-UNIMOD:4,96-UNIMOD:4,101-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q6VMQ6|MCAF1_HUMAN	Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	673-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	460-UNIMOD:21,175-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	89-UNIMOD:21,92-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|O75369-8|FLNB_HUMAN	Isoform 8 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1474-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	19.0	null	435-UNIMOD:21,534-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|Q9Y3D9|RT23_HUMAN	28S ribosomal protein S23, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS23 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	19.0	null	160-UNIMOD:21	0.11	19.0	1	1	1
PRT	sp|Q15771|RAB30_HUMAN	Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	184-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	87-UNIMOD:21,68-UNIMOD:21,70-UNIMOD:21	0.11	19.0	5	2	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	181-UNIMOD:21,186-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	110-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q15596|NCOA2_HUMAN	Nuclear receptor coactivator 2 OS=Homo sapiens OX=9606 GN=NCOA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	736-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	154-UNIMOD:21	0.03	19.0	4	1	0
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	77-UNIMOD:21,71-UNIMOD:35,81-UNIMOD:21	0.08	19.0	3	1	0
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	341-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|O95628|CNOT4_HUMAN	CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	424-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q5R3I4|TTC38_HUMAN	Tetratricopeptide repeat protein 38 OS=Homo sapiens OX=9606 GN=TTC38 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	452-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	82-UNIMOD:21	0.13	19.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	978-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	195-UNIMOD:21,457-UNIMOD:4,459-UNIMOD:21	0.05	19.0	2	2	2
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	249-UNIMOD:21,370-UNIMOD:21	0.07	19.0	2	2	2
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	559-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	399-UNIMOD:21,401-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|O75223|GGCT_HUMAN	Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	136-UNIMOD:21	0.10	19.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	317-UNIMOD:4,311-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	38-UNIMOD:21,17-UNIMOD:4,26-UNIMOD:21	0.15	19.0	3	2	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	335-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q96T76|MMS19_HUMAN	MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1027-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|O60831|PRAF2_HUMAN	PRA1 family protein 2 OS=Homo sapiens OX=9606 GN=PRAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	19-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	27-UNIMOD:21	0.07	19.0	2	1	0
PRT	sp|Q9ULH7|MRTFB_HUMAN	Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	921-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	508-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	147-UNIMOD:4,151-UNIMOD:21,165-UNIMOD:4,169-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1029-UNIMOD:21	0.01	19.0	2	2	2
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	385-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	159-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	186-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|Q9H6T3|RPAP3_HUMAN	RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	491-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P17813|EGLN_HUMAN	Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	516-UNIMOD:4,518-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	675-UNIMOD:21,691-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	186-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	345-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	192-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	235-UNIMOD:21,238-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	456-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q92503|S14L1_HUMAN	SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	585-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,2-UNIMOD:4,9-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	270-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	108-UNIMOD:21,116-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	294-UNIMOD:21,301-UNIMOD:21	0.06	18.0	2	1	0
PRT	sp|O95900|TRUB2_HUMAN	Mitochondrial mRNA pseudouridine synthase TRUB2 OS=Homo sapiens OX=9606 GN=TRUB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	299-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9NZB2|F120A_HUMAN	Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	991-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	70-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	441-UNIMOD:4,445-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O95302|FKBP9_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP9 OS=Homo sapiens OX=9606 GN=FKBP9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	277-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	203-UNIMOD:4,210-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	138-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	795-UNIMOD:21,809-UNIMOD:21	0.02	18.0	3	2	1
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	93-UNIMOD:21	0.03	18.0	3	1	0
PRT	sp|Q8NB90|AFG2H_HUMAN	ATPase family protein 2 homolog OS=Homo sapiens OX=9606 GN=SPATA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	398-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	715-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	150-UNIMOD:21,66-UNIMOD:21	0.11	18.0	2	2	2
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1757-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	55-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	454-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	321-UNIMOD:21	0.07	18.0	2	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	55-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	349-UNIMOD:4,355-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	29-UNIMOD:21,32-UNIMOD:21,46-UNIMOD:21,76-UNIMOD:21,80-UNIMOD:4	0.15	18.0	3	2	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	468-UNIMOD:21,479-UNIMOD:21,474-UNIMOD:21	0.05	18.0	3	1	0
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	508-UNIMOD:4,511-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9UJY1|HSPB8_HUMAN	Heat shock protein beta-8 OS=Homo sapiens OX=9606 GN=HSPB8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	24-UNIMOD:21,27-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	104-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	9-UNIMOD:21,2-UNIMOD:1,6-UNIMOD:21	0.16	18.0	2	2	2
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	249-UNIMOD:21,615-UNIMOD:21,903-UNIMOD:21,612-UNIMOD:21	0.05	18.0	4	3	2
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	476-UNIMOD:4,480-UNIMOD:21,482-UNIMOD:4,325-UNIMOD:21	0.06	18.0	2	2	2
PRT	sp|P18850|ATF6A_HUMAN	Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	94-UNIMOD:21,103-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	60-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	453-UNIMOD:4,466-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	80-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q13443|ADAM9_HUMAN	Disintegrin and metalloproteinase domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ADAM9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	428-UNIMOD:4,430-UNIMOD:4,432-UNIMOD:21,436-UNIMOD:4,441-UNIMOD:4,442-UNIMOD:4,447-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	786-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	287-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	49-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	258-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1079-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	100-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	237-UNIMOD:4,238-UNIMOD:21,234-UNIMOD:21	0.06	18.0	2	1	0
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	285-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	4521-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	64-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q8N392|RHG18_HUMAN	Rho GTPase-activating protein 18 OS=Homo sapiens OX=9606 GN=ARHGAP18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	613-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	115-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P08651|NFIC_HUMAN	Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	323-UNIMOD:21,305-UNIMOD:21	0.09	18.0	2	2	2
PRT	sp|Q8WTV0-2|SCRB1_HUMAN	Isoform 1 of Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	497-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	926-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	43-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	194-UNIMOD:21,197-UNIMOD:21	0.10	18.0	2	1	0
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	533-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	675-UNIMOD:21,686-UNIMOD:4,689-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|Q765P7|MTSS2_HUMAN	Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	615-UNIMOD:4,624-UNIMOD:21,634-UNIMOD:21,365-UNIMOD:4,371-UNIMOD:4,373-UNIMOD:21	0.08	18.0	3	3	3
PRT	sp|Q9Y5J6|T10B_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 B OS=Homo sapiens OX=9606 GN=TIMM10B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	99-UNIMOD:21,103-UNIMOD:21	0.26	18.0	2	2	2
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	51-UNIMOD:21,63-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|O00429-2|DNM1L_HUMAN	Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	575-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,12-UNIMOD:21	0.01	18.0	4	2	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,26-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q9H0C8|ILKAP_HUMAN	Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	1-UNIMOD:1,13-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,9-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q53T59|H1BP3_HUMAN	HCLS1-binding protein 3 OS=Homo sapiens OX=9606 GN=HS1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	1-UNIMOD:1,3-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	172-UNIMOD:21,174-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q9NSY1|BMP2K_HUMAN	BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	1105-UNIMOD:28,1114-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9Y232|CDYL_HUMAN	Chromodomain Y-like protein OS=Homo sapiens OX=9606 GN=CDYL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	201-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	955-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	433-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	13-UNIMOD:21	0.12	17.0	1	1	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	706-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	91-UNIMOD:21,251-UNIMOD:35,253-UNIMOD:21	0.06	17.0	3	2	1
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	426-UNIMOD:4,434-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	332-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9H3U1|UN45A_HUMAN	Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	8-UNIMOD:21,15-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P78310|CXAR_HUMAN	Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	334-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	17.0	2	2	2
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	732-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	212-UNIMOD:21	0.07	17.0	2	1	0
PRT	sp|A7E2V4|ZSWM8_HUMAN	Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1092-UNIMOD:21,1094-UNIMOD:4,1104-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	62-UNIMOD:4,65-UNIMOD:21,77-UNIMOD:21,82-UNIMOD:21,60-UNIMOD:35	0.34	17.0	5	2	0
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1038-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	201-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P05997|CO5A2_HUMAN	Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1288-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	376-UNIMOD:21,381-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q16666|IF16_HUMAN	Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	153-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	814-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q5T1V6|DDX59_HUMAN	Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	156-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	9-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2249-UNIMOD:4,2260-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1299-UNIMOD:21,1302-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	null	204-UNIMOD:21,211-UNIMOD:21,216-UNIMOD:21	0.10	17.0	1	1	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	423-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	315-UNIMOD:21,322-UNIMOD:21,321-UNIMOD:21	0.02	17.0	3	1	0
PRT	sp|Q9H4X1|RGCC_HUMAN	Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	101-UNIMOD:21,107-UNIMOD:21,97-UNIMOD:21	0.15	17.0	2	1	0
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2150-UNIMOD:4,2155-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	104-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q86YP4|P66A_HUMAN	Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	100-UNIMOD:21,113-UNIMOD:21,114-UNIMOD:21	0.03	17.0	2	1	0
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	115-UNIMOD:21	0.05	17.0	2	2	2
PRT	sp|Q96Q45|TM237_HUMAN	Transmembrane protein 237 OS=Homo sapiens OX=9606 GN=TMEM237 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	47-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	417-UNIMOD:4,420-UNIMOD:4	0.04	17.0	2	2	2
PRT	sp|P55265|DSRAD_HUMAN	Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	599-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	999-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q96DB5|RMD1_HUMAN	Regulator of microtubule dynamics protein 1 OS=Homo sapiens OX=9606 GN=RMDN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	308-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	669-UNIMOD:4,670-UNIMOD:21,681-UNIMOD:21,680-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	66-UNIMOD:21	0.02	17.0	2	2	2
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1250-UNIMOD:21,1257-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q16537|2A5E_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,7-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	17.0	2	2	2
PRT	sp|P30566|PUR8_HUMAN	Adenylosuccinate lyase OS=Homo sapiens OX=9606 GN=ADSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,9-UNIMOD:21,15-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|Q96EB6|SIR1_HUMAN	NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,14-UNIMOD:21,27-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	34-UNIMOD:21,37-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q2KJY2|KI26B_HUMAN	Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	324-UNIMOD:21,347-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P68400|CSK21_HUMAN	Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	183-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	233-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	341-UNIMOD:21,344-UNIMOD:4	0.03	16.0	2	2	2
PRT	sp|Q8TCU4|ALMS1_HUMAN	Alstrom syndrome protein 1 OS=Homo sapiens OX=9606 GN=ALMS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1635-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|O75449|KTNA1_HUMAN	Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	170-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	48-UNIMOD:21,54-UNIMOD:21	0.03	16.0	3	1	0
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	100-UNIMOD:21,104-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|P49757|NUMB_HUMAN	Protein numb homolog OS=Homo sapiens OX=9606 GN=NUMB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	636-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	14-UNIMOD:4,16-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q05D32|CTSL2_HUMAN	CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	161-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q9UHL4|DPP2_HUMAN	Dipeptidyl peptidase 2 OS=Homo sapiens OX=9606 GN=DPP7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	213-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	22-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P18827|SDC1_HUMAN	Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	233-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|Q92804|RBP56_HUMAN	TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	295-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q16875|F263_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	467-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	179-UNIMOD:21,190-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	22-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	62-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	149-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	458-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	784-UNIMOD:21,403-UNIMOD:28,412-UNIMOD:21	0.05	16.0	2	2	2
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	490-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	313-UNIMOD:21,320-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9NXH9|TRM1_HUMAN	tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	620-UNIMOD:4,621-UNIMOD:4,628-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	16.0	null	193-UNIMOD:21,220-UNIMOD:21	0.06	16.0	2	2	2
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1256-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	237-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	218-UNIMOD:21,227-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	316-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	353-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	123-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|Q01201|RELB_HUMAN	Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	573-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	127-UNIMOD:21	0.15	16.0	1	1	1
PRT	sp|O94855|SC24D_HUMAN	Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	299-UNIMOD:4,308-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,3-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,9-UNIMOD:21	0.19	16.0	1	1	1
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	548-UNIMOD:21,563-UNIMOD:4,564-UNIMOD:21,569-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,3-UNIMOD:4,9-UNIMOD:21,12-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q96PQ6|ZN317_HUMAN	Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	86-UNIMOD:35,98-UNIMOD:21,107-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	159-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	138-UNIMOD:21	0.10	15.0	1	1	1
PRT	sp|Q92526|TCPW_HUMAN	T-complex protein 1 subunit zeta-2 OS=Homo sapiens OX=9606 GN=CCT6B PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	49-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	77-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	293-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	410-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	321-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q86TM6|SYVN1_HUMAN	E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	613-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q8IXQ3|CI040_HUMAN	Uncharacterized protein C9orf40 OS=Homo sapiens OX=9606 GN=C9orf40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	67-UNIMOD:21	0.09	15.0	1	1	1
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	110-UNIMOD:21,112-UNIMOD:4	0.09	15.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	170-UNIMOD:4,178-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	246-UNIMOD:21,249-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	317-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	118-UNIMOD:21	0.09	15.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	238-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	302-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	658-UNIMOD:4,660-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	203-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q96HC4|PDLI5_HUMAN	PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	111-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	511-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	70-UNIMOD:21	0.10	15.0	1	1	1
PRT	sp|Q9BUR4|TCAB1_HUMAN	Telomerase Cajal body protein 1 OS=Homo sapiens OX=9606 GN=WRAP53 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	13-UNIMOD:4,14-UNIMOD:4,26-UNIMOD:21,30-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P84095|RHOG_HUMAN	Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	138-UNIMOD:21,44-UNIMOD:21	0.20	15.0	2	2	2
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.07	15.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	442-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	778-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	89-UNIMOD:21	0.14	15.0	1	1	1
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	350-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1697-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	966-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	388-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	275-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q13370|PDE3B_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase B OS=Homo sapiens OX=9606 GN=PDE3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	561-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	388-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	62-UNIMOD:21,67-UNIMOD:21,359-UNIMOD:21	0.07	15.0	2	2	2
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	151-UNIMOD:21	0.13	15.0	1	1	1
PRT	sp|Q03164|KMT2A_HUMAN	Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	3028-UNIMOD:21,3036-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q9NSI2|F207A_HUMAN	Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	34-UNIMOD:21,39-UNIMOD:21	0.11	15.0	1	1	1
PRT	sp|Q9NVD7|PARVA_HUMAN	Alpha-parvin OS=Homo sapiens OX=9606 GN=PARVA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,8-UNIMOD:21,14-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	140-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8WVM0|TFB1M_HUMAN	Dimethyladenosine transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TFB1M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	145-UNIMOD:21,147-UNIMOD:21,148-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1047-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	229-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	376-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	62-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	93-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9NS87|KIF15_HUMAN	Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1141-UNIMOD:21,1144-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.09	14.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	607-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q2M2I8|AAK1_HUMAN	AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	624-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	69-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P56385|ATP5I_HUMAN	ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	66-UNIMOD:21	0.16	14.0	1	1	1
PRT	sp|P48047|ATPO_HUMAN	ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	50-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	149-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	668-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9BUL5|PHF23_HUMAN	PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	126-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	263-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	11-UNIMOD:21	0.14	14.0	1	1	1
PRT	sp|Q5ST30|SYVM_HUMAN	Valine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=VARS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	105-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	216-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q6P996|PDXD1_HUMAN	Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	691-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q15004|PAF15_HUMAN	PCNA-associated factor OS=Homo sapiens OX=9606 GN=PCLAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	54-UNIMOD:4,58-UNIMOD:21	0.14	14.0	1	1	1
PRT	sp|Q6VN20|RBP10_HUMAN	Ran-binding protein 10 OS=Homo sapiens OX=9606 GN=RANBP10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	365-UNIMOD:21,369-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.13	14.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|Q14542|S29A2_HUMAN	Equilibrative nucleoside transporter 2 OS=Homo sapiens OX=9606 GN=SLC29A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	252-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	482-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	209-UNIMOD:21,219-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	307-UNIMOD:21,309-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	47-UNIMOD:21,52-UNIMOD:21	0.09	14.0	2	1	0
PRT	sp|P49116|NR2C2_HUMAN	Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	219-UNIMOD:21,224-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	146-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.09	14.0	2	2	2
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	283-UNIMOD:21,294-UNIMOD:21	0.04	14.0	2	2	2
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	11-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	155-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q9Y613|FHOD1_HUMAN	FH1/FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHOD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	498-UNIMOD:21,502-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	527-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	143-UNIMOD:4,147-UNIMOD:4,148-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	849-UNIMOD:4,856-UNIMOD:21,866-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|O75128|COBL_HUMAN	Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	439-UNIMOD:4,447-UNIMOD:21,455-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9BUW7|CI016_HUMAN	UPF0184 protein C9orf16 OS=Homo sapiens OX=9606 GN=C9orf16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	82-UNIMOD:21	0.20	14.0	1	1	1
PRT	sp|Q00587|BORG5_HUMAN	Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	106-UNIMOD:21,113-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q14914|PTGR1_HUMAN	Prostaglandin reductase 1 OS=Homo sapiens OX=9606 GN=PTGR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	88-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	268-UNIMOD:21	0.12	14.0	2	1	0
PRT	sp|Q6WKZ4|RFIP1_HUMAN	Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	197-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q96QD8|S38A2_HUMAN	Sodium-coupled neutral amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	22-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,16-UNIMOD:21	0.09	14.0	1	1	1
PRT	sp|O14910|LIN7A_HUMAN	Protein lin-7 homolog A OS=Homo sapiens OX=9606 GN=LIN7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	130-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	245-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q86WS4|CL040_HUMAN	Uncharacterized protein C12orf40 OS=Homo sapiens OX=9606 GN=C12orf40 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	471-UNIMOD:21,480-UNIMOD:21,481-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q96SB8|SMC6_HUMAN	Structural maintenance of chromosomes protein 6 OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	633-UNIMOD:4,638-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1062-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q8N8S7|ENAH_HUMAN	Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	482-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	82-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9ULL5|PRR12_HUMAN	Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	865-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	275-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	260-UNIMOD:35,264-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	233-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q96T23|RSF1_HUMAN	Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	604-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.14	13.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	153-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	303-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	157-UNIMOD:21,159-UNIMOD:4	0.03	13.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	61-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P60953|CDC42_HUMAN	Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	157-UNIMOD:4,158-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q6NVY1|HIBCH_HUMAN	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	356-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	305-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	366-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.09	13.0	1	1	1
PRT	sp|Q9UPQ9|TNR6B_HUMAN	Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	384-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O96019|ACL6A_HUMAN	Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	233-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q96D71|REPS1_HUMAN	RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	162-UNIMOD:21,174-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q96N66|MBOA7_HUMAN	Lysophospholipid acyltransferase 7 OS=Homo sapiens OX=9606 GN=MBOAT7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	280-UNIMOD:4,285-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	402-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	144-UNIMOD:21,150-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.07	13.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	19-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	628-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1492-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O75794|CD123_HUMAN	Cell division cycle protein 123 homolog OS=Homo sapiens OX=9606 GN=CDC123 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	289-UNIMOD:4,299-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	910-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9Y3D2|MSRB2_HUMAN	Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	90-UNIMOD:4,92-UNIMOD:4,93-UNIMOD:4,95-UNIMOD:21	0.11	13.0	1	1	1
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	176-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	76-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|Q96NT5|PCFT_HUMAN	Proton-coupled folate transporter OS=Homo sapiens OX=9606 GN=SLC46A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	458-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	441-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q4V326|GAG2E_HUMAN	G antigen 2E OS=Homo sapiens OX=9606 GN=GAGE2E PE=3 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	40-UNIMOD:21	0.32	13.0	1	1	1
PRT	sp|P41091|IF2G_HUMAN	Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens OX=9606 GN=EIF2S3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	105-UNIMOD:4,108-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	354-UNIMOD:21,363-UNIMOD:4	0.04	13.0	1	1	1
PRT	sp|Q16637|SMN_HUMAN	Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	31-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	61-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P53367|ARFP1_HUMAN	Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,5-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|Q9Y597|KCTD3_HUMAN	BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens OX=9606 GN=KCTD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	793-UNIMOD:21,795-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q9H078|CLPB_HUMAN	Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	663-UNIMOD:21,668-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	72-UNIMOD:21,77-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O43684|BUB3_HUMAN	Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	325-UNIMOD:21,327-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|Q3SYG4|PTHB1_HUMAN	Protein PTHB1 OS=Homo sapiens OX=9606 GN=BBS9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	136-UNIMOD:4	0.03	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	65.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3561.5	39.28467	3	2508.0757	2508.0760	M	R	2	32
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	2	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	61.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3361.6	34.15567	3	2994.261371	2994.261530	K	A	106	138
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	3	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	60.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3353.6	33.95352	3	2994.261371	2994.261530	K	A	106	138
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	4	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	56.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3570.4	39.50638	3	2508.0757	2508.0760	M	R	2	32
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	5	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	55.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3760.5	44.26507	4	3385.517694	3385.515651	K	A	399	429
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	6	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3674.5	42.03413	3	2988.150971	2988.155727	K	E	144	170
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	7	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3630.2	41.02688	3	2758.1462	2758.1503	M	D	2	33
PSM	LVQDVANNTNEEAGDGTTTATVLAR	8	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3395.5	35.03223	3	2639.204171	2639.207584	K	S	97	122
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	9	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3396.5	35.0582	5	4716.099118	4716.094806	K	A	530	573
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	10	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3486.4	37.33484	4	3265.402094	3265.402471	K	-	708	738
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	11	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	51.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4789.2	60.6476	4	3720.694494	3720.684901	K	G	621	655
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	12	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3095.3	27.25958	4	3445.416094	3445.417924	K	K	799	833
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	13	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	33.74152	3	2994.261371	2994.261530	K	A	106	138
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	14	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3264.4	31.6424	4	3093.276894	3093.277137	R	-	738	768
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	15	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	50.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3553.4	39.07409	3	2508.0757	2508.0760	M	R	2	32
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	16	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3272.5	31.85063	4	3093.276894	3093.277137	R	-	738	768
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	17	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	3-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3824.6	45.90525	4	3637.642094	3637.645482	R	V	592	630
PSM	AAAVAAAGAGEPQSPDELLPK	18	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4151.2	53.36332	3	2083.9823	2083.9822	M	G	2	23
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	19	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3565.3	39.37786	4	2508.0747	2508.0760	M	R	2	32
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	20	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3378.4	34.58983	4	2991.330094	2991.328110	R	V	221	251
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	21	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3278.4	31.99627	4	3704.513294	3704.512278	K	-	158	196
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	22	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3269.4	31.77218	4	3704.513294	3704.512278	K	-	158	196
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	23	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3769.6	44.4891	4	3385.517694	3385.515651	K	A	399	429
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	24	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4466.2	57.50955	3	2747.133371	2747.134344	K	D	208	233
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	25	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3337.6	33.53542	3	2994.261371	2994.261530	K	A	106	138
PSM	AAAVAAAGAGEPQSPDELLPK	26	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4143.3	53.15956	3	2083.9823	2083.9822	M	G	2	23
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	27	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3418.5	35.63462	4	2853.388894	2853.390968	K	K	62	95
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	28	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4300.2	55.4081	4	3681.644094	3681.639334	K	K	213	250
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	29	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	14-UNIMOD:21,17-UNIMOD:21,30-UNIMOD:21	ms_run[1]:scan=1.1.3872.2	47.07395	4	3773.752494	3773.758037	R	Q	125	162
PSM	AIVDALPPPCESACTVPTDVDK	30	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3681.5	42.21128	3	2434.076171	2434.079730	R	W	261	283
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	31	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3728.5	43.44067	3	3393.344171	3393.345713	K	F	86	114
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	32	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3307.6	32.75467	3	3722.189171	3722.195067	K	A	158	190
PSM	IADPEHDHTGFLTEYVATR	33	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3580.2	39.75887	4	2330.964894	2330.961009	R	W	190	209
PSM	APSEEDSLSSVPISPYKDEPWK	34	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3794.4	45.12562	3	2540.135771	2540.135982	K	Y	36	58
PSM	ILATPPQEDAPSVDIANIR	35	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3995.2	50.04748	3	2178.997571	2178.996332	K	M	284	303
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	36	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4940.2	61.86473	3	2620.055171	2620.055380	K	S	180	204
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	37	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3488.4	37.38397	4	3159.346494	3159.347523	R	G	2037	2066
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	38	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3926.3	48.44237	4	3536.408894	3536.408665	R	-	207	238
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	39	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3935.3	48.65755	4	3536.408894	3536.408665	R	-	207	238
PSM	IEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSR	40	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	8-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3865.2	46.89355	4	3778.610494	3778.613586	K	A	17	52
PSM	AAAVAAAGAGEPQSPDELLPK	41	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4166.2	53.56893	3	2083.9823	2083.9822	M	G	2	23
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	42	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3310.5	32.82847	4	3173.240494	3173.243468	R	-	738	768
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	43	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	9-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3131.6	28.18612	4	3492.324494	3492.326786	K	A	111	145
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	44	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3449.5	36.38123	4	3291.353294	3291.357615	R	S	1160	1192
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	45	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4415.2	56.99813	4	3537.372494	3537.370051	R	V	44	74
PSM	DATNVGDEGGFAPNILENK	46	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3761.3	44.28323	3	1959.916571	1959.917400	K	E	203	222
PSM	SGSSSPDSEITELKFPSINHD	47	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3917.2	48.19965	3	2325.998471	2326.000217	R	-	571	592
PSM	DNLTLWTSDTQGDEAEAGEGGEN	48	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3904.3	47.88643	3	2407.991171	2407.988786	R	-	223	246
PSM	AIVDALPPPCESACTVPTDVDK	49	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3689.2	42.41035	3	2434.076171	2434.079730	R	W	261	283
PSM	GGPGSAVSPYPTFNPSSDVAALHK	50	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3856.5	46.69947	3	2515.079771	2515.082187	K	A	30	54
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	51	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3903.3	47.86189	4	3465.488094	3465.481982	K	A	399	429
PSM	DDDIAALVVDNGSGMCK	52	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4566.2	58.40071	2	1901.7572	1900.7582	M	A	2	19
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	53	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3917.3	48.20965	3	2749.2295	2749.2301	-	Y	1	25
PSM	GYNHGQGSYSYSNSYNSPGGGGGSDYNYESK	54	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3203.5	30.04988	4	3332.262094	3332.259238	K	F	776	807
PSM	LVQDVANNTNEEAGDGTTTATVLAR	55	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.3362.6	34.1807	3	2559.243971	2559.241253	K	S	97	122
PSM	PAEKPAETPVATSPTATDSTSGDSSR	56	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2857.5	21.17353	3	2719.125371	2719.126296	K	S	148	174
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	57	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3369.6	34.3617	3	2994.261371	2994.261530	K	A	106	138
PSM	VPPAPVPCPPPSPGPSAVPSSPK	58	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3437.3	36.12268	4	2378.079694	2378.078288	K	S	366	389
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	59	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3478.6	37.13453	4	3265.402094	3265.402471	K	-	708	738
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	60	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:4,18-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4396.2	56.79617	4	3537.372494	3537.370051	R	V	44	74
PSM	LYGSAGPPPTGEEDTAEKDEL	61	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3453.6	36.48278	3	2254.949771	2254.951870	K	-	634	655
PSM	RADLNQGIGEPQSPSRR	62	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2906.3	22.41122	3	1959.928271	1959.927602	R	V	62	79
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	63	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3329.6	33.327	3	2994.261371	2994.261530	K	A	106	138
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	64	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.3305.6	32.70255	4	3722.194094	3722.195067	K	A	158	190
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	65	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.3315.6	32.96087	3	3722.189171	3722.195067	K	A	158	190
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	66	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3874.2	47.12555	4	3013.336494	3013.339266	K	V	8	36
PSM	SESETESEASEITIPPSTPAVPQAPVQGEDYGK	67	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3703.4	42.78797	4	3509.562894	3509.561066	R	G	530	563
PSM	SSSPAPADIAQTVQEDLR	68	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4089.2	52.13507	3	1963.891571	1963.888816	K	T	230	248
PSM	VPADTEVVCAPPTAYIDFAR	69	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4121.2	52.7073	3	2271.026171	2271.028287	K	Q	71	91
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	70	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4344.2	55.96685	3	2540.090771	2540.089049	K	S	180	204
PSM	MDSAGQDINLNSPNK	71	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3558.4	39.20383	2	1724.7058	1724.7072	-	G	1	16
PSM	TRVSDPISTSESSEEEEEAEAETAKATPR	72	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3293.6	32.38998	4	3215.398494	3215.399086	K	L	76	105
PSM	PAEKPAETPVATSPTATDSTSGDSSR	73	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2848.2	20.95278	3	2719.125371	2719.126296	K	S	148	174
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	74	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3410.4	35.42173	4	2853.388894	2853.390968	K	K	62	95
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	75	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3139.4	28.38637	5	3112.506118	3112.507789	R	S	847	876
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	76	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	2-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2821.6	20.30623	4	3178.164894	3178.161241	R	K	494	522
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	77	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3139.6	28.39303	4	3492.324494	3492.326786	K	A	111	145
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	78	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3388.6	34.8544	5	4716.099118	4716.094806	K	A	530	573
PSM	NVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVK	79	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0		ms_run[1]:scan=1.1.3345.6	33.74485	5	5277.7181	5277.7115	K	E	231	275
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	80	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3890.3	47.53443	4	3013.336494	3013.339266	K	V	8	36
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	81	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4289.2	55.20405	4	3681.644094	3681.639334	K	K	213	250
PSM	DATNVGDEGGFAPNILENK	82	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3760.2	44.25507	3	1959.916571	1959.917400	K	E	203	222
PSM	DTQSPSTCSEGLLGWSQK	83	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3858.2	46.73803	3	2059.855271	2059.855802	K	D	709	727
PSM	EGEEAGPGDPLLEAVPKTGDEK	84	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3567.4	39.43068	3	2317.035371	2317.036268	K	D	353	375
PSM	DYEIESQNPLASPTNTLLGSAK	85	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4172.2	53.65717	3	2427.120671	2427.120667	K	E	618	640
PSM	DSGSDEDFLMEDDDDSDYGSSK	86	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3502.5	37.7442	3	2443.858271	2443.860534	K	K	129	151
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	87	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4446.3	57.3058	3	2747.133371	2747.134344	K	D	208	233
PSM	DSSEESDSSEESDIDSEASSALFMAK	88	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4007.4	50.30328	3	2832.067271	2832.069221	K	K	340	366
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	89	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4812.2	60.85225	4	3720.694494	3720.684901	K	G	621	655
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	90	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4184.4	53.83152	4	3836.408894	3836.405155	K	A	469	503
PSM	DDDIAALVVDNGSGMCK	91	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4280.2	55.06618	2	1820.7915	1820.7915	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	92	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4583.2	58.60323	2	1900.7564	1900.7579	M	A	2	19
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	93	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3358.6	34.08062	3	2621.136671	2621.141158	K	I	50	74
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	94	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3561.4	39.28133	4	2833.352094	2833.352672	K	S	362	389
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	95	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	14-UNIMOD:21,21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3442.4	36.23418	4	3071.291694	3071.294441	R	V	221	251
PSM	SPAGLQVLNDYLADK	96	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4389.2	56.69123	2	1682.789047	1682.791668	K	S	8	23
PSM	VTNGAFTGEISPGMIK	97	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3781.4	44.78943	2	1700.780847	1700.784474	K	D	107	123
PSM	WLDDLLASPPPSGGGAR	98	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4692.2	59.63793	3	1867.792871	1867.790696	R	R	684	701
PSM	VQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVK	99	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3640.6	41.19665	4	3939.728894	3939.727022	K	D	2008	2043
PSM	LDNVPHTPSSYIETLPK	100	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	42.9609	3	1989.946571	1989.944874	R	A	45	62
PSM	SSSPAPADIAQTVQEDLR	101	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3807.3	45.46358	3	2043.855071	2043.855147	K	T	230	248
PSM	DNLTLWTSDMQGDGEEQNK	102	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3818.2	45.74949	3	2179.930871	2179.932792	R	E	226	245
PSM	ADLLLSTQPGREEGSPLELER	103	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3773.4	44.58097	3	2389.148171	2389.152635	K	L	593	614
PSM	DNLTLWTSDTQGDEAEAGEGGEN	104	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3896.5	47.69638	3	2407.991171	2407.988786	R	-	223	246
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	105	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3440.6	36.20475	3	3185.426171	3185.436140	K	-	708	738
PSM	APLATGEDDDDEVPDLVENFDEASKNEAN	106	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4613.2	58.8886	4	3198.314094	3198.303789	K	-	178	207
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	107	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3736.6	43.6479	3	3393.344171	3393.345713	K	F	86	114
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	108	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4051.3	51.27535	3	2829.1948	2829.1964	-	Y	1	25
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	109	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3118.6	27.84615	4	3365.448094	3365.451593	K	K	799	833
PSM	SQDATFSPGSEQAEKSPGPIVSR	110	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3217.3	30.40932	4	2454.107294	2454.106414	R	T	329	352
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	111	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3178.5	29.39837	4	2612.323294	2612.322435	R	Q	24	52
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	112	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3265.3	31.66532	5	3093.279618	3093.277137	R	-	738	768
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	113	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3283.6	32.1308	4	4445.550894	4445.553592	K	G	177	218
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	114	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	27-UNIMOD:21	ms_run[1]:scan=1.1.4341.2	55.91015	4	3274.358494	3274.357556	R	N	282	311
PSM	CIPALDSLTPANEDQK	115	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3585.2	39.89353	3	1850.811071	1850.812146	R	I	447	463
PSM	FSGWYDADLSPAGHEEAK	116	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3654.2	41.53572	3	2058.834371	2058.836052	R	R	22	40
PSM	TPEELDDSDFETEDFDVR	117	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3968.3	49.40248	3	2237.851571	2237.852550	R	S	634	652
PSM	VPPAPVPCPPPSPGPSAVPSSPK	118	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3447.4	36.32962	3	2378.071571	2378.078288	K	S	366	389
PSM	DYEIESQNPLASPTNTLLGSAK	119	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4186.2	53.87203	3	2427.120671	2427.120667	K	E	618	640
PSM	NALFPEVFSPTPDENSDQNSR	120	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4254.2	54.70257	3	2443.035671	2443.032914	R	S	567	588
PSM	DNLTLWTSDSAGEECDAAEGAEN	121	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3937.2	48.69903	3	2453.974271	2453.976507	R	-	223	246
PSM	VSTTTDSPVSPAQAASPFIPLDELSSK	122	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4698.2	59.75051	3	2904.310571	2904.308283	K	-	261	288
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	123	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3666.6	41.83703	3	2988.150971	2988.155727	K	E	144	170
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	124	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3479.6	37.16088	4	3459.427694	3459.429735	K	L	104	135
PSM	SCDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPK	125	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	2-UNIMOD:4,8-UNIMOD:4,11-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3915.6	48.15785	4	4014.598894	4014.596619	K	N	240	277
PSM	AAAVAAAGAGEPQSPDELLPK	126	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4182.2	53.7803	3	2083.9823	2083.9822	M	G	2	23
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPK	127	sp|Q9H2V7|SPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=1.1.4227.2	54.44247	3	3356.4737	3356.4717	M	S	2	36
PSM	VPSPLEGSEGDGDTD	128	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3312.4	32.87637	2	1553.575247	1553.577043	K	-	413	428
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	129	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3343.6	33.69218	4	4118.430894	4118.435708	K	A	142	177
PSM	EFQDAGEQVVSSPADVAEK	130	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3395.3	35.02557	3	2084.891771	2084.893961	K	A	77	96
PSM	LVQDVANNTNEEAGDGTTTATVLAR	131	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3387.6	34.82862	3	2639.204171	2639.207584	K	S	97	122
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	132	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	2-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3168.6	29.14073	4	3088.154894	3088.156036	R	A	10	40
PSM	ATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	133	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3207.5	30.15438	4	3668.405294	3668.406493	K	G	291	325
PSM	LHSAEQDADDEAADDTDDTSSVTSSASSTTSSQSGSGTSR	134	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3040.6	25.86013	4	4042.578894	4042.579248	R	K	473	513
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	135	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3203.6	30.05322	4	4245.542894	4245.543285	K	S	158	195
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	136	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3275.6	31.92818	4	4445.550894	4445.553592	K	G	177	218
PSM	AQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSR	137	sp|Q9NRR5|UBQL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3183.6	29.53188	4	4489.958894	4489.963063	K	R	88	137
PSM	EAAGGNDSSGATSPINPAVALE	138	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3797.5	45.20077	3	2106.913571	2106.910674	K	-	1236	1258
PSM	DMESPTKLDVTLAK	139	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3516.2	38.1003	3	1626.757871	1626.757591	K	D	277	291
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	140	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3816.4	45.69792	4	3637.642094	3637.645482	R	V	592	630
PSM	AAPEASSPPASPLQHLLPGK	141	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3845.2	46.41335	3	2126.976671	2126.980288	K	A	686	706
PSM	IADPEHDHTGFLTEYVATR	142	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3589.4	39.98325	3	2330.958971	2330.961009	R	W	190	209
PSM	DNLTLWTSDTQGDEAEAGEGGEN	143	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3913.3	48.09973	3	2407.991171	2407.988786	R	-	223	246
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	144	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3739.6	43.7246	3	3014.183171	3014.188484	K	-	661	690
PSM	DKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	145	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	32-UNIMOD:21	ms_run[1]:scan=1.1.3778.5	44.71023	5	4555.938118	4555.941265	K	R	720	764
PSM	EEEIAALVIDNGSGMCK	146	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5481.2	65.64118	2	1956.8214	1956.8205	M	A	2	19
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	147	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3900.6	47.79845	3	2749.2295	2749.2301	-	Y	1	25
PSM	SASYKYSEEANNLIEECEQAER	148	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3773.3	44.57763	4	2699.106094	2699.105821	K	L	115	137
PSM	SVSTPSEAGSQDSGDGAVGSR	149	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2862.2	21.301	3	2029.824371	2029.822587	K	T	92	113
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	150	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3308.3	32.77073	4	2717.305694	2717.307830	R	R	31	56
PSM	IACKSPPPESVDTPTSTK	151	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2866.2	21.39898	3	2073.870071	2073.873106	K	Q	1127	1145
PSM	GGNFGGRSSGPYGGGGQYFAK	152	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3333.4	33.42488	3	2099.884871	2099.885068	K	P	278	299
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	153	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3435.6	36.08285	4	3185.431294	3185.436140	K	-	708	738
PSM	CAPSAGSPAAAVGRESPGAAATSSSGPQAQQHR	154	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:4,7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3019.5	25.3125	4	3278.394094	3278.392533	R	G	54	87
PSM	GEPAAAAAPEAGASPVEK	155	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2944.4	23.36387	3	1701.760271	1701.761096	K	E	88	106
PSM	GEPAAAAAPEAGASPVEK	156	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2952.3	23.56768	3	1701.760271	1701.761096	K	E	88	106
PSM	LGAGGGSPEKSPSAQELK	157	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2924.5	22.84945	3	1791.842171	1791.840409	R	E	13	31
PSM	NIGRDTPTSAGPNSFNK	158	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3068.4	26.56398	3	1934.789771	1934.792487	K	G	134	151
PSM	GSLAEAVGSPPPAATPTPTPPTR	159	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3422.4	35.73594	3	2331.051371	2331.054910	R	K	446	469
PSM	VPPAPVPCPPPSPGPSAVPSSPK	160	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3456.2	36.54675	4	2378.077694	2378.078288	K	S	366	389
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	161	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4318.3	55.61047	4	3681.644094	3681.639334	K	K	213	250
PSM	DNLTLWTSDMQGDGEEQNK	162	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3826.3	45.94755	3	2179.930871	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	163	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3848.3	46.49252	3	2192.871071	2192.873028	R	-	228	248
PSM	VPADTEVVCAPPTAYIDFAR	164	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4109.2	52.4926	3	2271.026171	2271.028287	K	Q	71	91
PSM	GFGDLKSPAGLQVLNDYLADK	165	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4702.2	59.81245	3	2300.1122	2300.1085	M	S	2	23
PSM	ELSNSPLRENSFGSPLEFR	166	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3997.3	50.0991	3	2338.006271	2338.003208	K	N	1316	1335
PSM	DNLTLWTSENQGDEGDAGEGEN	167	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3834.4	46.15463	3	2349.947171	2349.946922	R	-	225	247
PSM	AIVDALPPPCESACTVPTDVDK	168	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3697.5	42.62815	3	2434.076171	2434.079730	R	W	261	283
PSM	DYEIESQNPLASPTNTLLGSAK	169	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4349.3	56.05737	3	2507.085071	2507.086998	K	E	618	640
PSM	ASYHFSPEELDENTSPLLGDAR	170	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3860.4	46.8027	3	2527.088471	2527.090429	K	F	262	284
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	171	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3665.5	41.80877	3	2573.997071	2573.998594	R	G	239	267
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	172	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3494.6	37.54043	4	3562.491294	3562.491898	K	V	60	92
PSM	EEEIAALVIDNGSGMCK	173	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4979.2	62.2219	2	1972.8155	1972.8154	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	174	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4549.2	58.17727	2	1900.7564	1900.7579	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	175	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4606.2	58.80613	2	1900.7564	1900.7579	M	A	2	19
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	176	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3616.5	40.68915	3	2588.0399	2588.0424	M	R	2	32
PSM	AESSESFTMASSPAQR	177	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3477.5	37.1051	2	1806.7107	1806.7126	M	R	2	18
PSM	SSIGTGYDLSASTFSPDGR	178	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.4049.2	51.22357	3	2038.8530	2038.8516	M	V	2	21
PSM	AAEEAFVNDIDESSPGTEWER	179	sp|P09496-2|CLCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3906.6	47.94572	2	2430.983447	2430.985295	R	V	163	184
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	180	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3729.4	43.46038	3	2882.1610	2882.1618	M	D	2	29
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	181	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3256.4	31.43312	4	3093.276894	3093.277137	R	-	738	768
PSM	VPSPLEGSEGDGDTD	182	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3304.5	32.67322	2	1553.575247	1553.577043	K	-	413	428
PSM	ADLNQGIGEPQSPSRR	183	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2987.6	24.48508	3	1803.830171	1803.826490	R	V	63	79
PSM	SAESPTSPVTSETGSTFK	184	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3276.2	31.9397	3	1891.807871	1891.808834	K	K	280	298
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	185	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3335.6	33.48372	4	4117.450894	4117.448322	K	K	158	194
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	186	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	34-UNIMOD:35	ms_run[1]:scan=1.1.3138.6	28.36737	4	4134.430894	4134.430623	K	A	142	177
PSM	QEEEAAQQGPVVVSPASDYK	187	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3260.5	31.54087	3	2210.969771	2210.973274	R	D	145	165
PSM	VPPAPVPCPPPSPGPSAVPSSPK	188	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3429.3	35.91643	3	2378.071571	2378.078288	K	S	366	389
PSM	NCQTVLAPCSPNPCENAAVCK	189	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3305.5	32.69921	3	2468.991071	2468.994638	K	E	829	850
PSM	PAEKPAETPVATSPTATDSTSGDSSR	190	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2898.6	22.21757	3	2639.158871	2639.159965	K	S	148	174
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	191	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3167.5	29.11103	3	2779.092971	2779.094999	K	M	571	596
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	192	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3269.2	31.76552	5	3093.279618	3093.277137	R	-	738	768
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	193	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3849.3	46.51682	4	2881.096094	2881.094982	K	T	701	725
PSM	ILATPPQEDAPSVDIANIR	194	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3985.3	49.84313	3	2178.997571	2178.996332	K	M	284	303
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	195	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3821.4	45.8211	4	2963.274494	2963.274343	R	T	88	114
PSM	GALQNIIPASTGAAK	196	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3549.5	38.97278	2	1490.749647	1490.749409	R	A	201	216
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	197	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3558.2	39.19717	4	2989.541294	2989.541321	K	G	202	228
PSM	TPSSDVLVFDYTK	198	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3934.2	48.61833	2	1550.688847	1550.690557	K	H	144	157
PSM	TPSSDVLVFDYTK	199	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3943.3	48.84552	2	1550.688847	1550.690557	K	H	144	157
PSM	VLLPEYGGTKVVLDDK	200	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3669.4	41.90597	3	1824.926771	1824.927433	K	D	71	87
PSM	CIPALDSLTPANEDQK	201	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	40.31195	3	1850.811071	1850.812146	R	I	447	463
PSM	IADPEHDHTGFLTEYVATR	202	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3477.2	37.0951	4	2250.992894	2250.994678	R	W	190	209
PSM	SGEEDFESLASQFSDCSSAK	203	sp|Q13526|PIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	16-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.4150.2	53.33812	3	2259.850571	2259.851504	K	A	98	118
PSM	AIVDALPPPCESACTVPTDVDK	204	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3672.5	41.98447	3	2434.076171	2434.079730	R	W	261	283
PSM	NALFPEVFSPTPDENSDQNSR	205	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4229.2	54.49306	3	2443.035671	2443.032914	R	S	567	588
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	206	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3762.4	44.3112	5	3385.515618	3385.515651	K	A	399	429
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	207	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3881.4	47.30136	4	3456.443694	3456.442334	R	-	207	238
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	208	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3973.4	49.53228	4	3756.441694	3756.438824	K	A	469	503
PSM	ADEAGKDKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	209	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	36-UNIMOD:21	ms_run[1]:scan=1.1.3659.6	41.65818	5	5127.2041	5127.2009	K	R	714	764
PSM	ADLSLADALTEPSPDIEGEIKR	210	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4573.2	58.52008	3	2461.1662	2461.1620	M	D	2	24
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	211	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3578.6	39.72193	3	2508.0757	2508.0760	M	R	2	32
PSM	AESSESFTMASSPAQR	212	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3485.4	37.31045	2	1806.7107	1806.7126	M	R	2	18
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	213	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3653.4	41.50483	3	2765.2240	2765.2250	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	214	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3909.6	48.0029	3	2749.2295	2749.2301	-	Y	1	25
PSM	SHSGVSENDSRPASPSAESDHESER	215	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2657.2	17.66757	4	2733.087294	2733.089988	R	G	1112	1137
PSM	VAAETQSPSLFGSTK	216	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3352.5	33.92417	2	1601.728447	1601.733819	K	L	215	230
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	217	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3179.6	29.42783	5	4165.734118	4165.736558	K	D	522	558
PSM	RADLNQGIGEPQSPSR	218	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2979.5	24.27398	3	1803.826571	1803.826490	R	R	62	78
PSM	SGKYDLDFKSPDDPSR	219	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3238.2	30.95682	4	1905.810494	1905.814588	R	Y	254	270
PSM	SAESPTSPVTSETGSTFKK	220	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3282.5	32.10207	3	2099.867771	2099.870128	K	F	280	299
PSM	AQTPPGPSLSGSKSPCPQEK	221	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2998.5	24.76853	3	2211.925271	2211.927266	K	S	1001	1021
PSM	SPEKLPQSSSSESSPPSPQPTK	222	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2877.5	21.67665	3	2361.074171	2361.073716	K	V	408	430
PSM	NGSLDSPGKQDTEEDEEEDEK	223	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2870.6	21.49837	3	2429.922971	2429.923149	K	D	134	155
PSM	IVRGDQPAASGDSDDDEPPPLPR	224	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3195.6	29.84458	3	2483.096471	2483.096577	K	L	45	68
PSM	PAEKPAETPVATSPTATDSTSGDSSR	225	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2890.6	22.01132	3	2639.158871	2639.159965	K	S	148	174
PSM	NGSLDSPGKQDTEEDEEEDEKDK	226	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2833.5	20.59197	3	2673.043871	2673.045055	K	G	134	157
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	227	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2817.3	20.20315	5	3104.327618	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	228	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2819.4	20.25115	4	3104.323294	3104.322430	K	S	145	174
PSM	TDRVGVEASEETPQTSSSSARPGTPSDHQSQEASQFER	229	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3105.3	27.49857	5	4154.801118	4154.805047	K	K	359	397
PSM	VPPAPVPCPPPSPGPSAVPSSPK	230	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3447.2	36.32295	4	2378.079694	2378.078288	K	S	366	389
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	231	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3722.4	43.27773	4	2835.277694	2835.274618	R	T	350	376
PSM	MVIQGPSSPQGEAMVTDVLEDQK	232	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4183.2	53.80633	3	2538.136271	2538.138307	K	E	1107	1130
PSM	CIPALDSLTPANEDQK	233	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3594.2	40.1026	3	1850.811071	1850.812146	R	I	447	463
PSM	NQYDNDVTVWSPQGR	234	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3550.3	38.99237	3	1857.767471	1857.768307	R	I	4	19
PSM	AEELSPAALSPSLEPIR	235	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4006.3	50.27692	3	1938.877871	1938.874092	R	C	441	458
PSM	SSSPAPADIAQTVQEDLR	236	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4081.2	51.92458	3	1963.891571	1963.888816	K	T	230	248
PSM	VAPEEHPVLLTEAPLNPK	237	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3587.3	39.93503	3	2033.021471	2033.023459	R	A	96	114
PSM	FSGWYDADLSPAGHEEAK	238	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3663.3	41.75146	3	2058.834371	2058.836052	R	R	22	40
PSM	DGYADIVDVLNSPLEGPDQK	239	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4749.2	60.2808	3	2223.995771	2223.993675	K	S	287	307
PSM	LYGSAGPPPTGEEDTAEKDEL	240	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3461.3	36.68108	3	2254.949771	2254.951870	K	-	634	655
PSM	QQPPEPEWIGDGESTSPSDK	241	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3534.5	38.57965	3	2262.930371	2262.931803	K	V	7	27
PSM	VPADTEVVCAPPTAYIDFAR	242	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4134.2	52.92977	3	2271.026171	2271.028287	K	Q	71	91
PSM	AIVDALPPPCESACTVPTDVDK	243	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3705.5	42.8375	3	2434.076171	2434.079730	R	W	261	283
PSM	ERIQQFDDGGSDEEDIWEEK	244	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3708.6	42.91879	3	2503.998071	2504.001674	K	H	607	627
PSM	DYEIESQNPLASPTNTLLGSAK	245	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4336.2	55.83815	3	2507.085071	2507.086998	K	E	618	640
PSM	FNEEHIPDSPFVVPVASPSGDAR	246	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3934.3	48.625	3	2626.113371	2626.114215	K	R	2311	2334
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	247	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3447.6	36.33628	3	3291.353171	3291.357615	R	S	1160	1192
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	248	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3485.3	37.30712	4	3562.491294	3562.491898	K	V	60	92
PSM	DSSKGEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	249	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	32-UNIMOD:21	ms_run[1]:scan=1.1.3778.4	44.7069	5	4535.112618	4535.111625	R	Q	475	520
PSM	AESSESFTMASSPAQR	250	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3221.5	30.52057	2	1822.7054	1822.7076	M	R	2	18
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	251	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3742.4	43.8011	3	2845.1905	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	252	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4030.3	50.83663	3	2829.1936	2829.1964	-	Y	1	25
PSM	MTEWETAAPAVAETPDIK	253	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4378.2	56.5314	3	2080.9054	2080.9059	-	L	1	19
PSM	NSVERPAEPVAGAATPSLVEQQK	254	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3258.3	31.48193	3	2458.179071	2457.190084	R	M	1455	1478
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	255	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3300.2	32.55902	4	2717.305694	2717.307830	R	R	31	56
PSM	DMESPTKLDVTLAK	256	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	33.57448	3	1642.753871	1642.752506	K	D	277	291
PSM	SETSVANGSQSESSVSTPSASFEPNNTCENSQSR	257	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3248.6	31.23117	4	3641.467294	3641.469702	K	N	117	151
PSM	IRYESLTDPSKLDSGK	258	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3287.5	32.23103	3	1887.900071	1887.897924	K	E	54	70
PSM	IRYESLTDPSKLDSGK	259	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3279.3	32.01817	3	1887.900071	1887.897924	K	E	54	70
PSM	DSENLASPSEYPENGER	260	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3220.6	30.49798	3	1972.765571	1972.768760	R	F	617	634
PSM	NQKPSQVNGAPGSPTEPAGQK	261	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2764.2	19.03645	3	2170.997471	2171.000826	K	Q	1255	1276
PSM	ETESAPGSPRAVTPVPTKTEEVSNLK	262	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	30.19998	4	2883.328894	2883.330416	K	T	514	540
PSM	EAAGGNDSSGATSPINPAVALE	263	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3805.4	45.40507	3	2106.913571	2106.910674	K	-	1236	1258
PSM	SLVSVTKEGLELPEDEEEK	264	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3884.2	47.37262	3	2210.024171	2210.024307	K	K	405	424
PSM	GALQNIIPASTGAAK	265	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3557.4	39.17795	2	1490.749647	1490.749409	R	A	201	216
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	266	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3566.4	39.40574	4	2989.543694	2989.541321	K	G	202	228
PSM	MLAESDESGDEESVSQTDKTELQNTLR	267	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3604.5	40.37423	4	3187.276494	3187.278911	K	T	186	213
PSM	VTNGAFTGEISPGMIK	268	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3780.2	44.75112	3	1700.782271	1700.784474	K	D	107	123
PSM	NQLTSNPENTVFDAK	269	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3547.2	38.91045	3	1756.769471	1756.766910	K	R	82	97
PSM	ASLGSLEGEAEAEASSPK	270	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3628.5	40.99753	2	1811.784447	1811.782620	K	G	5748	5766
PSM	WLDDLLASPPPSGGGAR	271	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4672.2	59.43437	3	1867.792871	1867.790696	R	R	684	701
PSM	KTDPSSLGATSASFNFGK	272	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3478.2	37.1212	3	1893.849971	1893.850974	K	K	258	276
PSM	DRSSFYVNGLTLGGQK	273	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3823.2	45.87985	3	1900.810271	1900.812160	K	C	55	71
PSM	DNLTLWTSDQQDDDGGEGNN	274	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3857.3	46.72512	3	2192.868971	2192.873028	R	-	228	248
PSM	DGYADIVDVLNSPLEGPDQK	275	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4771.2	60.49542	3	2223.995771	2223.993675	K	S	287	307
PSM	GFFICDQPYEPVSPYSCK	276	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4055.3	51.35385	3	2272.920071	2272.921045	R	E	676	694
PSM	DLYANTVLSGGTTMYPGIADR	277	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4166.3	53.57893	3	2294.030471	2294.029015	K	M	292	313
PSM	SQEGESVTEDISFLESPNPENK	278	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4025.4	50.71413	3	2515.061471	2515.063940	K	D	81	103
PSM	DGAVNGPSVVGDQTPIEPQTSIER	279	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3545.6	38.87117	3	2545.167371	2545.169742	K	L	377	401
PSM	DNLTLWTADNAGEEGGEAPQEPQS	280	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4145.2	53.21045	3	2608.058171	2608.060251	R	-	225	249
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	281	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.5272.2	64.28918	4	2952.333694	2952.330281	R	S	59	86
PSM	EEEIAALVIDNGSGMCK	282	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4956.2	62.02207	3	1972.8176	1972.8154	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	283	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4209.2	54.18843	3	1916.7533	1916.7528	M	A	2	19
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	284	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3336.6	33.50958	4	2898.289694	2898.290225	K	L	281	308
PSM	VTAEADSSSPTGILATSESK	285	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3384.3	34.74212	3	2030.907671	2029.909277	K	S	486	506
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	286	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4040.2	51.0541	3	2829.1948	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	287	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4069.2	51.694	3	2829.1930	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	288	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3651.3	41.4565	4	2765.2220	2765.2250	-	Y	1	25
PSM	AQETNQTPGPMLCSTGCGFYGNPR	289	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,7-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3898.6	47.74782	3	2764.1081	2764.1076	M	T	2	26
PSM	MTEWETAAPAVAETPDIK	290	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3923.5	48.36492	3	2096.9047	2096.9008	-	L	1	19
PSM	AAAVAAAGAGEPQSPDELLPK	291	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4135.6	52.9554	3	2083.9823	2083.9822	M	G	2	23
PSM	TPAAAAAMNLASPR	292	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3327.4	33.26807	2	1420.649847	1420.653400	R	T	2261	2275
PSM	SSGPYGGGGQYFAK	293	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3306.5	32.72535	2	1454.582647	1454.586761	R	P	285	299
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	294	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3333.6	33.43155	4	2957.326094	2957.325316	K	E	117	144
PSM	SGSSSPDSEITELK	295	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3335.5	33.48038	2	1515.631847	1515.634164	R	F	571	585
PSM	TPKTPKGPSSVEDIK	296	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2930.2	22.99453	3	1662.820571	1662.822968	K	A	234	249
PSM	AAGSPSSSDQDEKLPGQDESTAGTSEQNDILK	297	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3361.5	34.15233	4	3341.440094	3341.442014	K	V	184	216
PSM	PENVAPRSGATAGAAGGR	298	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2731.2	18.54967	3	1717.7888	1717.7892	M	G	2	20
PSM	TPSPKEEDEEPESPPEK	299	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2831.5	20.53782	3	2003.824871	2003.824878	K	K	202	219
PSM	TPSPKEEDEEPESPPEK	300	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2822.5	20.33098	3	2003.824871	2003.824878	K	K	202	219
PSM	DYEEVGADSADGEDEGEEY	301	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3429.6	35.92643	2	2077.735447	2077.739614	K	-	431	450
PSM	YRDVAECGPQQELDLNSPR	302	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3385.6	34.7779	3	2326.002671	2326.004926	K	N	102	121
PSM	SVSVDSGEQREAGTPSLDSEAK	303	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3053.4	26.18878	3	2328.003371	2328.011844	R	E	116	138
PSM	RSEACPCQPDSGSPLPAEEEK	304	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2983.5	24.3809	3	2422.974071	2422.977056	R	R	492	513
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	305	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.2660.2	17.70392	3	2627.076071	2627.080669	K	L	460	485
PSM	PAEKPAETPVATSPTATDSTSGDSSR	306	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2850.2	20.98808	4	2719.130894	2719.126296	K	S	148	174
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	307	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3236.6	30.91757	3	2742.060971	2742.064016	R	E	424	448
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	308	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2852.3	21.04005	4	3024.361694	3024.356099	K	S	145	174
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	309	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,24-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=1.1.3344.6	33.71865	3	3120.086171	3120.091253	R	E	92	118
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	310	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3373.5	34.46295	4	3223.229294	3223.230486	K	-	122	148
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	311	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3381.4	34.66705	4	3223.229294	3223.230486	K	-	122	148
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	312	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3316.6	32.98675	4	3722.194094	3722.195067	K	A	158	190
PSM	ADSGPTQPPLSLSPAPETK	313	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3442.3	36.22752	3	1971.915971	1971.919054	R	R	2071	2090
PSM	IFVGGLSPDTPEEK	314	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3717.5	43.15339	2	1647.681847	1647.683437	K	I	184	198
PSM	DISSDAFTALDPLGDK	315	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4589.2	58.67932	2	1743.758447	1743.760428	K	E	631	647
PSM	VTNGAFTGEISPGMIK	316	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3888.5	47.48628	2	1780.747247	1780.750805	K	D	107	123
PSM	WLDDLLASPPPSGGGAR	317	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4703.2	59.83832	3	1867.792871	1867.790696	R	R	684	701
PSM	WLDDLLASPPPSGGGAR	318	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4727.2	60.04844	3	1867.792871	1867.790696	R	R	684	701
PSM	NASTFEDVTQVSSAYQK	319	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3542.6	38.79239	2	1953.834047	1953.835718	K	T	320	337
PSM	VWGSPGGEGTGDLDEFDF	320	sp|Q13438|OS9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.5952.2	68.90245	2	1963.753647	1963.751319	R	-	650	668
PSM	GRLTPSPDIIVLSDNEASSPR	321	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3837.3	46.22441	3	2383.079771	2383.082187	R	S	117	138
PSM	DAEAHPWLSDYDDLTSATYDK	322	sp|P50542|PEX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4003.5	50.21785	3	2492.004671	2492.005696	R	G	302	323
PSM	SSSSESEDEDVIPATQCLTPGIR	323	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3690.5	42.44577	3	2557.083971	2557.089109	R	T	996	1019
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	324	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3822.5	45.8509	3	2644.234571	2644.238156	R	L	55	81
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	325	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4351.2	56.10758	3	2754.234371	2754.234331	R	Y	147	174
PSM	ERPTPSLNNNCTTSEDSLVLYNR	326	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3525.6	38.3464	3	2759.219771	2759.222189	K	V	734	757
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	327	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.4050.5	51.2495	3	2763.132071	2763.129259	K	D	208	233
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	328	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3557.3	39.17462	5	2989.545618	2989.541321	K	G	202	228
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	329	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3603.4	40.34435	4	3199.394894	3199.394275	K	N	213	241
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	330	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4381.4	56.58748	3	3537.374171	3537.370051	R	V	44	74
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	331	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21,29-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3911.3	48.04757	4	3717.615294	3717.611813	R	V	592	630
PSM	QSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN	332	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4185.2	53.85686	4	3812.605694	3812.606179	K	-	172	207
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	333	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3706.6	42.86654	4	3442.3960	3442.4027	K	L	104	135
PSM	ASGVAVSDGVIK	334	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3570.2	39.49972	2	1223.5776	1223.5794	M	V	2	14
PSM	MDSAGQDINLNSPNK	335	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3247.2	31.19163	3	1740.6992	1740.7021	-	G	1	16
PSM	MDSAGQDINLNSPNK	336	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3550.6	39.00237	2	1724.7058	1724.7072	-	G	1	16
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	337	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3921.3	48.30665	4	2749.2308	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	338	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3925.4	48.41635	3	2749.2295	2749.2301	-	Y	1	25
PSM	KYEQGFITDPVVLSPK	339	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3721.3	43.248	3	1901.945171	1899.938332	K	D	109	125
PSM	ADSGTAGGAALAAPAPGPGSGGPGPR	340	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3417.4	35.6047	3	2238.0037	2238.0061	M	V	2	28
PSM	DKGDEEEEGEEKLEEK	341	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2907.2	22.4322	3	1891.818071	1891.817077	K	Q	536	552
PSM	GKEDEGEEAASPMLQIQR	342	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3305.4	32.69588	3	2066.895071	2066.898001	K	D	2400	2418
PSM	DGLNQTTIPVSPPSTTKPSR	343	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	33.9175	3	2175.053171	2175.057278	K	A	573	593
PSM	KAEGAATEEEGTPKESEPQAAAEPAEAK	344	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2860.5	21.24995	4	2905.290894	2905.286622	K	E	25	53
PSM	GQAAVQQLQAEGLSPR	345	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3365.3	34.24658	3	1731.826571	1731.830513	R	F	43	59
PSM	TPKTPKGPSSVEDIK	346	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2993.5	24.6399	3	1742.790071	1742.789299	K	A	234	249
PSM	MDATANDVPSPYEVR	347	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3378.6	34.5965	2	1743.711847	1743.717517	K	G	434	449
PSM	MDATANDVPSPYEVR	348	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3274.5	31.90015	2	1759.710247	1759.712432	K	G	434	449
PSM	ADLNQGIGEPQSPSRR	349	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2995.6	24.69112	3	1803.830171	1803.826490	R	V	63	79
PSM	TSSVSNPQDSVGSPCSR	350	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2891.3	22.03705	3	1843.740971	1843.740772	K	V	94	111
PSM	DLEAEHVEVEDTTLNR	351	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3351.3	33.89137	3	1868.869571	1868.875201	R	C	15	31
PSM	LENVSQLSLDKSPTEK	352	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3307.3	32.74467	3	1866.891971	1866.897590	K	S	126	142
PSM	DNEESEQPPVPGTPTLR	353	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3319.4	33.0591	3	1944.845771	1944.846617	K	N	634	651
PSM	VKLESPTVSTLTPSSPGK	354	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3386.4	34.79682	3	1986.926471	1986.931606	R	L	290	308
PSM	GHTDTEGRPPSPPPTSTPEK	355	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2780.2	19.37995	4	2246.928494	2246.924624	R	C	353	373
PSM	KRDHANYEEDENGDITPIK	356	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2963.5	23.85818	4	2323.010894	2323.011785	R	A	132	151
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	357	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3299.6	32.54645	3	3722.189171	3722.195067	K	A	158	190
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	358	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3180.6	29.4539	4	4165.734894	4165.736558	K	D	522	558
PSM	VLLPEYGGTKVVLDDK	359	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3678.3	42.12718	3	1824.926771	1824.927433	K	D	71	87
PSM	SAESPTSPVTSETGSTFK	360	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3479.3	37.15088	3	1971.774971	1971.775165	K	K	280	298
PSM	TAHNSEADLEESFNEHELEPSSPK	361	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3494.3	37.53043	4	2776.155294	2776.150129	K	S	134	158
PSM	TVIIEQSWGSPK	362	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3562.5	39.31021	2	1423.672647	1423.674847	R	V	61	73
PSM	LGGSAVISLEGKPL	363	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4119.2	52.64623	2	1499.701247	1499.703779	K	-	153	167
PSM	MLAESDESGDEESVSQTDKTELQNTLR	364	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3494.4	37.53377	4	3107.316494	3107.312580	K	T	186	213
PSM	SACGNCYLGDAFR	365	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3665.4	41.80544	2	1569.569847	1569.574164	K	C	272	285
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	366	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3752.5	44.05867	4	3385.517694	3385.515651	K	A	399	429
PSM	EVAATEEDVTRLPSPTSPFSSLSQDQAATSK	367	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3974.4	49.55815	4	3408.504894	3408.501123	K	A	975	1006
PSM	DASDDLDDLNFFNQK	368	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4287.2	55.15248	3	1755.758171	1755.758774	K	K	65	80
PSM	SESVPPVTDWAWYK	369	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4567.2	58.42587	3	1823.720471	1823.720885	K	I	244	258
PSM	AEELSPAALSPSLEPIR	370	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3996.2	50.07333	3	1938.877871	1938.874092	R	C	441	458
PSM	LDGLVETPTGYIESLPR	371	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4446.2	57.2958	3	1938.934271	1938.933975	R	V	56	73
PSM	DALGDSLQVPVSPSSTTSSR	372	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3656.2	41.5708	3	2082.945671	2082.947059	R	C	141	161
PSM	DALGDSLQVPVSPSSTTSSR	373	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3647.3	41.36008	3	2082.945671	2082.947059	R	C	141	161
PSM	DRYMSPMEAQEFGILDK	374	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3949.3	48.97608	3	2108.894171	2108.894829	R	V	227	244
PSM	SGSTSISAPTGPSSPLPAPETPTAPAAESAPNGLSTVSHDYLK	375	sp|O15357|SHIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3895.4	47.67058	4	4306.962894	4306.955990	R	G	145	188
PSM	DNLTLWTSDQQDDDGGEGNN	376	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3867.3	46.93502	3	2192.868971	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	377	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3839.3	46.27573	3	2192.871071	2192.873028	R	-	228	248
PSM	IADPEHDHTGFLTEYVATR	378	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3469.5	36.8949	3	2250.992771	2250.994678	R	W	190	209
PSM	DTPENNPDTPFDFTPENYK	379	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3901.3	47.81295	3	2319.923171	2319.920904	R	R	43	62
PSM	VEEQEPELTSTPNFVVEVIK	380	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4321.2	55.66453	3	2366.125571	2366.129440	K	N	155	175
PSM	DSGSDEDFLMEDDDDSDYGSSK	381	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3682.5	42.23746	3	2427.862271	2427.865619	K	K	129	151
PSM	EGPYSISVLYGDEEVPRSPFK	382	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4012.2	50.43292	3	2448.126371	2448.125024	R	V	1516	1537
PSM	IAQLEEELEEEQGNTELINDR	383	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3866.3	46.90956	3	2471.161571	2471.166357	R	L	1731	1752
PSM	DNLTLWTADNAGEEGGEAPQEPQS	384	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3910.5	48.02532	3	2528.094671	2528.093920	R	-	225	249
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	385	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4106.4	52.44596	3	2540.088071	2540.089049	K	S	180	204
PSM	DNLTLWTADNAGEEGGEAPQEPQS	386	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4137.2	53.00667	3	2608.058171	2608.060251	R	-	225	249
PSM	SQSSEGVSSLSSSPSNSLETQSQSLSR	387	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3480.4	37.18032	3	2835.240371	2835.240735	R	S	76	103
PSM	QREEYQPATPGLGMFVEVKDPEDK	388	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3788.2	44.95645	4	2842.288094	2842.288477	K	V	72	96
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	389	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3825.4	45.93202	3	2881.092371	2881.094982	K	T	701	725
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	390	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.5299.2	64.49247	3	2952.335171	2952.330281	R	S	59	86
PSM	GGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSR	391	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	29-UNIMOD:21	ms_run[1]:scan=1.1.3480.5	37.18365	3	2953.096271	2953.096136	R	G	233	266
PSM	EPSYPMPVQETQAPESPGENSEQALQTLSPR	392	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=1.1.3930.3	48.54607	4	3556.512094	3556.510642	K	A	137	168
PSM	IEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSR	393	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3758.6	44.21793	4	3698.640494	3698.647255	K	A	17	52
PSM	CIPALDSLTPANEDQK	394	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4757.2	60.35052	2	1834.7852	1833.7852	R	I	447	463
PSM	EEEIAALVIDNGSGMCK	395	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5511.2	65.84296	3	1956.8210	1956.8205	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	396	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4225.3	54.39193	3	1916.7533	1916.7528	M	A	2	19
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	397	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.2949.5	23.4968	4	3007.3295	3007.3290	K	S	145	174
PSM	ATGANATPLDFPSK	398	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3624.5	40.89572	2	1510.6664	1510.6700	M	K	2	16
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDK	399	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3555.6	39.13215	4	4593.1172	4593.1139	M	K	2	53
PSM	MEGPLSVFGDR	400	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5266.2	64.21497	2	1328.5465	1328.5467	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	401	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3975.5	49.5842	3	2749.2280	2749.2301	-	Y	1	25
PSM	MEAAGSPAATETGK	402	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2781.5	19.40505	2	1457.5715	1457.5740	-	Y	1	15
PSM	TEWETAAPAVAETPDIK	403	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3975.2	49.57087	3	1949.8675	1949.8654	M	L	2	19
PSM	AAAVAAAGAGEPQSPDELLPK	404	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4122.3	52.72618	3	2083.9823	2083.9822	M	G	2	23
PSM	MEDLVQDGVASPATPGTGK	405	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4051.2	51.26535	3	1993.8722	1993.8699	-	S	1	20
PSM	SGPDVETPSAIQICR	406	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3699.6	42.68385	2	1750.7549	1750.7592	M	I	2	17
PSM	SDEFSLADALPEHSPAK	407	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4020.2	50.57445	3	1935.8312	1934.8292	M	T	2	19
PSM	TPKTPKGPSSVEDIK	408	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2922.3	22.7908	3	1662.820571	1662.822968	K	A	234	249
PSM	MDATANDVPSPYEVR	409	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3386.2	34.79015	3	1743.714371	1743.717517	K	G	434	449
PSM	HARPPDPPASAPPDSSSNSASQDTK	410	sp|Q15642|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2770.2	19.17578	4	2596.121694	2596.119103	R	E	486	511
PSM	MDSTANEVEAVK	411	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.2909.2	22.47543	2	1388.554247	1388.553078	K	V	425	437
PSM	KAEGAATEEEGTPKESEPQAAAEPAEAK	412	sp|P80723|BASP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2869.5	21.4694	4	2905.290894	2905.286622	K	E	25	53
PSM	AQAAAPASVPAQAPK	413	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2925.2	22.86527	3	1456.709171	1456.707544	K	R	135	150
PSM	PCSEETPAISPSK	414	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2910.6	22.50008	2	1481.6085	1481.6104	M	R	2	15
PSM	KAEAGAGSATEFQFR	415	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3265.2	31.66198	3	1648.723271	1648.724651	K	G	150	165
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	416	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3126.6	28.05518	4	3365.448094	3365.451593	K	K	799	833
PSM	GEPAAAAAPEAGASPVEK	417	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2960.4	23.77733	3	1701.760271	1701.761096	K	E	88	106
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	418	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3104.6	27.48238	4	3445.416094	3445.417924	K	K	799	833
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	419	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3147.5	28.5963	4	3492.324494	3492.326786	K	A	111	145
PSM	DAGDKDKEQELSEEDK	420	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2748.2	18.73048	3	1834.807871	1834.806846	R	Q	35	51
PSM	AGEAAELQDAEVESSAKSGKP	421	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3187.6	29.63537	3	2152.950071	2152.952539	K	-	657	678
PSM	GHTDTEGRPPSPPPTSTPEK	422	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2809.2	20.01343	4	2166.959694	2166.958293	R	C	353	373
PSM	PAETPVATSPTATDSTSGDSSR	423	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2918.3	22.69158	3	2213.932271	2213.932531	K	S	152	174
PSM	SQSPAASDCSSSSSSASLPSSGR	424	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2897.5	22.1918	3	2278.899371	2278.900914	R	S	171	194
PSM	SQSPAASDCSSSSSSASLPSSGR	425	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2889.5	21.98213	3	2278.899371	2278.900914	R	S	171	194
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	426	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3269.6	31.77885	3	3722.192171	3722.195067	K	A	158	190
PSM	SVTSNQSDGTQESCESPDVLDR	427	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3178.6	29.4017	3	2489.979671	2489.985372	R	H	346	368
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	428	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3323.5	33.16652	3	2494.086371	2494.089063	R	L	815	839
PSM	NGSLDSPGKQDTEEDEEEDEK	429	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2885.5	21.88233	3	2509.886171	2509.889480	K	D	134	155
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	430	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3119.3	27.86267	5	2769.238618	2769.239553	K	V	100	125
PSM	ASSDLDQASVSPSEEENSESSSESEK	431	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3070.6	26.62233	3	2794.081271	2794.082562	K	T	173	199
PSM	NSCQDSEADEETSPGFDEQEDGSSSQTANKPSR	432	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2990.6	24.56262	4	3668.396494	3668.396597	K	F	311	344
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	433	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3261.6	31.5705	4	3704.513294	3704.512278	K	-	158	196
PSM	DVAEAKPELSLLGDGDH	434	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3600.2	40.25972	3	1764.853271	1764.853008	R	-	232	249
PSM	RQPPVSPLTLSPGPEAHQGFSR	435	sp|Q6UUV7|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3458.4	36.60615	4	2517.153694	2517.156689	R	Q	386	408
PSM	GYISPYFINTSK	436	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3875.5	47.1513	2	1468.660847	1468.663948	R	G	222	234
PSM	AEAGAGSATEFQFR	437	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3475.3	37.04587	2	1520.628647	1520.629688	K	G	151	165
PSM	SSGSEGSSPNWLQALK	438	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3959.2	49.2244	2	1726.756247	1726.756345	K	L	1708	1724
PSM	SESVPPVTDWAWYK	439	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4276.2	55.0027	3	1743.756971	1743.754554	K	I	244	258
PSM	KIFVGGLSPDTPEEK	440	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3576.2	39.6563	3	1775.777171	1775.778400	K	I	183	198
PSM	LVQDVANNTNEEAGDGTTTATVLAR	441	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3483.6	37.2659	3	2719.169471	2719.173915	K	S	97	122
PSM	VSHVSTGGGASLELLEGK	442	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3535.2	38.59595	3	1819.870871	1819.871709	K	V	389	407
PSM	SESVPPVTDWAWYK	443	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4553.2	58.22263	3	1823.720471	1823.720885	K	I	244	258
PSM	SLSTSGESLYHVLGLDK	444	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4399.2	56.85032	3	1884.886571	1884.887025	R	N	8	25
PSM	LDGLVETPTGYIESLPR	445	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4469.2	57.5455	3	1938.934271	1938.933975	R	V	56	73
PSM	LDNVPHTPSSYIETLPK	446	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3718.2	43.16722	3	1989.946571	1989.944874	R	A	45	62
PSM	DNLTLWTSDQQDDDGGEGNN	447	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3875.4	47.14463	3	2192.868971	2192.873028	R	-	228	248
PSM	CGNTIPDDDNQVVSLSPGSR	448	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3450.5	36.40548	3	2209.928171	2209.931092	R	Y	643	663
PSM	LYGSAGPPPTGEEDTAEKDEL	449	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3444.3	36.2638	2	2254.951447	2254.951870	K	-	634	655
PSM	EGEEAGPGDPLLEAVPKTGDEK	450	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3559.5	39.23278	3	2317.035371	2317.036268	K	D	353	375
PSM	DTPENNPDTPFDFTPENYK	451	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3910.3	48.01865	3	2319.923171	2319.920904	R	R	43	62
PSM	DLGLSESGEDVNAAILDESGKK	452	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3748.5	43.95436	3	2326.056071	2326.057732	K	F	464	486
PSM	IQQALTSPLPMTPILEGSHR	453	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3969.4	49.42813	3	2348.096171	2348.100086	R	A	421	441
PSM	EVSSLEGSPPPCLGQEEAVCTK	454	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3520.6	38.21563	3	2453.050271	2453.049158	K	I	1388	1410
PSM	SMVSPVPSPTGTISVPNSCPASPR	455	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3815.2	45.672	3	2584.105871	2584.110393	R	G	236	260
PSM	YDSDGDKSDDLVVDVSNEDPATPR	456	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3531.6	38.5045	3	2688.106271	2688.107595	R	V	238	262
PSM	VEIIANDQGNRTTPSYVAFTDTER	457	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3666.5	41.8337	3	2776.268471	2776.270519	K	L	26	50
PSM	MLAESDESGDEESVSQTDKTELQNTLR	458	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3572.6	39.56396	3	3091.313171	3091.317665	K	T	186	213
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	459	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3595.6	40.14195	3	3199.394171	3199.394275	K	N	213	241
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	460	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3726.5	43.38538	4	3393.346494	3393.345713	K	F	86	114
PSM	CIPALDSLTPANEDQK	461	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4737.2	60.14895	2	1834.7842	1833.7852	R	I	447	463
PSM	CIPALDSLTPANEDQK	462	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4777.2	60.55257	2	1833.7874	1833.7851	R	I	447	463
PSM	DDDIAALVVDNGSGMCK	463	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4038.3	51.01212	2	1836.7876	1836.7865	M	A	2	19
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	464	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3603.5	40.34768	3	2508.0808	2508.0760	M	R	2	32
PSM	MEGPLSVFGDR	465	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4317.2	55.58513	2	1344.5401	1344.5416	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	466	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4060.2	51.47947	3	2829.1969	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	467	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4080.3	51.90893	3	2829.1987	2829.1964	-	Y	1	25
PSM	AETLPGSGDSGPGTASLGPGVAETGTR	468	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3744.2	43.85297	3	2563.1393	2563.1434	M	R	2	29
PSM	MEAAGSPAATETGK	469	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3088.5	27.08602	2	1441.5775	1441.5791	-	Y	1	15
PSM	PCSEETPAISPSK	470	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2918.4	22.69492	2	1481.6085	1481.6104	M	R	2	15
PSM	SCEGQNPELLPKTPISPLK	471	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3656.4	41.57747	3	2267.028671	2267.031003	K	T	308	327
PSM	QREEYQPATPGLGMFVEVKDPEDK	472	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3983.4	49.79115	3	2825.2588	2825.2614	K	V	72	96
PSM	AEAEGVPTTPGPASGSTFR	473	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3537.4	38.65465	3	1952.8511	1952.8512	M	G	2	21
PSM	CNTPTYCDLGK	474	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3360.2	34.11732	2	1449.5251	1449.5300	M	A	2	13
PSM	SPASPRVPPVPDYVAHPER	475	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3367.2	34.2962	4	2150.028894	2150.031004	R	W	143	162
PSM	MDATANDVPSPYEVR	476	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3385.2	34.76457	3	1743.714371	1743.717517	K	G	434	449
PSM	RTEGVGPGVPGEVEMVK	477	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3371.3	34.40427	3	1819.852571	1819.853951	R	G	16	33
PSM	SVTSNQSDGTQESCESPDVLDR	478	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3180.4	29.44723	4	2489.990494	2489.985372	R	H	346	368
PSM	STGCDFAVSPK	479	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3123.2	27.9632	2	1247.486447	1247.489355	K	L	501	512
PSM	GAGAGHPGAGGAQPPDSPAGVR	480	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2855.2	21.12407	3	1962.870971	1962.869752	R	T	71	93
PSM	AGDNIPEEQPVASTPTTVSDGENKK	481	sp|Q9Y320|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3110.4	27.63192	4	2663.193694	2663.196351	K	D	270	295
PSM	TFDQLTPDESK	482	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3146.5	28.57092	2	1359.555247	1359.559543	K	E	71	82
PSM	MDSTANEVEAVK	483	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3004.5	24.92075	2	1372.557447	1372.558163	K	V	425	437
PSM	GVQVETISPGDGR	484	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3138.5	28.36403	2	1393.6195	1393.6233	M	T	2	15
PSM	KLEDVKNSPTFK	485	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2922.2	22.78747	3	1484.729771	1484.727611	K	S	164	176
PSM	AIEINPDSAQPYK	486	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3356.6	34.03023	2	1524.683047	1524.686140	R	W	174	187
PSM	ERAMSTTSISSPQPGK	487	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2723.2	18.44547	3	1771.779071	1771.781180	K	L	265	281
PSM	SADGSAPAGEGEGVTLQR	488	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3119.4	27.866	3	1780.761671	1780.762887	K	N	31	49
PSM	NIGRDTPTSAGPNSFNK	489	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3033.4	25.67013	3	1854.825071	1854.826156	K	G	134	151
PSM	IACKSPPPESVDTPTSTK	490	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2874.2	21.5908	3	2073.870071	2073.873106	K	Q	1127	1145
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	491	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	35-UNIMOD:35	ms_run[1]:scan=1.1.3105.6	27.50857	4	4461.542894	4461.548507	K	G	177	218
PSM	NGSLDSPGKQDTEEDEEEDEK	492	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2842.5	20.79848	3	2429.923871	2429.923149	K	D	134	155
PSM	AAAAAAAAAPAAAATAPTTAATTAATAAQ	493	sp|P37108|SRP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3394.6	35.0097	3	2447.168471	2447.169348	K	-	108	137
PSM	NCQTVLAPCSPNPCENAAVCK	494	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3297.6	32.49412	3	2468.991071	2468.994638	K	E	829	850
PSM	HRNDHLTSTTSSPGVIVPESSENK	495	sp|O75496|GEMI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3033.6	25.6768	4	2671.219294	2671.223903	K	N	53	77
PSM	ELAQRQEEEAAQQGPVVVSPASDYK	496	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3297.4	32.48745	4	2808.295294	2808.296734	K	D	140	165
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	497	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3273.2	31.8652	5	3093.279618	3093.277137	R	-	738	768
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	498	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3251.5	31.30585	4	3351.395294	3351.401211	R	A	108	139
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	499	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3048.5	26.06508	5	3793.551118	3793.546038	K	R	142	179
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	500	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3206.6	30.13153	5	4245.536618	4245.543285	K	S	158	195
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	501	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3404.5	35.26717	5	4716.099118	4716.094806	K	A	530	573
PSM	AEEYEFLTPVEEAPK	502	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3806.4	45.43148	3	1830.797471	1830.796479	R	G	153	168
PSM	DDGVFVQEVTQNSPAAR	503	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	39.5249	3	1911.837671	1911.836387	R	T	29	46
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	504	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3484.4	37.28485	5	3265.401618	3265.402471	K	-	708	738
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	505	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3484.5	37.28819	5	3265.401618	3265.402471	K	-	708	738
PSM	EVYELLDSPGK	506	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3586.3	39.91763	2	1328.588647	1328.590115	K	V	20	31
PSM	EVYELLDSPGK	507	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3577.2	39.68208	2	1328.588647	1328.590115	K	V	20	31
PSM	DSGFTIVSPLDI	508	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5953.2	68.92744	2	1342.606647	1342.605765	K	-	784	796
PSM	GYISPYFINTSK	509	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3883.5	47.35668	2	1468.660847	1468.663948	R	G	222	234
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	510	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3690.4	42.44243	4	2972.319694	2972.324602	K	Q	178	204
PSM	SEPERGRLTPSPDIIVLSDNEASSPR	511	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3677.2	42.11182	4	2981.352094	2981.353277	R	S	112	138
PSM	VEEQEPELTSTPNFVVEVIKNDDGKK	512	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3983.3	49.78448	4	3023.438494	3023.437644	K	A	155	181
PSM	LQALVNSLCAGQSP	513	sp|Q6XQN6|PNCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3816.3	45.69125	2	1536.698047	1536.700745	R	-	525	539
PSM	GYISPYFINTSK	514	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4025.3	50.70747	2	1548.627847	1548.630279	R	G	222	234
PSM	GNPTVEVDLFTSK	515	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3949.4	48.98275	2	1565.638047	1565.641572	R	G	16	29
PSM	APNTPDILEIEFK	516	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4180.2	53.74838	2	1565.734247	1565.737842	K	K	216	229
PSM	SACGNCYLGDAFR	517	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3673.3	42.00267	2	1569.569847	1569.574164	K	C	272	285
PSM	DMSPLSETEMALGK	518	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4092.2	52.17615	2	1587.655247	1587.656162	K	D	505	519
PSM	DWALSSAAAVMEER	519	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4203.2	54.10007	2	1614.672247	1614.674924	K	K	547	561
PSM	DLADELALVDVIEDK	520	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.5441.2	65.37785	3	1656.844871	1656.845798	K	L	43	58
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	521	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:35	ms_run[1]:scan=1.1.3718.6	43.18055	4	3472.442894	3472.437249	R	-	207	238
PSM	RLEENDDDAYLNSPWADNTALK	522	sp|P57076|CF298_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3733.5	43.56713	3	2629.127171	2629.133357	K	R	255	277
PSM	NQLTSNPENTVFDAK	523	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3521.3	38.2321	3	1836.732971	1836.733241	K	R	82	97
PSM	DMASPNWSILPEEER	524	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4147.2	53.26143	3	1852.769471	1852.770281	R	N	327	342
PSM	NQYDNDVTVWSPQGR	525	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3542.3	38.78238	3	1857.767471	1857.768307	R	I	4	19
PSM	NQYDNDVTVWSPQGR	526	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3534.2	38.56965	3	1857.767471	1857.768307	R	I	4	19
PSM	HSGGFLSSPADFSQENK	527	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3518.3	38.155	3	1886.784371	1886.783623	R	A	772	789
PSM	EKEPSYPMPVQETQAPESPGENSEQALQTLSPR	528	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	18-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3753.5	44.08752	4	3813.648094	3813.648198	R	A	135	168
PSM	DTMSDQALEALSASLGTR	529	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4399.3	56.86032	3	1944.850571	1944.849988	K	Q	284	302
PSM	KEESEESDDDMGFGLFD	530	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.4083.4	51.98549	2	1948.750247	1948.752033	K	-	98	115
PSM	DATNVGDEGGFAPNILENK	531	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3885.3	47.40182	3	2039.880671	2039.883731	K	E	203	222
PSM	VLDSGAPIKIPVGPETLGR	532	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4031.2	50.86905	3	2078.021171	2078.021425	K	I	125	144
PSM	PVTTPEEIAQVATISANGDK	533	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3747.2	43.9308	3	2120.001071	2120.003846	K	E	161	181
PSM	AAPEASSPPASPLQHLLPGK	534	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3854.3	46.63802	3	2126.976671	2126.980288	K	A	686	706
PSM	AAPEASSPPASPLQHLLPGK	535	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3836.2	46.19672	3	2126.976671	2126.980288	K	A	686	706
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	536	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3838.2	46.24507	4	2881.096094	2881.094982	K	T	701	725
PSM	ATESGAQSAPLPMEGVDISPK	537	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3713.4	43.0425	3	2163.976571	2163.975917	K	Q	8	29
PSM	KYEQGFITDPVVLSPKDR	538	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3550.2	38.98903	4	2171.065694	2171.066387	K	V	109	127
PSM	KGEQTSSGTLSAFASYFNSK	539	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4081.3	51.93458	3	2188.971371	2188.967795	R	V	670	690
PSM	VPADTEVVCAPPTAYIDFAR	540	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4113.2	52.57607	2	2271.025447	2271.028287	K	Q	71	91
PSM	LYGSAGPPPTGEEDTAEKDEL	541	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3592.3	40.05416	3	2334.916271	2334.918201	K	-	634	655
PSM	DNLTLWTSDTQGDEAEAGEGGEN	542	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3921.4	48.31332	3	2407.991171	2407.988786	R	-	223	246
PSM	DNLTLWTSDSAGEECDAAEGAEN	543	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3957.2	49.17227	3	2453.974271	2453.976507	R	-	223	246
PSM	DNLTLWTSDSAGEECDAAEGAEN	544	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3947.2	48.9208	3	2453.974271	2453.976507	R	-	223	246
PSM	TDLNPDNLQGGDDLDPNYVLSSR	545	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3914.3	48.12212	3	2597.132771	2597.128271	K	V	108	131
PSM	APSEEDSLSSVPISPYKDEPWK	546	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3912.3	48.0803	3	2620.103771	2620.102313	K	Y	36	58
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	547	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4366.2	56.31021	3	2754.234371	2754.234331	R	Y	147	174
PSM	QREEYQPATPGLGMFVEVKDPEDK	548	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3611.5	40.55757	4	2858.283294	2858.283392	K	V	72	96
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	549	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3842.4	46.3479	3	2881.092371	2881.094982	K	T	701	725
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	550	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3731.6	43.51942	3	3014.183171	3014.188484	K	-	661	690
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	551	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3456.6	36.56008	3	3291.353171	3291.357615	R	S	1160	1192
PSM	EPSYPMPVQETQAPESPGENSEQALQTLSPR	552	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=1.1.3922.3	48.33928	4	3556.512094	3556.510642	K	A	137	168
PSM	YGKDATNVGDEGGFAPNILENK	553	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3663.5	41.75813	3	2388.059771	2388.063486	K	E	200	222
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	554	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3341.6	33.63997	3	2898.286871	2898.290225	K	L	281	308
PSM	MEGPLSVFGDR	555	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5206.2	63.81008	2	1328.5465	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	556	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4299.2	55.37327	2	1344.5401	1344.5416	-	S	1	12
PSM	MEGPLSVFGDR	557	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5236.2	64.0126	2	1328.5465	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	558	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4285.2	55.12057	2	1344.5401	1344.5416	-	S	1	12
PSM	SCINLPTVLPGSPSK	559	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4202.2	54.08484	2	1690.7981	1690.7996	M	T	2	17
PSM	EALQDVEDENQ	560	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3115.5	27.76528	2	1288.537847	1288.541905	K	-	245	256
PSM	TRSWDSSSPVDRPEPEAASPTTR	561	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3115.6	27.76862	4	2608.157294	2608.155489	R	T	352	375
PSM	GSLSNAGDPEIVKSPSDPK	562	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3106.6	27.5347	3	1976.904371	1976.909217	R	Q	93	112
PSM	TFDQLTPEESK	563	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3158.6	28.87917	2	1373.573647	1373.575193	K	E	60	71
PSM	GVQVETISPGDGR	564	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3130.5	28.1565	2	1393.6195	1393.6233	M	T	2	15
PSM	VLQATVVAVGSGSK	565	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3235.4	30.88493	2	1394.713447	1394.717047	K	G	41	55
PSM	EGLELPEDEEEK	566	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3302.4	32.6178	2	1415.628847	1415.630385	K	K	412	424
PSM	AIADTGANVVVTGGK	567	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3123.5	27.97653	2	1451.698047	1451.702125	K	V	282	297
PSM	LIAPVAEEEATVPNNK	568	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3322.2	33.13077	3	1693.888571	1693.888666	K	I	8	24
PSM	GGRGDVGSADIQDLEK	569	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3245.2	31.13932	3	1695.746171	1695.746509	K	W	250	266
PSM	ALSRQEMQEVQSSR	570	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2752.2	18.81133	3	1743.759071	1743.761113	K	S	187	201
PSM	MDATANDVPSPYEVR	571	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3282.3	32.0954	3	1759.708271	1759.712432	K	G	434	449
PSM	ALVSGKPAESSAVAATEK	572	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	27.29458	3	1794.876071	1794.876460	K	K	75	93
PSM	RLYPAVDEQETPLPR	573	sp|Q96S59|RANB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3339.4	33.58115	3	1862.890871	1862.892779	K	S	153	168
PSM	EQPPTEPGPQSASEVEK	574	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2997.5	24.7395	3	1888.807871	1888.809169	R	I	393	410
PSM	NIGRDTPTSAGPNSFNK	575	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3076.4	26.771	3	1934.789771	1934.792487	K	G	134	151
PSM	NGNGGPGPYVGQAGTATLPR	576	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3346.3	33.76087	3	1962.895271	1962.894904	K	N	185	205
PSM	KSQIFSTASDNQPTVTIK	577	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3330.4	33.34645	3	2043.987671	2043.987802	K	V	447	465
PSM	SHSPSSPDPDTPSPVGDSR	578	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2898.5	22.21423	3	2080.777871	2080.777625	R	A	616	635
PSM	NSLDASRPAGLSPTLTPGER	579	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3383.5	34.72262	3	2118.006371	2118.010663	K	Q	138	158
PSM	DLHQPSLSPASPHSQGFER	580	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3326.2	33.23522	4	2248.927694	2248.930378	K	G	58	77
PSM	AGEEDEGEEDSDSDYEISAK	581	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3136.3	28.30587	3	2253.793871	2253.795823	R	A	463	483
PSM	RTEGYAAFQEDSSGDEAESPSK	582	sp|Q15311|RBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3161.5	28.95433	3	2439.974171	2439.970374	K	M	81	103
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	583	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2812.6	20.08845	5	3104.327618	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	584	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2810.3	20.03142	4	3104.323294	3104.322430	K	S	145	174
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	585	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3169.6	29.16733	4	3290.595694	3290.597273	K	E	178	210
PSM	DAGQISGLNVLR	586	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3787.2	44.93085	2	1321.637447	1321.639131	K	V	207	219
PSM	EGLELLKTAIGK	587	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3649.2	41.4017	2	1350.713247	1350.715984	K	A	222	234
PSM	LDIDSPPITAR	588	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3556.3	39.14875	2	1356.571847	1356.572764	R	N	33	44
PSM	VEIIANDQGNRTTPSYVAFTDTER	589	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3665.2	41.79877	4	2776.268894	2776.270519	K	L	26	50
PSM	DNALLSAIEESR	590	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4297.3	55.33315	2	1396.622847	1396.623540	K	K	107	119
PSM	IVSAQSLAEDDVE	591	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3664.2	41.77408	2	1454.616447	1454.617786	R	-	133	146
PSM	GYISPYFINTSK	592	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3891.4	47.56028	2	1468.660847	1468.663948	R	G	222	234
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	593	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3574.6	39.61652	4	2989.543694	2989.541321	K	G	202	228
PSM	GASSPLITVFTDDK	594	sp|Q15155|NOMO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4020.3	50.58445	2	1529.699647	1529.701456	K	G	822	836
PSM	GYISPYFINTSK	595	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4033.2	50.92055	2	1548.627847	1548.630279	R	G	222	234
PSM	FVEWLQNAEEESESEGEEN	596	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4161.2	53.50708	3	2333.887271	2333.884913	K	-	401	420
PSM	IFVGGLSPDTPEEK	597	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3551.6	39.0284	2	1567.714647	1567.717106	K	I	184	198
PSM	RASGQAFELILSPR	598	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3761.2	44.2799	3	1623.812471	1623.813407	K	S	14	28
PSM	IFVGGLSPDTPEEK	599	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3733.4	43.5638	2	1647.681847	1647.683437	K	I	184	198
PSM	DDGLFSGDPNWFPK	600	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4888.2	61.42738	2	1673.676247	1673.676304	R	K	140	154
PSM	VTNGAFTGEISPGMIK	601	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3772.2	44.54955	3	1700.782271	1700.784474	K	D	107	123
PSM	NVSSFPDDATSPLQENR	602	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3462.4	36.71018	3	1955.824871	1955.826216	R	N	52	69
PSM	KEESEESDDDMGFGLFD	603	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3801.3	45.30115	3	1964.749271	1964.746948	K	-	98	115
PSM	FDRGYISPYFINTSK	604	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3886.3	47.42765	3	1966.826171	1966.826747	K	G	219	234
PSM	DRDVTFSPATIENELIK	605	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4436.2	57.15237	3	2026.960871	2026.961253	K	F	46	63
PSM	GPSLDIDTPDVNIEGPEGK	606	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3771.2	44.52837	2	2031.899447	2031.903797	K	L	4423	4442
PSM	AAPEASSPPASPLQHLLPGK	607	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3828.3	45.99947	3	2126.976671	2126.980288	K	A	686	706
PSM	YESQEPLAGQESPLPLATR	608	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3639.3	41.16222	3	2165.000471	2165.004180	R	E	590	609
PSM	IIEVAPQVATQNVNPTPGATS	609	sp|P49903|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3641.4	41.21445	3	2186.060471	2186.062029	R	-	372	393
PSM	YLLSQSSPAPLTAAEEELR	610	sp|Q12792|TWF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4571.3	58.48863	3	2233.991771	2233.990912	K	Q	137	156
PSM	LYGSAGPPPTGEEDTAEKDEL	611	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3470.3	36.91438	3	2254.949771	2254.951870	K	-	634	655
PSM	VPADTEVVCAPPTAYIDFAR	612	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4142.2	53.13423	3	2271.026171	2271.028287	K	Q	71	91
PSM	GFFICDQPYEPVSPYSCK	613	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4063.2	51.55202	3	2272.920071	2272.921045	R	E	676	694
PSM	GSPLNAAPYGIESMSQDTEVR	614	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3832.4	46.10542	3	2301.000971	2300.998443	K	S	351	372
PSM	IADPEHDHTGFLTEYVATR	615	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3572.5	39.56063	3	2330.958971	2330.961009	R	W	190	209
PSM	VPPAPVPCPPPSPGPSAVPSSPK	616	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3481.5	37.2101	3	2378.071571	2378.078288	K	S	366	389
PSM	AAVPSGASTGIYEALELRDNDK	617	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4059.2	51.46362	3	2436.058271	2436.061117	R	T	33	55
PSM	GGPGSAVSPYPTFNPSSDVAALHK	618	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3866.4	46.9129	3	2515.079771	2515.082187	K	A	30	54
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	619	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3830.4	46.05443	3	2644.234571	2644.238156	R	L	55	81
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	620	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3562.2	39.30022	5	2833.354118	2833.352672	K	S	362	389
PSM	RPPEPTTPWQEDPEPEDENLYEK	621	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3508.6	37.90479	3	2875.220171	2875.222566	K	N	47	70
PSM	RAAAKSPDLSNQNSDQANEEWETASESSDFTSER	622	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3463.6	36.74332	4	3836.599694	3836.603493	R	R	1301	1335
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	623	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3623.5	40.87097	4	3464.574094	3464.574823	K	E	218	249
PSM	NAVITVPAYFNDSQR	624	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3909.3	47.9929	3	1773.810971	1773.808715	K	Q	188	203
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	625	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3695.4	42.57292	3	2574.981971	2573.998594	R	G	239	267
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	626	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3703.3	42.7813	3	2574.981971	2573.998594	R	G	239	267
PSM	MEGPLSVFGDR	627	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5290.2	64.4183	2	1328.5465	1328.5467	-	S	1	12
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	628	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3248.4	31.2245	4	2987.314094	2987.319929	R	-	684	712
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	629	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3897.4	47.7157	4	2749.2308	2749.2301	-	Y	1	25
PSM	SPWSNKYDPPLEDGAMPSAR	630	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3606.5	40.42663	3	2296.981271	2296.982399	R	L	73	93
PSM	MEAAGSPAATETGK	631	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3080.6	26.88132	2	1441.5775	1441.5791	-	Y	1	15
PSM	ADDLDFETGDAGASATFPMQCSALRK	632	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.4203.3	54.11007	3	2895.2113	2895.2087	M	N	2	28
PSM	MTEWETAAPAVAETPDIK	633	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4391.2	56.74008	3	2080.9054	2080.9059	-	L	1	19
PSM	AMHQAQTMEGCSSPMVVK	634	sp|Q92879|CELF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3020.3	25.33175	3	2086.829771	2086.834555	K	F	167	185
PSM	NVSSFPDDATSPLQENR	635	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3478.3	37.12453	3	1957.821371	1955.826216	R	N	52	69
PSM	RADLNQGIGEPQSPSR	636	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2971.4	24.06957	3	1803.826571	1803.826490	R	R	62	78
PSM	KITIADCGQLE	637	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3248.2	31.21783	2	1246.618647	1246.622738	K	-	155	166
PSM	DSAQNSVIIVDK	638	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3152.2	28.7113	2	1287.664847	1287.667045	K	N	194	206
PSM	EALQDVEDENQ	639	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3107.5	27.55718	2	1288.537847	1288.541905	K	-	245	256
PSM	SAESPTSPVTSETGSTFKK	640	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3116.3	27.78435	3	2019.901871	2019.903797	K	F	280	299
PSM	SQSLPNSLDYTQTSDPGR	641	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3435.4	36.07618	3	2044.872071	2044.873894	R	H	44	62
PSM	ASPGTPLSPGSLR	642	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3411.3	35.44465	2	1398.593047	1398.594562	R	S	33	46
PSM	NAEAVLQSPGLSGK	643	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3261.5	31.56717	2	1449.682047	1449.686475	R	V	849	863
PSM	NAEAVLQSPGLSGK	644	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3269.3	31.76885	2	1449.682047	1449.686475	R	V	849	863
PSM	SESPKEPEQLRK	645	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2776.2	19.28022	3	1506.708071	1506.707938	K	L	4	16
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	646	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3402.4	35.21152	4	3054.245694	3054.246274	K	N	1928	1956
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	647	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3268.5	31.74985	4	3162.496094	3162.502310	K	E	179	210
PSM	SQDATFSPGSEQAEKSPGPIVSR	648	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3214.5	30.33755	3	2454.104471	2454.106414	R	T	329	352
PSM	ESVPEFPLSPPKKK	649	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3364.2	34.21786	3	1661.841071	1661.842975	K	D	30	44
PSM	TPKTPKGPSSVEDIK	650	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2938.2	23.20433	3	1662.820571	1662.822968	K	A	234	249
PSM	SSTPLPTISSSAENTR	651	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3241.2	31.03505	3	1726.775471	1726.777475	R	Q	158	174
PSM	QEDSESSEEESDSEEAAASPAQVK	652	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2949.6	23.50013	3	2618.003171	2618.002856	K	T	759	783
PSM	HTGPNSPDTANDGFVR	653	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3008.2	25.01413	3	1763.726171	1763.726442	K	L	99	115
PSM	DKPHVNVGTIGHVDHGK	654	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2890.2	21.99798	4	1808.929694	1808.928179	R	T	54	71
PSM	SAESPTSPVTSETGSTFK	655	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3268.3	31.74318	3	1891.807871	1891.808834	K	K	280	298
PSM	EVNVSPCPTQPCQLSK	656	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3171.5	29.21617	3	1922.821871	1922.826750	K	G	36	52
PSM	GNSRPGTPSAEGGSTSSTLR	657	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2828.3	20.4577	3	1997.880671	1997.880377	R	A	383	403
PSM	TPSPKEEDEEPESPPEK	658	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2831.6	20.54115	3	2003.824871	2003.824878	K	K	202	219
PSM	GPSPSSPTPPAAAAPAEQAPR	659	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3070.4	26.61567	3	2035.933871	2035.936435	R	A	103	124
PSM	NHSDSSTSESEVSSVSPLK	660	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3029.5	25.56967	3	2055.864071	2055.863389	K	N	211	230
PSM	IACKSPPPESVDTPTSTK	661	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2882.4	21.79857	3	2073.870071	2073.873106	K	Q	1127	1145
PSM	KQEETAVLEEDSADWEK	662	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3368.3	34.32555	3	2085.875771	2085.877977	K	E	302	319
PSM	SAESPTSPVTSETGSTFKK	663	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3290.4	32.30538	3	2099.867771	2099.870128	K	F	280	299
PSM	TVEVAEGEAVRTPQSVTAK	664	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3193.4	29.78588	3	2130.958571	2130.959947	R	Q	132	151
PSM	NSLDASRPAGLSPTLTPGER	665	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3406.5	35.3202	3	2197.976471	2197.976994	K	Q	138	158
PSM	GHASAPYFGKEEPSVAPSSTGK	666	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3118.4	27.83948	4	2283.024894	2283.020893	K	T	131	153
PSM	SSSNDSVDEETAESDTSPVLEK	667	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3227.6	30.6814	3	2404.962671	2404.964285	K	E	400	422
PSM	SQDATFSPGSEQAEKSPGPIVSR	668	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3295.6	32.44228	3	2534.071271	2534.072745	R	T	329	352
PSM	ASPEPQRENASPAPGTTAEEAMSR	669	sp|P46379|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3108.6	27.58665	3	2563.097171	2563.101011	R	G	963	987
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	670	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3428.6	35.90002	3	2574.221471	2574.222781	K	K	453	479
PSM	SSSSVTTSETQPCTPSSSDYSDLQR	671	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3237.6	30.94407	3	2786.119271	2786.122594	K	V	322	347
PSM	NNDQPQSANANEPQDSTVNLQSPLK	672	sp|P37275|ZEB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3405.6	35.29715	3	2788.227671	2788.230111	K	M	658	683
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	673	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3408.6	35.3755	3	3044.150171	3044.151982	K	L	595	622
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	674	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2820.3	20.28188	3	3104.321171	3104.322430	K	S	145	174
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	675	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3302.6	32.62447	3	3173.243171	3173.243468	R	-	738	768
PSM	SADTLWGIQK	676	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3692.2	42.48815	2	1197.541047	1197.543105	K	E	319	329
PSM	SADTLWDIQK	677	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3762.3	44.30787	2	1255.546247	1255.548584	K	D	320	330
PSM	YFEADPPGQVAASPDPTT	678	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3538.5	38.6847	3	1941.805871	1941.803355	R	-	157	175
PSM	FNEEHIPDSPFVVPVASPSGDAR	679	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3928.3	48.48475	4	2626.115294	2626.114215	K	R	2311	2334
PSM	VWSPLVTEEGK	680	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3694.5	42.55079	2	1323.606047	1323.611184	K	R	88	99
PSM	DLFSLDSEDPSPASPPLR	681	sp|Q9BTK6|PAGR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4311.2	55.51193	3	2021.898071	2021.898318	R	S	224	242
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	682	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3553.3	39.07075	4	2833.352094	2833.352672	K	S	362	389
PSM	WPDPEDLLTPR	683	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4153.2	53.39538	2	1417.627247	1417.627897	R	W	39	50
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	684	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3450.4	36.40215	4	2933.355294	2933.357299	K	K	62	95
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	685	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3842.2	46.34123	4	2976.322094	2976.329413	K	A	2621	2646
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	686	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3882.4	47.32733	4	3013.336494	3013.339266	K	V	8	36
PSM	GVVDSEDLPLNISR	687	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3678.5	42.13385	2	1512.772647	1512.778387	R	E	387	401
PSM	QVEEQSAAANEEVLFPFCR	688	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4291.2	55.23558	3	2302.997171	2302.992964	K	E	218	237
PSM	DSPESPFEVIIDK	689	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4148.3	53.28703	2	1554.684447	1554.685472	K	A	242	255
PSM	TKEVYELLDSPGK	690	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3498.2	37.6294	3	1557.731471	1557.732756	K	V	18	31
PSM	MLAESDESGDEESVSQTDKTELQNTLR	691	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3704.6	42.81452	4	3171.283694	3171.283996	K	T	186	213
PSM	SLTNDWEDHLAVK	692	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3694.3	42.54412	3	1606.700771	1606.702853	K	H	315	328
PSM	QSKPVTTPEEIAQVATISANGDK	693	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3620.5	40.79502	3	2463.185771	2463.189415	K	E	158	181
PSM	APNTPDILEIEFKK	694	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3809.2	45.50282	3	1693.831271	1693.832805	K	G	216	230
PSM	DNLTLWTADNAGEEGGEAPQEPQS	695	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4155.2	53.42793	3	2608.058171	2608.060251	R	-	225	249
PSM	VGIDTPDIDIHGPEGK	696	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3482.2	37.22645	3	1741.792271	1741.792396	K	L	4560	4576
PSM	CVWSPLASPSTSILK	697	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4697.2	59.72563	3	1804.788071	1804.787191	R	R	2169	2184
PSM	EGSVLDILKSPGFASPK	698	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4332.2	55.77508	3	1903.873571	1903.873363	K	I	605	622
PSM	NSDVLQSPLDSAARDEL	699	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3894.3	47.63474	3	1908.848171	1908.846617	K	-	606	623
PSM	NSDVLQSPLDSAARDEL	700	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3886.2	47.42432	3	1908.848171	1908.846617	K	-	606	623
PSM	SATSSSPGSPLHSLETSL	701	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4499.2	57.78092	2	1916.777247	1916.780585	K	-	1203	1221
PSM	NVSSFPDDATSPLQENR	702	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3454.3	36.49845	3	1955.824871	1955.826216	R	N	52	69
PSM	GSLESPATDVFGSTEEGEK	703	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3726.2	43.37538	3	2018.835071	2018.835777	K	R	331	350
PSM	TIGGGDDSFNTFFSETGAGK	704	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4079.2	51.8836	3	2086.852271	2086.852096	K	H	41	61
PSM	LTPSPDIIVLSDNEASSPR	705	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3871.2	47.04852	3	2089.990571	2089.993281	R	S	119	138
PSM	DRYMSPMEAQEFGILDK	706	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3794.3	45.11895	3	2124.892871	2124.889744	R	V	227	244
PSM	AAPEASSPPASPLQHLLPGK	707	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3820.4	45.7949	3	2126.976671	2126.980288	K	A	686	706
PSM	SSVSRVPCNVEGISPELEK	708	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3465.4	36.78788	3	2166.001271	2166.002800	K	V	290	309
PSM	TQDPAKAPNTPDILEIEFK	709	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3906.5	47.94238	3	2206.056671	2206.055881	K	K	210	229
PSM	IADPEHDHTGFLTEYVATR	710	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3727.2	43.40168	4	2250.996094	2250.994678	R	W	190	209
PSM	DTPENNPDTPFDFTPENYK	711	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3918.3	48.22887	3	2319.923171	2319.920904	R	R	43	62
PSM	IADPEHDHTGFLTEYVATR	712	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3532.5	38.52738	3	2330.963471	2330.961009	R	W	190	209
PSM	ELSNSPLRENSFGSPLEFR	713	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3988.2	49.88445	3	2338.006271	2338.003208	K	N	1316	1335
PSM	KFVEWLQNAEEESESEGEEN	714	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3947.3	48.9308	3	2461.977071	2461.979876	K	-	400	420
PSM	QSKPVTTPEEIAQVATISANGDK	715	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3522.6	38.2678	3	2463.187871	2463.189415	K	E	158	181
PSM	SQEGESVTEDISFLESPNPENK	716	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4007.3	50.29662	3	2515.061471	2515.063940	K	D	81	103
PSM	YAQDFGLVEEACFPYTGTDSPCK	717	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.4306.2	55.46273	3	2734.101971	2734.096837	K	M	310	333
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	718	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.4029.4	50.81773	3	2763.130571	2763.129259	K	D	208	233
PSM	VSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENR	719	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3577.6	39.69542	4	4163.758894	4163.759416	K	G	372	413
PSM	LSSSEETESTQCCPGSPVAQTESPCDLSSIVEEENTDR	720	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,13-UNIMOD:4,23-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=1.1.3861.5	46.82558	4	4294.730894	4294.734903	R	S	330	368
PSM	VGPATPSAQVGKWEEDSESSSEESSDSSDGEVPTAVAPAQEK	721	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3617.6	40.71958	4	4340.858894	4340.860555	K	S	529	571
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	722	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3642.3	41.23893	3	2758.1462	2758.1503	M	D	2	33
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTK	723	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,29-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=1.1.3607.5	40.45308	4	3691.6099	3691.6092	M	S	2	41
PSM	AGAGSAAVSGAGTPVAGPTGR	724	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3178.3	29.3917	3	1832.8394	1832.8413	M	D	2	23
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	725	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3737.5	43.66987	3	2882.1610	2882.1618	M	D	2	29
PSM	AAQGVGPGPGSAAPPGLEAAR	726	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3559.4	39.22945	3	1951.9136	1951.9148	M	Q	2	23
PSM	TLEEVVMAEEEDEGTDRPGSPA	727	sp|A6NKF1|SAC31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3924.5	48.39095	3	2439.996971	2439.998897	R	-	383	405
PSM	NQVAMNPTNTVFDAK	728	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3203.2	30.03988	3	1744.749371	1744.749152	K	R	57	72
PSM	GASLKSPLPSQ	729	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3137.3	28.33168	2	1163.553847	1163.558755	K	-	113	124
PSM	DKVDKSAVGFEYQGK	730	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3080.4	26.87465	3	1749.793271	1749.797482	K	T	204	219
PSM	HGEVCPAGWKPGSDTIKPDVQK	731	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3159.4	28.89838	4	2485.147694	2485.146110	K	S	169	191
PSM	GAGAGHPGAGGAQPPDSPAGVR	732	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2863.5	21.32362	3	1962.870971	1962.869752	R	T	71	93
PSM	AVPMAPAPASPGSSNDSSAR	733	sp|Q66K74|MAP1S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.2938.3	23.21433	3	1964.829371	1964.829921	K	S	750	770
PSM	TPKGPSSVEDIK	734	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2960.2	23.77067	3	1336.624871	1336.627563	K	A	237	249
PSM	KQSKPVTTPEEIAQVATISANGDK	735	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3418.4	35.63128	4	2671.251694	2671.250709	K	E	157	181
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	736	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2845.4	20.87825	5	3503.288618	3503.284224	R	A	81	114
PSM	NGEVVHTPETSV	737	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3092.2	27.17708	2	1427.535047	1427.537107	K	-	454	466
PSM	DNPGVVTCLDEAR	738	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3331.5	33.37595	2	1444.660647	1444.661643	K	H	227	240
PSM	EFHLNESGDPSSK	739	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3081.2	26.89447	3	1525.605071	1525.608618	K	S	165	178
PSM	ELSDQATASPIVAR	740	sp|Q5JSH3|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3165.5	29.0589	2	1536.716847	1536.718503	K	T	88	102
PSM	ELQAAGKSPEDLER	741	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3027.3	25.51112	3	1621.734371	1621.734881	K	L	448	462
PSM	AAHSEGNTTAGLDMR	742	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2745.2	18.65598	3	1625.653271	1625.650500	R	E	467	482
PSM	APGTPHSHTKPYVR	743	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2632.2	17.42362	4	1626.771694	1626.766791	K	S	155	169
PSM	GRTVIIEQSWGSPK	744	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	34.04215	3	1636.796171	1636.797422	K	V	59	73
PSM	GRTVIIEQSWGSPK	745	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	34.24325	3	1636.796171	1636.797422	K	V	59	73
PSM	GRTVIIEQSWGSPK	746	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3373.2	34.45295	3	1636.796171	1636.797422	K	V	59	73
PSM	IDEMPEAAVKSTANK	747	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3088.2	27.07602	3	1682.754971	1682.758653	R	Y	30	45
PSM	GEPAAAAAPEAGASPVEK	748	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2968.4	23.98512	3	1701.760271	1701.761096	K	E	88	106
PSM	ICEPGYSPTYKQDK	749	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3014.6	25.18348	2	1764.740447	1764.743004	K	H	210	224
PSM	TDSVIIADQTPTPTR	750	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3298.3	32.5101	3	1773.759071	1773.758727	R	F	42	57
PSM	HVPDSGATATAYLCGVK	751	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3430.2	35.93932	3	1825.807271	1825.807001	K	G	110	127
PSM	ASSDLDQASVSPSEEENSESSSESEK	752	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3078.6	26.8297	3	2794.081271	2794.082562	K	T	173	199
PSM	SGKYDLDFKSPDDPSR	753	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3230.4	30.75397	3	1905.812771	1905.814588	R	Y	254	270
PSM	ERSPALKSPLQSVVVR	754	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3403.2	35.23138	4	1924.951294	1924.953679	R	R	246	262
PSM	VTAEADSSSPTGILATSESK	755	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3382.5	34.69663	2	2029.901447	2029.909277	K	S	486	506
PSM	VKLESPTVSTLTPSSPGK	756	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3379.3	34.61222	3	2066.898371	2066.897937	R	L	290	308
PSM	SHSPSSPDPDTPSPVGDSR	757	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2890.5	22.00798	3	2080.777871	2080.777625	R	A	616	635
PSM	QPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGAR	758	sp|Q96S55|WRIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,35-UNIMOD:21	ms_run[1]:scan=1.1.3184.6	29.55737	4	4180.614894	4180.617956	K	L	82	122
PSM	TVGTPIASVPGSTNTGTVPGSEK	759	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3339.6	33.58782	3	2236.060871	2236.062423	R	D	270	293
PSM	HGGPGPGGPEPELSPITEGSEAR	760	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3362.5	34.17737	3	2307.012371	2307.016870	R	A	554	577
PSM	ELEREESGAAESPALVTPDSEK	761	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3160.6	28.93222	3	2423.067971	2423.074110	K	S	173	195
PSM	DAAASASTPAQAPTSDSPVAEDASR	762	sp|P55789|ALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3058.6	26.319	3	2452.038371	2452.039122	R	R	43	68
PSM	SQDATFSPGSEQAEKSPGPIVSR	763	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3222.5	30.54678	3	2454.104471	2454.106414	R	T	329	352
PSM	QEDSESSEEESDSEEAAASPAQVK	764	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2957.6	23.70637	3	2618.003171	2618.002856	K	T	759	783
PSM	MAEESSSSSSSSSPTAATSQQQQLK	765	sp|Q13620|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2846.3	20.90407	3	2639.088371	2639.090565	K	N	134	159
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	766	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3321.6	33.11767	3	2994.261371	2994.261530	K	A	106	138
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	767	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3323.6	33.16985	3	3722.189171	3722.195067	K	A	158	190
PSM	IADPEHDHTGFLTEYVATR	768	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3533.3	38.54692	4	2330.961694	2330.961009	R	W	190	209
PSM	VLPGVDALSNI	769	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4348.2	56.03222	2	1176.578647	1176.579156	K	-	407	418
PSM	VPPAPVPCPPPSPGPSAVPSSPK	770	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3464.2	36.7555	4	2378.077694	2378.078288	K	S	366	389
PSM	LDIDSPPITAR	771	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3515.5	38.08472	2	1276.604647	1276.606433	R	N	33	44
PSM	SILSPGGSCGPIK	772	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3497.3	37.60623	2	1351.620047	1351.620704	R	V	207	220
PSM	IMNTFSVVPSPK	773	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3704.5	42.81118	2	1398.659447	1398.661840	R	V	163	175
PSM	ESVPEFPLSPPK	774	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3816.2	45.68458	2	1405.650647	1405.653049	K	K	30	42
PSM	EFSPFGTITSAK	775	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4094.2	52.23903	2	1443.572047	1443.572430	K	V	313	325
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	776	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3927.4	48.46824	4	2896.364094	2896.363082	K	A	2621	2646
PSM	YHTSQSGDEMTSLSEYVSR	777	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3507.3	37.86858	3	2175.936671	2175.937877	R	M	457	476
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	778	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3813.4	45.61333	4	2963.274494	2963.274343	R	T	88	114
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	779	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3699.4	42.67719	4	2972.319694	2972.324602	K	Q	178	204
PSM	EQFLDGDGWTSR	780	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3707.5	42.8897	2	1489.585847	1489.587489	K	W	25	37
PSM	TSDIFGSPVTATSR	781	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3518.6	38.165	2	1517.672847	1517.676304	K	L	91	105
PSM	DKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	782	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3780.6	44.76445	6	4555.944741	4555.941265	K	R	720	764
PSM	DTCYSPKPSVYLSTPSSASK	783	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3447.3	36.32628	3	2333.952071	2333.952813	K	A	538	558
PSM	ANTTAFLTPLEIK	784	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4149.2	53.31252	2	1577.712647	1577.714343	K	A	558	571
PSM	DNLTLWTSDTQGDEAEAGEGGEN	785	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3929.3	48.5208	3	2407.991171	2407.988786	R	-	223	246
PSM	RASGQAFELILSPR	786	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3753.2	44.07418	3	1623.812471	1623.813407	K	S	14	28
PSM	RASGQAFELILSPR	787	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3745.2	43.86583	3	1623.812471	1623.813407	K	S	14	28
PSM	DDGLFSGDPNWFPK	788	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4912.2	61.63263	2	1673.676247	1673.676304	R	K	140	154
PSM	RASGQAFELILSPR	789	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3965.2	49.32338	3	1703.780471	1703.779738	K	S	14	28
PSM	DDGLFSGDPNWFPKK	790	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4097.2	52.30503	3	1801.773071	1801.771267	R	S	140	155
PSM	TWTTPEVTSPPPSPR	791	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3509.4	37.92425	2	1811.748847	1811.753248	R	T	125	140
PSM	GPPQSPVFEGVYNNSR	792	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3544.2	38.8317	3	1826.800871	1826.798879	K	M	107	123
PSM	WLDDLLASPPPSGGGAR	793	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4747.2	60.24902	3	1867.792871	1867.790696	R	R	684	701
PSM	HSGGFLSSPADFSQENK	794	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3510.3	37.94685	3	1886.784371	1886.783623	R	A	772	789
PSM	DSGPLPTPPGVSLLGEPPK	795	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4293.2	55.2582	3	1936.953971	1936.954711	K	D	482	501
PSM	PEIVDTCSLASPASVCR	796	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3551.3	39.0184	3	1940.8346	1940.8368	M	T	2	19
PSM	QENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVR	797	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,15-UNIMOD:21,17-UNIMOD:21,26-UNIMOD:4	ms_run[1]:scan=1.1.3579.6	39.7478	4	3923.683694	3923.685663	R	L	257	293
PSM	FDRGYISPYFINTSK	798	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3894.4	47.63807	3	1966.826171	1966.826747	K	G	219	234
PSM	GSLESPATDVFGSTEEGEK	799	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3734.3	43.58678	3	2018.835071	2018.835777	K	R	331	350
PSM	ILATPPQEDAPSVDIANIR	800	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3860.2	46.78937	3	2099.023571	2099.030001	K	M	284	303
PSM	DQPAFTPSGILTPHALGSR	801	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3981.3	49.73913	3	2123.943971	2123.944237	R	N	428	447
PSM	DQLIYNLLKEEQTPQNK	802	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3993.2	49.9859	3	2153.042171	2153.040566	K	I	6	23
PSM	DNLTLWTSDQQDDDGGEGNN	803	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3916.3	48.18383	3	2192.871371	2192.873028	R	-	228	248
PSM	TQDPAKAPNTPDILEIEFKK	804	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3667.2	41.84897	4	2334.149294	2334.150844	K	G	210	230
PSM	GRLTPSPDIIVLSDNEASSPR	805	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3846.2	46.43745	3	2383.079771	2383.082187	R	S	117	138
PSM	DAEKTPAVSISCLELSNNLEK	806	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3851.5	46.56933	3	2397.114071	2397.113473	K	K	458	479
PSM	QSKPVTTPEEIAQVATISANGDK	807	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	38.46515	4	2463.192094	2463.189415	K	E	158	181
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	808	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3476.6	37.08158	3	2619.212171	2619.213536	R	D	175	200
PSM	PVQETQAPESPGENSEQALQTLSPR	809	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3543.5	38.81597	3	2852.2274	2852.2262	M	A	2	27
PSM	FSDCWNTEGSYDCVCSPGYEPVSGAK	810	sp|Q9UHX3|AGRE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3783.5	44.83743	3	3051.137171	3051.139841	K	T	82	108
PSM	EANPTPLTPGASSLSQLGAYLDSDDSNGSN	811	sp|Q9BW85|YJU2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5270.2	64.25868	3	3057.311171	3057.308814	K	-	294	324
PSM	HCGLGFSEVEDHDGEGDVAGDDDDDDDDSPDPESPDDSESDSESEKEESAEELQAAEHPDEVEDPK	812	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	2-UNIMOD:4,29-UNIMOD:21	ms_run[1]:scan=1.1.3695.6	42.57958	6	7236.7182	7236.7042	R	N	99	165
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	813	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3596.6	40.16796	4	3642.458494	3642.458229	K	V	60	92
PSM	QSKPVTTPEEIAQVATISANGDK	814	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3778.2	44.70023	3	2526.1262	2526.1287	K	E	158	181
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	815	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3786.6	44.9183	4	3386.514494	3385.515651	K	A	399	429
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	816	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2914.6	22.5994	4	3087.2924	3087.2954	K	S	145	174
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	817	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3001.6	24.84612	5	3566.433118	3565.448950	K	D	124	155
PSM	ASGVAVSDGVIK	818	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3561.2	39.27467	2	1223.5776	1223.5794	M	V	2	14
PSM	RGGSGSHNWGTVKDELTESPK	819	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3157.6	28.8527	3	2321.046371	2321.043754	K	Y	216	237
PSM	MEGPLSVFGDR	820	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5176.2	63.60732	2	1328.5465	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	821	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4333.3	55.80043	2	1344.5401	1344.5416	-	S	1	12
PSM	YRDVAECGPQQELDLNSPR	822	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3377.5	34.56715	3	2326.002671	2326.004926	K	N	102	121
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	823	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3734.6	43.59678	3	2845.1905	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	824	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3967.5	49.37667	3	2749.2280	2749.2301	-	Y	1	25
PSM	KIFVGGLSPDTPEEK	825	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3568.2	39.44867	3	1775.777171	1775.778400	K	I	183	198
PSM	AADVSVTHRPPLSPK	826	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3216.3	30.38285	3	1695.8335	1695.8340	M	S	2	17
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	827	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3748.4	43.95103	4	2908.394894	2908.396782	R	S	67	92
PSM	CELLSDDSLAVSSPR	828	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3637.3	41.11643	2	1728.744247	1727.743732	K	L	292	307
PSM	SDAAVDTSSEITTK	829	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3181.6	29.47992	2	1465.6746	1465.6779	M	D	2	16
PSM	AVETLSPDWEFDRVDDGSQK	830	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4165.2	53.55352	3	2415.0232	2415.0262	M	I	2	22
PSM	ADDVDQQQTTNTVEEPLDLIR	831	sp|P62310|LSM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4860.2	61.22265	3	2521.1227	2521.1216	M	L	2	23
PSM	SDEFSLADALPEHSPAK	832	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4010.2	50.36817	3	1935.8312	1934.8292	M	T	2	19
PSM	VEIIANDQGNR	833	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2951.4	23.54523	2	1227.616447	1227.620764	R	I	50	61
PSM	TDYNASVSVPDSSGPER	834	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3196.3	29.86075	3	1859.759471	1859.757467	R	I	70	87
PSM	GPSTPKSPGASNFSTLPK	835	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3293.2	32.37665	3	1931.842571	1931.843126	R	I	223	241
PSM	SSPNPFVGSPPK	836	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3236.3	30.90757	2	1292.578647	1292.580219	K	G	393	405
PSM	SSPNPFVGSPPK	837	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3244.3	31.1166	2	1292.578647	1292.580219	K	G	393	405
PSM	TREAQQALGSAAADATEAK	838	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3210.4	30.22958	3	1967.889371	1967.894964	K	N	1405	1424
PSM	GLLSGQTSPTNAK	839	sp|Q969J3|BORC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3094.2	27.23538	2	1352.629647	1352.633711	K	L	68	81
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	840	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3374.4	34.48592	4	2717.306494	2717.307830	R	R	31	56
PSM	SPAVATSTAAPPPPSSPLPSK	841	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3154.4	28.76838	3	2038.993571	2038.997638	K	S	439	460
PSM	TFDQLTPEESK	842	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3150.4	28.66867	2	1373.573647	1373.575193	K	E	60	71
PSM	SSDQPLTVPVSPK	843	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3303.6	32.65052	2	1433.677647	1433.680327	K	F	728	741
PSM	NSGSFPSPSISPR	844	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3409.5	35.3988	2	1491.578847	1491.579641	R	-	1258	1271
PSM	GEATVSFDDPPSAK	845	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3236.5	30.91423	2	1499.614447	1499.618120	K	A	335	349
PSM	AGDLLEDSPKRPK	846	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2925.4	22.87193	3	1504.728071	1504.728674	R	E	158	171
PSM	SGSSSPDSEITELK	847	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3327.5	33.2714	2	1515.631847	1515.634164	R	F	571	585
PSM	ELSDQATASPIVAR	848	sp|Q5JSH3|WDR44_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3157.5	28.84937	2	1536.716847	1536.718503	K	T	88	102
PSM	VPSPLEGSEGDGDTD	849	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3320.5	33.08843	2	1553.575247	1553.577043	K	-	413	428
PSM	GIETPQCDQSTGQCVCVEGVEGPRCDK	850	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,7-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=1.1.3312.6	32.88303	4	3145.260894	3145.261036	R	C	1138	1165
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	851	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3398.6	35.1137	6	4716.096741	4716.094806	K	A	530	573
PSM	LTFDSSFSPNTGKK	852	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3388.2	34.84107	3	1607.721671	1607.723254	K	N	97	111
PSM	SSPGSPQSPSSGAEAADEDSNDSPASSSSRPLK	853	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3020.4	25.33842	4	3268.368894	3268.364098	K	V	297	330
PSM	ADLNQGIGEPQSPSR	854	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3089.6	27.11447	2	1647.722447	1647.725379	R	R	63	78
PSM	GLGKPGGQGDAIQLSPK	855	sp|Q5VV41|ARHGG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3194.2	29.80497	3	1701.844571	1701.845101	K	L	160	177
PSM	KVPQVSTPTLVEVSR	856	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3381.3	34.66372	3	1718.895671	1718.896802	K	N	438	453
PSM	LKGEATVSFDDPPSAK	857	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3192.4	29.75972	3	1740.795671	1740.797147	K	A	333	349
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	858	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3350.6	33.87505	3	2621.136671	2621.141158	K	I	50	74
PSM	FSEGVLQSPSQDQEK	859	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3253.4	31.35452	3	1757.748671	1757.750926	R	L	428	443
PSM	ATEPPSPDAGELSLASR	860	sp|Q8IYB8|SUV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3416.2	35.5722	3	1776.791771	1776.793125	K	L	720	737
PSM	ADLNQGIGEPQSPSRR	861	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2994.2	24.652	4	1803.825694	1803.826490	R	V	63	79
PSM	HASSSPESPKPAPAPGSHR	862	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2490.2	16.37395	4	1975.890494	1975.890153	R	E	433	452
PSM	NRVIGSGCNLDSARFR	863	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3285.6	32.18263	3	1980.839471	1980.839060	K	Y	156	172
PSM	SPAVATSTAAPPPPSSPLPSK	864	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3148.6	28.62502	2	2038.991447	2038.997638	K	S	439	460
PSM	AACPLDSESAEGVVPPASGGGR	865	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3345.4	33.73818	3	2162.926571	2162.930364	K	V	2201	2223
PSM	KLSSWDQAETPGHTPSLR	866	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3299.2	32.53312	4	2168.931294	2168.929315	K	W	214	232
PSM	NVASGGGGVGDGVQEPTTGNWR	867	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3350.3	33.86505	3	2193.941171	2193.944040	K	G	569	591
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	868	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3233.6	30.83928	4	4431.602894	4431.610713	K	A	139	177
PSM	TVGTPIASVPGSTNTGTVPGSEK	869	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3347.5	33.79368	3	2236.060871	2236.062423	R	D	270	293
PSM	DYHFKVDNDENEHQLSLR	870	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3292.2	32.35081	4	2258.037294	2258.035223	K	T	28	46
PSM	NNEESPTATVAEQGEDITSKK	871	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3263.5	31.61993	3	2327.012471	2327.016595	K	D	9	30
PSM	GSLAEAVGSPPPAATPTPTPPTR	872	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3414.6	35.5333	3	2331.051371	2331.054910	R	K	446	469
PSM	QIDSSPVGGETDETTVSQNYR	873	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3254.5	31.38467	3	2361.987671	2361.996194	K	G	565	586
PSM	ITRKPVTVSPTTPTSPTEGEAS	874	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3042.5	25.9086	3	2415.094871	2415.097168	R	-	502	524
PSM	ELEREESGAAESPALVTPDSEK	875	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3163.6	29.00983	3	2503.040171	2503.040441	K	S	173	195
PSM	EEGSSDEISSGVGDSESEGLNSPVK	876	sp|P52701|MSH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3316.5	32.98342	3	2574.046271	2574.049412	K	V	271	296
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	877	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2864.3	21.3509	3	2611.088471	2611.085754	K	L	460	485
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	878	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3366.6	34.28322	3	2621.136671	2621.141158	K	I	50	74
PSM	SISQSSTDSYSSAASYTDSSDDEVSPREK	879	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3221.6	30.5239	3	3165.275171	3165.278302	R	Q	66	95
PSM	AAPEASSPPASPLQHLLPGK	880	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3832.2	46.09875	4	2126.980894	2126.980288	K	A	686	706
PSM	IADPEHDHTGFLTEYVATR	881	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3605.3	40.3942	4	2330.956494	2330.961009	R	W	190	209
PSM	SSSSESEDEDVIPATQCLTPGIR	882	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3692.3	42.49148	4	2557.084494	2557.089109	R	T	996	1019
PSM	TDGFAEAIHSPQVAGVPR	883	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3522.2	38.25447	3	1930.891871	1930.893842	R	F	2146	2164
PSM	DAGQISGLNVLR	884	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3779.3	44.72906	2	1321.637447	1321.639131	K	V	207	219
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	885	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3528.4	38.41898	4	2654.187294	2654.189112	K	K	453	479
PSM	SILSPGGSCGPIK	886	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3489.2	37.40172	2	1351.620047	1351.620704	R	V	207	220
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	887	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3908.2	47.9634	5	3465.491618	3465.481982	K	A	399	429
PSM	IMNTFSVVPSPK	888	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3712.4	43.01635	2	1398.659447	1398.661840	R	V	163	175
PSM	IMNTFSVVPSPK	889	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3827.3	45.97685	2	1478.626847	1478.628171	R	V	163	175
PSM	GNPTVEVDLFTSK	890	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3790.3	45.01192	2	1485.673247	1485.675241	R	G	16	29
PSM	DVNSSSPVMLAFK	891	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3617.4	40.71292	2	1489.649047	1489.652398	K	S	28	41
PSM	TPEELDDSDFETEDFDVR	892	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3958.4	49.19168	3	2237.851571	2237.852550	R	S	634	652
PSM	TGTAEMSSILEER	893	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3681.4	42.20795	2	1502.629647	1502.632390	K	I	46	59
PSM	QQPPEPEWIGDGESTSPSDK	894	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3526.5	38.36982	3	2262.930371	2262.931803	K	V	7	27
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	895	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3935.2	48.64755	4	3032.288094	3032.284194	K	I	350	377
PSM	TTPSVVAFTADGER	896	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3555.4	39.12548	2	1529.674047	1529.676304	R	L	86	100
PSM	TQVLSPDSLFTAK	897	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4220.2	54.31975	2	1565.675047	1565.677958	K	F	1717	1730
PSM	ISMQDVDLSLGSPK	898	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3891.6	47.56695	2	1568.712447	1568.715726	K	L	500	514
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	899	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3691.5	42.4721	5	3932.710618	3932.709658	K	T	6	40
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	900	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3606.6	40.42997	4	3246.387294	3246.383770	K	V	233	262
PSM	DHMVSPTAVAFLER	901	sp|O60499|STX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3880.2	47.26867	3	1651.739771	1651.742944	K	N	104	118
PSM	NRPTSISWDGLDSGK	902	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3533.2	38.54358	3	1711.757471	1711.756680	K	L	48	63
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	903	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3885.5	47.40848	4	3522.473694	3522.472617	K	F	604	634
PSM	DDGLFSGDPNWFPKK	904	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4080.2	51.89893	3	1801.773071	1801.771267	R	S	140	155
PSM	RTLDFDPLLSPASPK	905	sp|Q53H80|AKIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4144.2	53.1849	3	1815.817271	1815.820934	K	R	9	24
PSM	DRSSFYVNGLTLGGQK	906	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3706.2	42.8532	3	1820.843471	1820.845829	K	C	55	71
PSM	SYELPDGQVITIGNER	907	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4095.2	52.254	3	1869.849971	1869.850974	K	F	241	257
PSM	VQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVK	908	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3649.4	41.40837	4	3939.728894	3939.727022	K	D	2008	2043
PSM	DNLTLWTSDQQDEEAGEGN	909	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3867.2	46.93168	3	2120.872871	2120.877051	R	-	228	247
PSM	DQLIYNLLKEEQTPQNK	910	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4003.2	50.20452	3	2153.042171	2153.040566	K	I	6	23
PSM	SGSSSPDSEITELKFPSINHD	911	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3909.5	47.99957	3	2325.998471	2326.000217	R	-	571	592
PSM	QLSSTSPLAPYPTSQMVSSDR	912	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3802.4	45.33338	3	2411.013371	2411.011724	R	S	408	429
PSM	VLENAEGARTTPSVVAFTADGER	913	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3530.6	38.47849	3	2469.153071	2469.153698	K	L	77	100
PSM	ADLLLSTQPGREEGSPLELER	914	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3897.5	47.71903	3	2469.117371	2469.118966	K	L	593	614
PSM	VLENAEGARTTPSVVAFTADGER	915	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3528.6	38.42565	3	2549.119871	2549.120029	K	L	77	100
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	916	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3912.2	48.0703	4	3465.488094	3465.481982	K	A	399	429
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	917	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3468.2	36.85877	4	2619.213294	2619.213536	R	D	175	200
PSM	MSESPTPCSGSSFEETEALVNTAAK	918	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3920.4	48.28755	3	2709.116471	2709.118694	R	N	2566	2591
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	919	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21,22-UNIMOD:35,26-UNIMOD:21	ms_run[1]:scan=1.1.4949.2	61.95878	3	2968.329971	2968.325196	R	S	59	86
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	920	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3590.3	40.00422	4	3062.403694	3062.401610	K	S	2194	2221
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	921	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3895.3	47.66392	4	3465.488094	3465.481982	K	A	399	429
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	922	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3625.3	40.91385	5	3464.573618	3464.574823	K	E	218	249
PSM	QSKPVTTPEEIAQVATISANGDK	923	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,18-UNIMOD:21	ms_run[1]:scan=1.1.3736.5	43.64457	3	2446.1578	2446.1623	K	E	158	181
PSM	DDDIAALVVDNGSGMCK	924	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4293.3	55.2682	2	1820.7915	1820.7915	M	A	2	19
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	925	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3714.6	43.07557	3	2835.272771	2835.274618	R	T	350	376
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	926	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3015.6	25.20895	5	3566.434118	3565.448950	K	D	124	155
PSM	NGSLDSPGKQDTEEDEEEDEK	927	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2907.5	22.44553	3	2430.912371	2429.923149	K	D	134	155
PSM	AESSESFTMASSPAQR	928	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3213.6	30.31462	2	1822.7054	1822.7076	M	R	2	18
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDK	929	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,43-UNIMOD:21	ms_run[1]:scan=1.1.3556.6	39.15875	5	4593.1186	4593.1139	M	K	2	53
PSM	ADQLTEEQIAEFK	930	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3905.3	47.91433	2	1562.7441	1562.7459	M	E	2	15
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	931	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3926.2	48.43237	4	2749.2308	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	932	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3759.6	44.24338	3	2845.1899	2845.1913	-	Y	1	25
PSM	AAAAAAAAVPSAGPAGPAPTSAAGR	933	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3204.5	30.07605	3	2190.986471	2190.982413	R	T	694	719
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	934	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3240.5	31.01895	4	3093.273694	3093.277137	R	-	738	768
PSM	QQPPEPEWIGDGESTSPSDK	935	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.3855.2	46.67363	3	2245.9030	2245.9047	K	V	7	27
PSM	GGLNTPLHESDFSGVTPQR	936	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3477.4	37.10177	3	2090.938571	2090.942249	K	Q	381	400
PSM	WLKSPTTPIDPEK	937	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3431.2	35.96568	3	1670.735471	1670.735807	K	Q	859	872
PSM	LGAGGGSPEKSPSAQELK	938	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2957.3	23.69637	3	1791.836171	1791.840409	R	E	13	31
PSM	AASPPASASDLIEQQQK	939	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3388.3	34.8444	3	1819.832171	1819.835324	R	R	333	350
PSM	NTCPGDRSAITPGGLR	940	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3125.4	28.02222	3	1830.745271	1830.748514	K	L	410	426
PSM	PGPTPSGTNVGSSGRSPSK	941	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2747.2	18.70577	3	1848.8360	1848.8362	M	A	2	21
PSM	IVRGDQPAASGDSDDDEPPPLPR	942	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3193.2	29.77922	4	2483.098494	2483.096577	K	L	45	68
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	943	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3322.4	33.13743	4	2494.088494	2494.089063	R	L	815	839
PSM	DCAVKPCQSDEVPDGIKSASYK	944	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3194.5	29.81497	4	2533.087294	2533.086607	R	Y	98	120
PSM	NGLAAELGPASPR	945	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3342.4	33.65943	2	1331.621247	1331.623480	R	R	91	104
PSM	DGGRSSPGGQDEGGFMAQGK	946	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3063.4	26.43635	3	2016.795971	2016.799683	R	T	298	318
PSM	QQAGAQGPGSADLEDGEMGK	947	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3160.3	28.92222	3	2024.812871	2024.814665	R	R	1064	1084
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	948	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3398.3	35.1037	4	2727.235694	2727.234862	R	G	70	97
PSM	HSPNLSFEPNFCQDNPRSPTSSK	949	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3417.3	35.60137	4	2725.158894	2725.159194	K	E	107	130
PSM	AVADAIRTSLGPK	950	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3204.4	30.07272	2	1377.699047	1377.701731	K	G	43	56
PSM	ASEAKEGEEAGPGDPLLEAVPKTGDEK	951	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	34.87317	4	2803.278494	2803.280080	K	D	348	375
PSM	EALSPCPSTVSTK	952	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2996.4	24.71658	2	1455.631447	1455.631662	R	S	670	683
PSM	AQAAAPASVPAQAPK	953	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2917.5	22.67395	2	1456.705447	1456.707544	K	R	135	150
PSM	STTPPPAEPVSLPQEPPKPR	954	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3292.4	32.35748	3	2204.086871	2204.087850	K	V	225	245
PSM	KLEDVKNSPTFK	955	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2914.4	22.59273	3	1484.729771	1484.727611	K	S	164	176
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	956	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3370.6	34.3881	4	2991.330094	2991.328110	R	V	221	251
PSM	GEATVSFDDPPSAK	957	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3244.4	31.11993	2	1499.614447	1499.618120	K	A	335	349
PSM	DVSGPMPDSYSPR	958	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.3016.5	25.23168	2	1502.572247	1502.574876	K	Y	291	304
PSM	RVEPGSPAEAAALR	959	sp|Q15599|NHRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3069.2	26.58335	3	1502.724071	1502.724257	R	A	38	52
PSM	NHCGIASAASYPTV	960	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3434.5	36.05383	2	1526.617447	1526.622494	R	-	320	334
PSM	NGRVEIIANDQGNR	961	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2915.4	22.61885	3	1554.785471	1554.786266	K	I	47	61
PSM	LAVDEEENADNNTK	962	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2863.6	21.32695	2	1560.690647	1560.690360	K	A	40	54
PSM	NIIHGSDSVKSAEK	963	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2817.2	20.19648	3	1563.728471	1563.729402	R	E	100	114
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	964	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3276.5	31.9497	4	3162.496094	3162.502310	K	E	179	210
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	965	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3177.5	29.37228	4	3290.595694	3290.597273	K	E	178	210
PSM	AAFTTPDHAPLSPQSSVASSGSEQTEEQGSSR	966	sp|Q5PRF9|SMAG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3350.4	33.86838	4	3325.433694	3325.437203	R	N	260	292
PSM	IDEMPEAAVKSTANK	967	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3080.2	26.86798	3	1682.754971	1682.758653	R	Y	30	45
PSM	ENVNATENCISAVGK	968	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3167.4	29.1077	2	1684.706247	1684.712766	K	I	964	979
PSM	KPAAAAAPGTAEKLSPK	969	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2813.2	20.10028	3	1686.872771	1686.870587	K	A	23	40
PSM	KPAAAAAPGTAEKLSPK	970	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2822.2	20.31765	3	1686.872771	1686.870587	K	A	23	40
PSM	IDEMPEAAVKSTANK	971	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3077.3	26.79365	3	1762.724771	1762.724984	R	Y	30	45
PSM	SSDEENGPPSSPDLDR	972	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2980.4	24.29655	3	1780.678571	1780.678883	R	I	202	218
PSM	LSESSALKQPATPTAAESSEGEGEEGDDGGETESR	973	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3145.6	28.54887	4	3587.486094	3587.490814	R	E	74	109
PSM	SETSVANGSQSESSVSTPSASFEPNNTCENSQSR	974	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3240.6	31.02228	4	3641.467294	3641.469702	K	N	117	151
PSM	HTGPNSPDTANDGFVR	975	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3072.5	26.6702	3	1843.693871	1843.692773	K	L	99	115
PSM	TSSVSNPQDSVGSPCSR	976	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2883.2	21.83078	3	1843.740971	1843.740772	K	V	94	111
PSM	GVQVETISPGDGRTFPK	977	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3363.3	34.19567	3	1866.8825	1866.8872	M	R	2	19
PSM	RQQDPSPGSNLGGGDDLK	978	sp|Q13951-2|PEBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3002.3	24.87242	3	1919.836871	1919.837449	R	L	168	186
PSM	SSGSPYGGGYGSGGGSGGYGSR	979	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3032.6	25.65103	2	1989.750047	1989.749028	R	R	355	377
PSM	LREQDCGEPASPAASISR	980	sp|O60353|FZD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2981.4	24.32902	3	2022.875771	2022.883019	R	L	610	628
PSM	FIHQQPQSSSPVYGSSAK	981	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2976.5	24.19632	3	2026.914971	2026.914971	R	T	76	94
PSM	AIGSASEGAQSSLQEVYHK	982	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3393.4	34.9769	3	2040.913871	2040.915365	R	S	169	188
PSM	GPPASSPAPAPKFSPVTPK	983	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3377.3	34.56048	3	2071.881971	2071.882228	R	F	254	273
PSM	SAESPTSPVTSETGSTFKK	984	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3274.3	31.89348	3	2099.867771	2099.870128	K	F	280	299
PSM	GGNFGGRSSGPYGGGGQYFAK	985	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3333.2	33.41822	4	2099.888894	2099.885068	K	P	278	299
PSM	QISSSSTGCLSSPNATVQSPK	986	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3122.6	27.951	3	2214.975971	2214.982793	K	H	266	287
PSM	YGVQADRVDKSAVGFDYQGK	987	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3327.6	33.27473	3	2282.035871	2282.036877	K	T	162	182
PSM	NNEESPTATVAEQGEDITSKK	988	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3255.5	31.41062	3	2327.012471	2327.016595	K	D	9	30
PSM	DTSSITSCGDGNVVKQEQLSPK	989	sp|Q9Y6Q9|NCOA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3223.5	30.57288	3	2429.076071	2429.078150	K	K	709	731
PSM	SISSPSVSSETMDKPVDLSTRK	990	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3268.2	31.73985	4	2430.129294	2430.134936	K	E	2802	2824
PSM	DAAASASTPAQAPTSDSPVAEDASR	991	sp|P55789|ALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3079.6	26.85578	3	2452.035371	2452.039122	R	R	43	68
PSM	LDNTPASPPRSPAEPNDIPIAK	992	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3403.5	35.24138	3	2459.110571	2459.113487	K	G	2311	2333
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	993	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3267.6	31.72737	3	3722.192171	3722.195067	K	A	158	190
PSM	ELEREESGAAESPALVTPDSEK	994	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3155.6	28.80078	3	2503.040171	2503.040441	K	S	173	195
PSM	MAEESSSSSSSSSPTAATSQQQQLK	995	sp|Q13620|CUL4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2913.5	22.57397	3	2623.096871	2623.095650	K	N	134	159
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	996	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2819.3	20.24782	4	3024.356094	3024.356099	K	S	145	174
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	997	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3348.6	33.82335	4	3431.362894	3431.367542	R	A	108	139
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	998	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3286.5	32.20505	4	3704.513294	3704.512278	K	-	158	196
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	999	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3045.6	25.99067	4	3793.540894	3793.546038	K	R	142	179
PSM	DVQTALALAK	1000	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3655.2	41.54652	2	1108.551647	1108.552941	K	G	70	80
PSM	AIVDALPPPCESACTVPTDVDK	1001	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3708.2	42.90545	4	2434.073294	2434.079730	R	W	261	283
PSM	SADTLWDIQK	1002	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3754.3	44.10392	2	1255.546247	1255.548584	K	D	320	330
PSM	SSSSESEDEDVIPATQCLTPGIR	1003	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3691.2	42.4621	4	2557.084494	2557.089109	R	T	996	1019
PSM	SSSSESEDEDVIPATQCLTPGIR	1004	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3693.4	42.52045	4	2557.084494	2557.089109	R	T	996	1019
PSM	DSGFTIVSPLDI	1005	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5922.2	68.70361	2	1342.606647	1342.605765	K	-	784	796
PSM	IMNTFSVVPSPK	1006	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3688.4	42.39088	2	1398.659447	1398.661840	R	V	163	175
PSM	IMNTFSVVPSPK	1007	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3696.5	42.60212	2	1398.659447	1398.661840	R	V	163	175
PSM	GLFSANDWQCK	1008	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3892.2	47.57947	2	1404.550847	1404.553352	R	T	62	73
PSM	DVEDFLSPLLGK	1009	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.5978.2	69.09702	2	1411.664847	1411.663614	K	T	123	135
PSM	TVIIEQSWGSPK	1010	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3554.4	39.10007	2	1423.672647	1423.674847	R	V	61	73
PSM	TSSLAPVVGTTTTTPSPSAIK	1011	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3616.3	40.68248	3	2175.012371	2175.011313	K	A	226	247
PSM	NLEQILNGGESPK	1012	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3787.5	44.94085	2	1477.678247	1477.681389	K	Q	219	232
PSM	IMNTFSVVPSPK	1013	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3819.4	45.76887	2	1478.626847	1478.628171	R	V	163	175
PSM	SSVSRVPCNVEGISPELEK	1014	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3525.4	38.33973	3	2245.966271	2245.969131	K	V	290	309
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	1015	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3873.4	47.10025	4	3013.336494	3013.339266	K	V	8	36
PSM	GASSPLITVFTDDK	1016	sp|Q15155|NOMO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4010.3	50.37483	2	1529.699647	1529.701456	K	G	822	836
PSM	GYISPYFINTSK	1017	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4007.2	50.28995	2	1548.627847	1548.630279	R	G	222	234
PSM	DEILPTTPISEQK	1018	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3475.4	37.0492	2	1549.725047	1549.727671	K	G	215	228
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRK	1019	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4132.5	52.87873	4	3109.364894	3109.368258	R	A	139	166
PSM	TKEVYELLDSPGK	1020	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3506.3	37.84185	3	1557.731471	1557.732756	K	V	18	31
PSM	GNPTVEVDLFTSK	1021	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3940.2	48.75702	2	1565.638047	1565.641572	R	G	16	29
PSM	GNPTVEVDLFTSK	1022	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3958.5	49.19835	2	1565.638047	1565.641572	R	G	16	29
PSM	QDLESSVQSSPHDSIAIIPPPQSTKPGR	1023	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	39.25268	4	3130.436894	3130.437341	K	G	414	442
PSM	KKSPNELVDDLFK	1024	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3701.2	42.72287	3	1611.787571	1611.790940	R	G	112	125
PSM	AQQATPGGAAPTIFSR	1025	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3455.4	36.52778	2	1651.767447	1651.771936	K	I	43	59
PSM	VGPATPSAQVGKWEEDSESSSEESSDSSDGEVPTAVAPAQEK	1026	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3621.5	40.82042	5	4340.860118	4340.860555	K	S	529	571
PSM	AAALAAAVAQDPAASGAPSS	1027	sp|Q8TAE8|G45IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3497.2	37.6029	3	1775.808671	1775.809109	R	-	203	223
PSM	AQSPGAVEEILDRENK	1028	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3587.2	39.92837	3	1834.845071	1834.846223	R	R	7	23
PSM	GADFLVTEVENGGSLGSK	1029	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3961.2	49.26648	3	1858.836071	1858.834990	K	K	189	207
PSM	GADFLVTEVENGGSLGSK	1030	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4046.2	51.1349	3	1858.837871	1858.834990	K	K	189	207
PSM	WLDDLLASPPPSGGGAR	1031	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4630.2	59.0169	3	1867.792871	1867.790696	R	R	684	701
PSM	YFQINQDEEEEEDED	1032	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3485.6	37.31712	2	1930.719847	1930.722842	R	-	114	129
PSM	PEIVDTCSLASPASVCR	1033	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3559.3	39.22612	3	1940.8346	1940.8368	M	T	2	19
PSM	TVQGPPTSDDIFEREYK	1034	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3536.4	38.62852	3	2060.911271	2060.909217	K	Y	33	50
PSM	DNLTLWTSDQQDDDGGEGNN	1035	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3951.3	49.03462	3	2192.871971	2192.873028	R	-	228	248
PSM	ESMCSTPAFPVSPETPYVK	1036	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3900.3	47.78845	3	2285.903171	2285.902691	K	T	839	858
PSM	DLYANTVLSGGTTMYPGIADR	1037	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3950.5	49.00552	3	2310.022271	2310.023930	K	M	292	313
PSM	GSPLNAAPYGIESMSQDTEVR	1038	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3533.6	38.55692	3	2316.988271	2316.993358	K	S	351	372
PSM	VAASPKSPTAALNESLVECPK	1039	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,7-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3601.6	40.29915	3	2328.045371	2328.047382	K	C	422	443
PSM	DNLTLWTSENQGDEGDAGEGEN	1040	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3843.3	46.36855	3	2349.947171	2349.946922	R	-	225	247
PSM	SAMDSPVPASMFAPEPSSPGAAR	1041	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4008.2	50.31577	3	2418.965771	2418.962665	R	A	8	31
PSM	SQEGESVTEDISFLESPNPENK	1042	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4015.6	50.5112	3	2515.061471	2515.063940	K	D	81	103
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1043	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3657.2	41.59527	4	2574.001294	2573.998594	R	G	239	267
PSM	NSHELGPCPEDGSDAPLEDSTADAAASPGP	1044	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.3502.6	37.74753	3	3043.205171	3043.202635	R	-	1493	1523
PSM	MLAESDESGDEESVSQTDKTELQNTLR	1045	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3709.5	42.94175	3	3171.284171	3171.283996	K	T	186	213
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	1046	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:4,17-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3700.6	42.70942	4	3544.540894	3544.541154	K	E	218	249
PSM	DDDIAALVVDNGSGMCK	1047	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4241.2	54.58078	3	1916.7533	1916.7528	M	A	2	19
PSM	AIVDALPPPCESACTVPTDVDK	1048	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3678.3	42.12718	4	2434.073294	2434.079730	R	W	261	283
PSM	MDSAGQDINLNSPNK	1049	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3239.5	30.9929	2	1740.6974	1740.7021	-	G	1	16
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1050	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4097.3	52.31503	3	2829.1987	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1051	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3927.3	48.46157	4	2749.2308	2749.2301	-	Y	1	25
PSM	SSIGTGYDLSASTFSPDGR	1052	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.4038.2	51.00212	3	2038.8530	2038.8516	M	V	2	21
PSM	AIEINPDSAQPYK	1053	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3348.5	33.82001	2	1524.683047	1524.686140	R	W	174	187
PSM	TEWETAAPAVAETPDIK	1054	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4046.3	51.1449	3	2029.8341	2029.8318	M	L	2	19
PSM	SHPSPQAKPSNPSNPR	1055	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2678.2	17.90688	3	1821.8137	1821.8154	M	V	2	18
PSM	AALGHLAGEAAAAPGPGTPCASR	1056	sp|Q9H7E9|CH033_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,18-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.3690.3	42.4391	3	2224.0052	2224.0091	M	G	2	25
PSM	MNPVYSPGSSGVPYANAK	1057	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3603.3	40.34101	3	1975.8353	1975.8382	-	G	1	19
PSM	MEPSSLELPADTVQR	1058	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.4013.2	50.45928	3	1793.7947	1793.7902	-	I	1	16
PSM	MNLLPNIESPVTRQEK	1059	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4340.2	55.88437	3	1989.9590	1989.9590	-	M	1	17
PSM	AASEAAVVSSPSLK	1060	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3437.4	36.12602	2	1437.6705	1437.6747	M	T	2	16
PSM	HELQANCYEEVK	1061	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2957.2	23.69303	3	1518.674771	1518.677293	K	D	133	145
PSM	GHASAPYFGKEEPSVAPSSTGK	1062	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3134.2	28.25108	4	2283.017694	2283.020893	K	T	131	153
PSM	GASLKSPLPSQ	1063	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3129.5	28.13045	2	1163.553847	1163.558755	K	-	113	124
PSM	LITPAVVSER	1064	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3401.2	35.17902	2	1163.593447	1163.595140	K	L	67	77
PSM	LEGQGDVPTPK	1065	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2975.3	24.16372	2	1219.546847	1219.548584	K	Q	257	268
PSM	NCQTVLAPCSPNPCENAAVCK	1066	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3305.2	32.68922	4	2468.990894	2468.994638	K	E	829	850
PSM	STGCDFAVSPK	1067	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3115.4	27.76195	2	1247.486447	1247.489355	K	L	501	512
PSM	DAINQGMDEELERDEK	1068	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3308.2	32.7674	3	1890.830471	1890.826536	R	V	37	53
PSM	ALINSPEGAVGR	1069	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3309.2	32.79305	2	1262.600247	1262.602017	R	S	66	78
PSM	VLDTSSLTQSAPASPTNK	1070	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3266.3	31.69142	3	1895.884871	1895.887753	R	G	850	868
PSM	KPQEEDSPGPSTSSVLK	1071	sp|Q9BQE4|SELS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2970.5	24.04003	3	1944.808871	1944.811885	K	R	134	151
PSM	DGARPDVTESESGSPEYR	1072	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2957.5	23.70303	3	1950.850871	1950.855528	K	Q	425	443
PSM	DQVANSAFVER	1073	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3150.3	28.66533	2	1314.555447	1314.560546	K	L	500	511
PSM	DQVANSAFVER	1074	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3142.5	28.46748	2	1314.555447	1314.560546	K	L	500	511
PSM	YALYDATYETK	1075	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3348.3	33.81335	2	1336.615047	1336.618698	R	E	82	93
PSM	TPKGPSSVEDIK	1076	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2968.5	23.98845	2	1336.623647	1336.627563	K	A	237	249
PSM	ELASPVSPELR	1077	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3404.2	35.25717	2	1356.571847	1356.572764	K	Q	175	186
PSM	SPAVATSTAAPPPPSSPLPSK	1078	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3162.6	28.98393	3	2038.993571	2038.997638	K	S	439	460
PSM	ELISNSSDALDK	1079	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3237.2	30.93073	2	1370.591047	1370.596657	R	I	47	59
PSM	QAGGFLGPPPPSGK	1080	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3296.4	32.46152	2	1388.646647	1388.648967	K	F	224	238
PSM	SSPSARPPDVPGQQPQAAKSPSPVQGK	1081	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2966.3	23.93305	4	2777.342894	2777.349772	R	K	82	109
PSM	GILAADESTGSIAK	1082	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3262.4	31.58998	2	1411.655647	1411.659591	K	R	29	43
PSM	TPAAAAAMNLASPR	1083	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3319.5	33.06244	2	1420.649847	1420.653400	R	T	2261	2275
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1084	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3154.5	28.77172	4	2914.282094	2914.285140	K	L	281	308
PSM	VSDPISTSESSEEEEEAEAETAKATPR	1085	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3380.3	34.6379	4	2958.251294	2958.250297	R	L	78	105
PSM	PCSEETPAISPSK	1086	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2926.6	22.90443	2	1481.6085	1481.6104	M	R	2	15
PSM	DVSGPMPDSYSPR	1087	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3259.4	31.5118	2	1486.576447	1486.579961	K	Y	291	304
PSM	AMSTTSISSPQPGK	1088	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.2767.4	19.11113	2	1486.634047	1486.637476	R	L	267	281
PSM	SSDQPLTVPVSPK	1089	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3359.5	34.10233	2	1513.642047	1513.646658	K	F	728	741
PSM	SLPTTVPESPNYR	1090	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3310.4	32.82513	2	1539.695047	1539.697039	R	N	766	779
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	1091	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	27-UNIMOD:21	ms_run[1]:scan=1.1.2912.5	22.54575	4	3173.334094	3173.326984	K	E	337	367
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	1092	sp|Q9Y478|AAKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,9-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3351.5	33.89803	4	3213.339694	3213.342046	K	F	173	200
PSM	TAADVVSPGANSVDSR	1093	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3024.6	25.4424	2	1624.714247	1624.709395	K	V	1000	1016
PSM	ESLKEEDESDDDNM	1094	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2929.6	22.98217	2	1654.613047	1654.615206	K	-	242	256
PSM	LEAIEDDSVKETDSSSASAATPSK	1095	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3090.6	27.13875	3	2517.102971	2517.100719	K	K	215	239
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEK	1096	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3237.5	30.94073	4	3353.646094	3353.650431	K	K	62	99
PSM	GLGKPGGQGDAIQLSPK	1097	sp|Q5VV41|ARHGG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3186.3	29.59952	3	1701.844571	1701.845101	K	L	160	177
PSM	NILLTNEQLESARK	1098	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	34.14233	3	1707.852371	1707.855665	R	I	36	50
PSM	NLDIERPTYTNLNR	1099	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3334.2	33.44433	3	1717.875071	1717.874747	R	L	216	230
PSM	NLDIERPTYTNLNR	1100	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3326.5	33.24522	3	1717.875071	1717.874747	R	L	216	230
PSM	ALSRQEMQEVQSSR	1101	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2965.6	23.91398	3	1727.762771	1727.766198	K	S	187	201
PSM	EQGPYETYEGSPVSK	1102	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3140.6	28.41882	2	1749.707847	1749.713477	K	G	549	564
PSM	HAEPLTDTGSETPTAR	1103	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2884.3	21.84658	3	1761.754871	1761.757074	K	R	51	67
PSM	ATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEK	1104	sp|O95361|TRI16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3407.5	35.34635	4	3545.523694	3545.520658	R	L	15	51
PSM	AQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSR	1105	sp|Q9NRR5|UBQL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3189.6	29.6875	5	4489.969118	4489.963063	K	R	88	137
PSM	VQEKPDSPGGSTQIQR	1106	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2794.3	19.62802	3	1805.829971	1805.830907	R	Y	1284	1300
PSM	HIAEEADRKYEEVAR	1107	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2961.2	23.79645	4	1814.888094	1814.891125	K	K	154	169
PSM	IGRIEDVTPIPSDSTR	1108	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3271.3	31.81898	3	1834.878371	1834.882608	K	R	126	142
PSM	DLEVTCDPDSGGSQGLR	1109	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3356.4	34.02357	3	1884.758171	1884.756088	R	G	1319	1336
PSM	IGRIEDVTPIPSDSTR	1110	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3337.5	33.53208	3	1914.847271	1914.848939	K	R	126	142
PSM	SERPPTILMTEEPSSPK	1111	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3383.4	34.71928	3	1977.909371	1977.911860	K	G	1080	1097
PSM	DGARPDVTESESGSPEYR	1112	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2985.5	24.4292	3	2030.820071	2030.821859	K	Q	425	443
PSM	KPVTVSPTTPTSPTEGEAS	1113	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3057.4	26.28753	3	2044.862771	2044.864315	R	-	505	524
PSM	SHSPSSPDPDTPSPVGDSR	1114	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2882.5	21.80523	3	2080.777871	2080.777625	R	A	616	635
PSM	AKPSPAPPSTTTAPDASGPQK	1115	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2839.4	20.72522	3	2084.974271	2084.977965	K	R	32	53
PSM	NPQSILKPHSPTYNDEGL	1116	sp|Q9NVA1|UQCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3424.5	35.79155	3	2088.949271	2088.951751	K	-	282	300
PSM	SAESPTSPVTSETGSTFKK	1117	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3262.3	31.58665	3	2099.867771	2099.870128	K	F	280	299
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	1118	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3241.6	31.04838	4	4431.602894	4431.610713	K	A	139	177
PSM	WLNSGRGDEASEEGQNGSSPK	1119	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2985.6	24.43253	3	2283.939371	2283.939348	R	S	447	468
PSM	APVQPQQSPAAAPGGTDEKPSGK	1120	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2792.4	19.58112	4	2297.068094	2297.068906	K	E	9	32
PSM	TEAQDLCRASPEPPGPESSSR	1121	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3034.4	25.69633	3	2349.990071	2349.989669	R	W	663	684
PSM	RSEACPCQPDSGSPLPAEEEK	1122	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2991.6	24.58847	3	2422.974071	2422.977056	R	R	492	513
PSM	QPATPTAAESSEGEGEEGDDGGETESR	1123	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2912.6	22.54908	3	2772.049871	2772.051931	K	E	82	109
PSM	VSDPISTSESSEEEEEAEAETAKATPR	1124	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3375.6	34.51871	3	2958.249971	2958.250297	R	L	78	105
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1125	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2843.4	20.82045	4	3024.361694	3024.356099	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1126	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2818.2	20.22045	5	3104.327618	3104.322430	K	S	145	174
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	1127	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3272.6	31.85397	4	3156.392894	3156.395856	K	G	306	335
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	1128	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3053.6	26.19545	4	3793.540894	3793.546038	K	R	142	179
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	1129	sp|Q99590|SCAFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3228.6	30.70712	4	3927.669694	3927.670193	R	Q	329	367
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	1130	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	37-UNIMOD:35	ms_run[1]:scan=1.1.3061.6	26.39312	4	4447.606894	4447.605628	K	A	139	177
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPKAEDGATPSPSNETPK	1131	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3347.6	33.79702	4	4475.926894	4475.924947	K	K	106	153
PSM	DLNVLTPTGF	1132	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4693.2	59.66283	2	1155.521247	1155.521307	R	-	296	306
PSM	VLLPEYGGTK	1133	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3440.2	36.19142	2	1155.555447	1155.557692	K	V	71	81
PSM	SADTLWDIQK	1134	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3539.3	38.70413	2	1175.582447	1175.582253	K	D	320	330
PSM	RGFFICDQPYEPVSPYSCK	1135	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,14-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3812.3	45.58412	4	2429.014494	2429.022156	R	E	675	694
PSM	NPDDITQEEYGEFYK	1136	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3601.2	40.28582	3	1846.788971	1846.789740	R	S	292	307
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1137	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	46.63468	4	2515.082094	2515.082187	K	A	30	54
PSM	LDIDSPPITAR	1138	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3548.2	38.93647	2	1356.571847	1356.572764	R	N	33	44
PSM	TVDNFVALATGEK	1139	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3618.3	40.73573	2	1443.657047	1443.664677	K	G	72	85
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	1140	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3759.2	44.23005	4	2933.372094	2933.372935	K	V	8	36
PSM	DVSPDLSCADEISECYHK	1141	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3550.4	38.9957	3	2203.842671	2203.843917	K	L	53	71
PSM	EIGINEDQFQEACTSPLAK	1142	sp|Q96G28|CFA36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3707.4	42.88637	3	2228.964671	2228.966080	K	T	71	90
PSM	EQFLDGDGWTSR	1143	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3687.3	42.36133	2	1489.586447	1489.587489	K	W	25	37
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1144	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3550.5	38.99903	4	2989.541294	2989.541321	K	G	202	228
PSM	TSDIFGSPVTATSR	1145	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3526.6	38.37315	2	1517.672847	1517.676304	K	L	91	105
PSM	AHASPFSGALTPSAPPGPEMNR	1146	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3567.5	39.43402	3	2350.986371	2350.980699	R	S	119	141
PSM	ISMQDVDLSLGSPK	1147	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3498.6	37.64273	2	1584.707847	1584.710641	K	L	500	514
PSM	GVVDSEDLPLNISR	1148	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3851.4	46.566	2	1592.742247	1592.744718	R	E	387	401
PSM	DMSPLSETEMALGK	1149	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3859.5	46.77705	2	1603.647247	1603.651077	K	D	505	519
PSM	MQESPKLPQQSYNFDPDTCDESVDPFK	1150	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3937.3	48.70903	4	3281.358894	3281.357027	K	T	2356	2383
PSM	QSKPVTTPEEIAQVATISANGDK	1151	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3612.5	40.58425	3	2463.185771	2463.189415	K	E	158	181
PSM	IFVGGLSPDTPEEK	1152	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3725.6	43.3629	2	1647.681847	1647.683437	K	I	184	198
PSM	DDGLFSGDPNWFPK	1153	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4938.2	61.83382	2	1673.676247	1673.676304	R	K	140	154
PSM	APNTPDILEIEFKK	1154	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3817.2	45.71038	3	1693.831271	1693.832805	K	G	216	230
PSM	RIDFIPVSPAPSPTR	1155	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3827.2	45.97018	3	1811.836871	1811.837252	K	G	136	151
PSM	QVPDSAATATAYLCGVK	1156	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3707.3	42.88303	3	1830.819371	1830.822317	R	A	107	124
PSM	DSLSPVLHPSDLILTR	1157	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4110.2	52.50818	3	1841.928971	1841.928830	K	G	311	327
PSM	FDRGYISPYFINTSK	1158	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3783.2	44.82743	3	1886.859971	1886.860416	K	G	219	234
PSM	DLKPSNLLLNTTCDLK	1159	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3734.2	43.58345	3	1923.937871	1923.937681	R	I	149	165
PSM	IDEPSTPYHSMMGDDEDACSDTEATEAMAPDILAR	1160	sp|P41236|IPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.4092.4	52.18948	4	3920.542494	3920.541018	K	K	68	103
PSM	LDNVPHTPSSYIETLPK	1161	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3702.4	42.75555	3	1989.946571	1989.944874	R	A	45	62
PSM	EAAGGNDSSGATSPINPAVALE	1162	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3805.5	45.41173	2	2106.911447	2106.910674	K	-	1236	1258
PSM	SAGVQCFGPTAEAAQLESSK	1163	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3685.4	42.31262	3	2116.914071	2116.913651	R	R	88	108
PSM	DYEEVGADSADGEDEGEEY	1164	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3509.6	37.93092	2	2157.703447	2157.705945	K	-	431	450
PSM	DNLTLWTSDQQDDDGGEGNN	1165	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3908.4	47.97007	3	2192.871371	2192.873028	R	-	228	248
PSM	SIQTPQSHGTLTAELWDNK	1166	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3666.3	41.82703	3	2205.006671	2205.010328	K	V	1977	1996
PSM	EINAREESLVEELSPASEK	1167	sp|Q9BXK5|B2L13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3543.2	38.80597	3	2209.016471	2209.015139	K	K	413	432
PSM	QFTPCQLLADHANSPNKK	1168	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3507.2	37.86525	4	2227.944894	2227.948671	K	F	743	761
PSM	IADPEHDHTGFLTEYVATR	1169	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3469.4	36.89157	4	2250.992894	2250.994678	R	W	190	209
PSM	QHPQPYIFPDSPGGTSYER	1170	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3525.5	38.34307	3	2254.967171	2254.968463	R	Y	75	94
PSM	EASRPPEEPSAPSPTLPAQFK	1171	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3470.5	36.92105	3	2315.081171	2315.083493	R	Q	351	372
PSM	VKSATLSSTESTASEMQEEMK	1172	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3473.5	36.9996	3	2353.002071	2353.006624	K	G	638	659
PSM	VMTIPYQPMPASSPVICAGGQDR	1173	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3882.5	47.33067	3	2554.138571	2554.141953	R	C	178	201
PSM	QCLEDSDAGASNEYDSSPAAWNK	1174	sp|P46063|RECQ1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3445.5	36.28475	3	2593.988471	2593.990457	K	E	48	71
PSM	FNEEHIPDSPFVVPVASPSGDAR	1175	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3925.3	48.40968	3	2626.113371	2626.114215	K	R	2311	2334
PSM	YDSDGDKSDDLVVDVSNEDPATPR	1176	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3523.6	38.29352	3	2688.106271	2688.107595	R	V	238	262
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	1177	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3598.5	40.21752	4	2756.202094	2756.199676	K	E	296	321
PSM	QREEYQPATPGLGMFVEVKDPEDK	1178	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3780.3	44.75445	4	2842.288094	2842.288477	K	V	72	96
PSM	NEDGTWPRGPSTPKSPGASNFSTLPK	1179	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3522.4	38.26114	4	2887.253294	2887.257920	K	I	215	241
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	1180	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:35,19-UNIMOD:21	ms_run[1]:scan=1.1.3768.5	44.46128	4	3552.398494	3552.403580	R	-	207	238
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1181	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3591.3	40.02907	5	3596.729618	3596.728741	K	-	244	278
PSM	ETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	1182	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3866.6	46.91957	4	4312.810894	4312.819359	K	R	722	764
PSM	VGPATPSAQVGKWEEDSESSSEESSDSSDGEVPTAVAPAQEK	1183	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3625.6	40.92385	4	4340.858894	4340.860555	K	S	529	571
PSM	TLPLTTAPEAGEVTPSDSGGQEDSPAK	1184	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3584.5	39.86945	3	2814.191771	2814.188562	K	G	2233	2260
PSM	ATGANATPLDFPSK	1185	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	41.10977	2	1510.6668	1510.6700	M	K	2	16
PSM	PYQYPALTPEQKK	1186	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3168.4	29.13407	3	1642.7822	1641.7802	M	E	2	15
PSM	MEGPLSVFGDR	1187	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4296.2	55.3078	2	1344.5401	1344.5416	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1188	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4022.4	50.63713	3	2829.1936	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1189	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3730.5	43.48965	4	2845.1951	2845.1913	-	Y	1	25
PSM	MQELTLSPGPAK	1190	sp|Q93015-2|NAA80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3929.2	48.5108	2	1392.6319	1392.6355	-	L	1	13
PSM	MDEPSPLAQPLELNQHSR	1191	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3678.4	42.13052	3	2198.9641	2198.9662	-	F	1	19
PSM	MDEPSPLAQPLELNQHSR	1192	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3869.3	46.98662	3	2182.9675	2182.9713	-	F	1	19
PSM	SHSPSSPDPDTPSPVGDSR	1193	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2906.5	22.42122	3	2080.777871	2080.777625	R	A	616	635
PSM	HYGGLTGLNKAETAAK	1194	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3177.2	29.36228	3	1789.782371	1789.780132	R	H	91	107
PSM	SGPKPFSAPKPQTSPSPK	1195	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2934.2	23.09752	4	1916.939294	1916.939729	R	R	295	313
PSM	NVSIGIVGK	1196	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3395.2	35.02223	2	965.491647	965.494698	K	D	209	218
PSM	DLHQPSLSPASPHSQGFER	1197	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3243.2	31.08718	4	2168.959294	2168.964047	K	G	58	77
PSM	GHTDTEGRPPSPPPTSTPEK	1198	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2800.3	19.7787	4	2246.928494	2246.924624	R	C	353	373
PSM	RLQEDPNYSPQRFPNAQR	1199	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3132.3	28.20232	4	2295.048494	2295.054593	K	A	1109	1127
PSM	GQAAVQQLQAEGLSPR	1200	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3357.3	34.04548	3	1731.826571	1731.830513	R	F	43	59
PSM	HTGPNSPDTANDGFVR	1201	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3000.4	24.81388	3	1763.726171	1763.726442	K	L	99	115
PSM	RADLNQGIGEPQSPSRR	1202	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2903.2	22.33298	5	1959.933118	1959.927602	R	V	62	79
PSM	DSYVGDEAQSK	1203	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2795.3	19.66313	2	1197.512847	1197.514961	K	R	53	64
PSM	GGLGAPPLQSAR	1204	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3194.4	29.81163	2	1202.578247	1202.580887	R	S	88	100
PSM	EAESSPFVER	1205	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3028.4	25.54003	2	1229.494047	1229.496549	K	L	548	558
PSM	DVGRPNFEEGGPTSVGR	1206	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3227.4	30.67473	3	1852.809071	1852.810506	K	K	176	193
PSM	IDATSASVLASR	1207	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3254.2	31.37467	2	1269.591847	1269.596597	K	F	120	132
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	1208	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3428.4	35.89335	4	2574.216894	2574.222781	K	K	453	479
PSM	AGGPTTPLSPTR	1209	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2939.5	23.23728	2	1313.539447	1313.541799	R	L	15	27
PSM	GINSSNVENQLQATQAAR	1210	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3399.4	35.13287	3	1979.903171	1979.906197	K	K	84	102
PSM	EITALAPSTMK	1211	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3421.3	35.70675	2	1320.538847	1320.543772	K	I	318	329
PSM	EQVANSAFVER	1212	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3125.6	28.02888	2	1328.571247	1328.576196	K	V	365	376
PSM	AGDNIPEEQPVASTPTTVSDGENKK	1213	sp|Q9Y320|TMX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3102.2	27.41788	4	2663.193694	2663.196351	K	D	270	295
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	1214	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3183.3	29.52188	4	2712.261694	2712.264371	K	T	139	165
PSM	NGEVVHTPETSV	1215	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3066.5	26.51562	2	1427.535047	1427.537107	K	-	454	466
PSM	GSGSGGSGSDSEPDSPVFEDSK	1216	sp|P36956|SRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3110.5	27.63525	3	2163.805571	2163.811748	R	A	447	469
PSM	EVDEQMLNVQNK	1217	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3206.3	30.12153	2	1445.678847	1445.682044	K	N	325	337
PSM	DRVHHEPQLSDK	1218	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2655.2	17.63688	3	1459.717571	1459.716790	K	V	26	38
PSM	NAPAAVDEGSISPR	1219	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3032.5	25.6477	2	1462.640647	1462.645338	R	T	373	387
PSM	ETPAATEAPSSTPK	1220	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2749.3	18.7553	2	1465.631647	1465.633770	K	A	185	199
PSM	GGEIQPVSVKVGDK	1221	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3129.2	28.12045	3	1491.729671	1491.733425	K	V	57	71
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	1222	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3240.4	31.01562	4	2987.314094	2987.319929	R	-	684	712
PSM	SLYASSPGGVYATR	1223	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3334.5	33.45433	2	1507.670447	1507.670825	R	S	51	65
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	1224	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21,16-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3404.3	35.2605	4	3037.291694	3037.291647	K	E	117	144
PSM	PFSAPKPQTSPSPK	1225	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2951.3	23.5419	3	1547.736371	1547.738510	K	R	299	313
PSM	DSAGQDINLNSPNK	1226	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3247.5	31.20163	2	1551.6549	1551.6561	M	G	2	16
PSM	VAAETQSPSLFGSTK	1227	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3344.5	33.71532	2	1601.728447	1601.733819	K	L	215	230
PSM	QLPLEPESPSGQVGPRPAPPQEESPSSEAK	1228	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3422.5	35.73927	4	3204.493694	3204.497618	K	S	63	93
PSM	LTFDSSFSPNTGKK	1229	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3379.2	34.60888	3	1607.721671	1607.723254	K	N	97	111
PSM	SVTEQGAELSNEER	1230	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3034.2	25.68967	3	1627.671671	1627.672675	K	N	28	42
PSM	ESVPEFPLSPPKKK	1231	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3356.2	34.0169	3	1661.841071	1661.842975	K	D	30	44
PSM	NGSLDSPGKQDTEEDEEEDEK	1232	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2893.4	22.08893	3	2509.886171	2509.889480	K	D	134	155
PSM	GKGGEIQPVSVKVGDK	1233	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3011.2	25.09168	3	1676.846471	1676.849852	K	V	55	71
PSM	SSGPYGGGGQYFAKPR	1234	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3210.3	30.22625	3	1707.736571	1707.740636	R	N	337	353
PSM	LKGEATVSFDDPPSAK	1235	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3200.3	29.96473	3	1740.795671	1740.797147	K	A	333	349
PSM	VQAYEEPSVASSPNGK	1236	sp|Q99575|POP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3054.5	26.21677	2	1741.752247	1741.756011	R	E	719	735
PSM	NQTAEKEEFEHQQK	1237	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2691.2	18.08075	4	1744.799294	1744.801642	K	E	584	598
PSM	EQGPYETYEGSPVSK	1238	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3132.6	28.21232	2	1749.707847	1749.713477	K	G	549	564
PSM	MDATANDVPSPYEVR	1239	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3266.6	31.70142	2	1759.710247	1759.712432	K	G	434	449
PSM	LKGEATVSFDDPPSAK	1240	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3259.3	31.50847	3	1820.758871	1820.763478	K	A	333	349
PSM	QLVRGEPNVSYICSR	1241	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3287.4	32.2277	3	1856.859371	1856.860433	K	Y	269	284
PSM	GVQVETISPGDGRTFPK	1242	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3355.4	33.99817	3	1866.8825	1866.8872	M	R	2	19
PSM	SGKYDLDFKSPDDPSR	1243	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3239.6	30.99623	2	1905.809447	1905.814588	R	Y	254	270
PSM	GPSTPKSPGASNFSTLPK	1244	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3301.3	32.5881	3	1931.842571	1931.843126	R	I	223	241
PSM	VKLESPTVSTLTPSSPGK	1245	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3349.5	33.84588	3	1986.927971	1986.931606	R	L	290	308
PSM	GNSRPGTPSAEGGSTSSTLR	1246	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2819.2	20.24448	3	1997.880671	1997.880377	R	A	383	403
PSM	SMGTGDTPGLEVPSSPLRK	1247	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3436.6	36.10792	3	2007.929171	2007.933658	R	A	381	400
PSM	SVSTPSEAGSQDSGDGAVGSR	1248	sp|Q13409|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2853.5	21.07468	3	2029.824371	2029.822587	K	T	92	113
PSM	GGNFGGRSSGPYGGGGQYFAK	1249	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3325.3	33.21228	3	2099.884871	2099.885068	K	P	278	299
PSM	ETVSEESNVLCLSKSPNK	1250	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3351.6	33.90137	2	2099.939447	2099.944617	R	H	581	599
PSM	TPSPKEEDEEPESPPEKK	1251	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2746.2	18.68108	4	2131.922894	2131.919841	K	T	202	220
PSM	HFKDEDEDEDVASPDGLGR	1252	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3120.6	27.89927	3	2209.877471	2209.880102	K	L	537	556
PSM	DYHFKVDNDENEHQLSLR	1253	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3294.5	32.41278	3	2258.031071	2258.035223	K	T	28	46
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	1254	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3298.5	32.51677	3	2268.865571	2268.864409	R	S	326	351
PSM	EHYPVSSPSSPSPPAQPGGVSR	1255	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3142.6	28.47082	3	2378.990771	2378.993372	K	N	2036	2058
PSM	EHYPVSSPSSPSPPAQPGGVSR	1256	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3134.6	28.26442	3	2378.990771	2378.993372	K	N	2036	2058
PSM	LGSTAPQVLSTSSPAQQAENEAK	1257	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3402.5	35.21485	3	2393.106071	2393.111165	K	A	260	283
PSM	GSLAEAVGSPPPAATPTPTPPTRK	1258	sp|Q9Y6I3|EPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3264.5	31.64573	3	2459.149871	2459.149873	R	T	446	470
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1259	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3390.3	34.89538	4	2727.235694	2727.234862	R	G	70	97
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1260	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3061.5	26.38978	4	2968.358494	2968.358028	R	L	420	447
PSM	APTTVEDRVGDSTPVSEKPVSAAVDANASESP	1261	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3425.6	35.82092	3	3342.452171	3342.454173	K	-	421	453
PSM	RASGQAFELILSPR	1262	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3737.2	43.65987	3	1623.812471	1623.813407	K	S	14	28
PSM	NQVALNPQNTVFDAK	1263	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3457.2	36.57302	3	1737.807971	1737.808715	K	R	57	72
PSM	IADPEHDHTGFLTEYVATR	1264	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	40.181	4	2330.956494	2330.961009	R	W	190	209
PSM	RIDFTPVSPAPSPTR	1265	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3466.6	36.82053	3	1799.798771	1799.800867	K	G	108	123
PSM	VDIDTPDIDIHGPEGK	1266	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3496.2	37.57757	3	1799.797571	1799.797876	K	L	4096	4112
PSM	LDIDSPPITAR	1267	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3446.3	36.30225	2	1276.600847	1276.606433	R	N	33	44
PSM	LDIDSPPITAR	1268	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3564.3	39.35355	2	1356.571847	1356.572764	R	N	33	44
PSM	ERPTPSLNNNCTTSEDSLVLYNR	1269	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3524.5	38.31742	4	2759.220894	2759.222189	K	V	734	757
PSM	DVIELTDDSFDK	1270	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3727.3	43.40502	2	1395.639047	1395.640556	K	N	161	173
PSM	EAAGGNDSSGATSPINPAVALE	1271	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3789.4	44.98922	3	2106.913571	2106.910674	K	-	1236	1258
PSM	ESVPEFPLSPPK	1272	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3808.4	45.4835	2	1405.650647	1405.653049	K	K	30	42
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1273	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3571.3	39.52823	4	2833.352094	2833.352672	K	S	362	389
PSM	PVQETQAPESPGENSEQALQTLSPR	1274	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	5-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3542.4	38.78572	4	2852.2284	2852.2262	M	A	2	27
PSM	EGFSIPVSADGFK	1275	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3984.2	49.81715	2	1432.628447	1432.627563	K	F	1887	1900
PSM	DNLTLWTSDMQGDGEEQNK	1276	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3609.4	40.50173	3	2195.928671	2195.927707	R	E	226	245
PSM	DVNSSSPVMLAFK	1277	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3868.2	46.95761	3	1473.656471	1473.657483	K	S	28	41
PSM	GALQNIIPASTGAAK	1278	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3541.5	38.7626	2	1490.749647	1490.749409	R	A	201	216
PSM	LGGSPTSLGTWGSWIGPDHDK	1279	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4105.2	52.42628	3	2247.000671	2246.999763	K	F	439	460
PSM	DLLLTSSYLSDSGSTGEHTK	1280	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3948.4	48.9569	3	2269.941671	2269.939271	K	S	397	417
PSM	ILTPLVSLDTPGK	1281	sp|Q9HC38|GLOD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4831.2	61.01902	2	1512.723647	1512.724180	K	A	240	253
PSM	SVVTGGVQSVMGSR	1282	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3728.3	43.43067	2	1522.630647	1522.625211	K	L	167	181
PSM	IFVGGLSPDTPEEK	1283	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3597.5	40.191	2	1567.710447	1567.717106	K	I	184	198
PSM	VHSPSGALEECYVTEIDQDK	1284	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3676.5	42.08358	3	2355.999971	2355.993023	K	Y	2368	2388
PSM	GALQNIIPASTGAAK	1285	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3693.5	42.52378	2	1570.711047	1570.715740	R	A	201	216
PSM	SASSYSDIEEIATPDSSAPSSPK	1286	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3568.4	39.45533	3	2484.981371	2484.982258	K	L	1233	1256
PSM	NRPTSISWDGLDSGK	1287	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3466.3	36.81053	3	1711.754771	1711.756680	K	L	48	63
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1288	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4273.4	54.96303	4	3425.462494	3425.458138	K	-	610	647
PSM	VTNGAFTGEISPGMIK	1289	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3557.2	39.17128	3	1716.779171	1716.779389	K	D	107	123
PSM	SQPEPSPVLSQLSQR	1290	sp|Q5T6F2|UBAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3499.2	37.65542	3	1731.823271	1731.819280	K	Q	427	442
PSM	GLSPAQADSQFLENAK	1291	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3680.2	42.1751	3	1754.786771	1754.787645	R	R	384	400
PSM	CFSPGVIEVQEVQGK	1292	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3731.2	43.50608	3	1755.787271	1755.790288	R	K	256	271
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1293	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3893.4	47.61833	4	3522.473694	3522.472617	K	F	604	634
PSM	EAEQAASEAAGGDTTPGSSPSSLYYEEPLGQPPR	1294	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3770.6	44.51377	4	3528.513294	3528.520598	R	F	237	271
PSM	KYEMFAQTLQQSR	1295	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3518.2	38.15167	3	1788.728471	1788.730738	R	G	754	767
PSM	QATKDAGQISGLNVLR	1296	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3616.2	40.67915	3	1829.848871	1829.843794	R	V	203	219
PSM	VVVAENFDEIVNNENK	1297	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3682.2	42.22747	3	1831.890971	1831.895208	K	D	380	396
PSM	WLDDLLASPPPSGGGAR	1298	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4658.2	59.23315	3	1867.792871	1867.790696	R	R	684	701
PSM	SESAPTLHPYSPLSPK	1299	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3504.5	37.7966	3	1869.795971	1869.795113	R	G	100	116
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	1300	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	27-UNIMOD:35	ms_run[1]:scan=1.1.3868.6	46.97095	4	3772.431294	3772.433739	K	A	469	503
PSM	QGAIVAVTGDGVNDSPALK	1301	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3493.3	37.50533	3	1890.911171	1890.908823	R	K	708	727
PSM	ENVATTDTLESTTVGTSV	1302	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3613.5	40.61022	2	1903.823247	1903.829964	K	-	580	598
PSM	SSTPPGESYFGVSSLQLK	1303	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4044.2	51.11108	3	1962.896171	1962.897590	K	G	1041	1059
PSM	SVPTSTVFYPSDGVATEK	1304	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3620.4	40.79168	3	1963.879871	1963.881605	R	A	439	457
PSM	NSDVLQSPLDSAARDEL	1305	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4065.3	51.60475	2	1988.804847	1988.812948	K	-	606	623
PSM	QIESKTAFQEALDAAGDK	1306	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3686.4	42.33925	3	2000.907671	2000.909217	K	L	4	22
PSM	SSSPAPADIAQTVQEDLR	1307	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	45.24583	3	2043.855071	2043.855147	K	T	230	248
PSM	LDNVPHTPSSYIETLPK	1308	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3906.4	47.93905	3	2069.911571	2069.911205	R	A	45	62
PSM	DQPAFTPSGILTPHALGSR	1309	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3972.3	49.5059	3	2123.943971	2123.944237	R	N	428	447
PSM	DLLLTSSYLSDSGSTGEHTK	1310	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3787.3	44.93419	3	2189.975171	2189.972940	K	S	397	417
PSM	CGNTIPDDDNQVVSLSPGSR	1311	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3458.5	36.60948	3	2209.928171	2209.931092	R	Y	643	663
PSM	SIDSNSEIVSFGSPCSINSR	1312	sp|P42702|LIFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3749.4	43.97702	3	2234.949071	2234.951493	R	Q	1047	1067
PSM	SSVSRVPCNVEGISPELEK	1313	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3517.4	38.1325	3	2245.966271	2245.969131	K	V	290	309
PSM	DKDDLGPDRFSTLTDDPSPR	1314	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3491.4	37.45837	3	2326.009571	2326.011450	K	L	1002	1022
PSM	TLEAEFNSPSPPTPEPGEGPR	1315	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3583.4	39.83862	3	2367.957671	2367.966154	K	K	525	546
PSM	SDSYSQSLKSPLNDMSDDDDDDDSSD	1316	sp|Q9H8W4|PKHF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3660.5	41.68058	3	2932.021271	2932.023727	R	-	224	250
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1317	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3549.3	38.96612	5	2989.545618	2989.541321	K	G	202	228
PSM	FSDCWNTEGSYDCVCSPGYEPVSGAK	1318	sp|Q9UHX3|AGRE2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3791.6	45.04742	3	3051.137171	3051.139841	K	T	82	108
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQRK	1319	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3831.4	46.08005	3	3199.445171	3199.444580	K	F	139	167
PSM	KVEEEGSPGDPDHEASTQGR	1320	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2700.2	18.16365	4	2203.905294	2203.901900	R	T	309	329
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1321	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,18-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3670.4	41.9309	3	2588.0399	2588.0424	M	R	2	32
PSM	AESSESFTMASSPAQR	1322	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3219.2	30.45833	3	1822.7087	1822.7076	M	R	2	18
PSM	AESSESFTMASSPAQR	1323	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3490.5	37.43682	2	1806.7107	1806.7126	M	R	2	18
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1324	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3726.6	43.38872	3	2845.1905	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1325	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3670.6	41.93756	3	2765.2240	2765.2250	-	Y	1	25
PSM	SSIGTGYDLSASTFSPDGR	1326	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.4120.2	52.68184	3	2038.8533	2038.8516	M	V	2	21
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1327	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3736.3	43.6379	4	2882.1872	2882.1622	M	D	2	29
PSM	SETSVANGSQSESSVSTPSASFEPNNTCENSQSR	1328	sp|Q92575|UBXN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3273.6	31.87853	4	3642.452894	3641.469702	K	N	117	151
PSM	SCINLPTVLPGSPSK	1329	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4186.3	53.88203	2	1690.7981	1690.7996	M	T	2	17
PSM	SDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLR	1330	sp|Q99536|VAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.3608.6	40.48223	5	4802.2021	4802.1939	M	C	2	50
PSM	MGNTPDSASDNLGFR	1331	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3323.2	33.15652	3	1676.652971	1676.650166	R	C	275	290
PSM	CNTPTYCDLGK	1332	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3368.4	34.32888	2	1449.5251	1449.5300	M	A	2	13
PSM	MESETEPEPVTLLVKSPNQR	1333	sp|Q15011|HERP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=1.1.3989.2	49.90027	3	2405.1211	2405.1180	-	H	1	21
PSM	VEVTEFEDIKSGYR	1334	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3572.2	39.55063	3	1750.788071	1750.781497	K	I	133	147
PSM	LQANLTFDPAALLPGASPK	1335	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4143.3	53.15956	3	2083.982771	2082.979225	K	S	89	108
PSM	DVNAAIATIK	1336	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3320.2	33.07843	2	1014.569847	1014.570960	K	T	327	337
PSM	SGLTVPTSPK	1337	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3107.3	27.55052	2	1065.507847	1065.510742	R	G	87	97
PSM	GGSGSHNWGTVKDELTESPK	1338	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3242.2	31.06115	4	2164.940494	2164.942643	R	Y	217	237
PSM	SAFSGGYYR	1339	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3220.4	30.49132	2	1086.417047	1086.417176	K	G	43	52
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1340	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3168.5	29.1374	6	3290.596941	3290.597273	K	E	178	210
PSM	DVVICPDASLEDAKK	1341	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3294.2	32.40278	3	1658.816471	1658.818537	R	E	49	64
PSM	KYEDICPSTHNMDVPNIK	1342	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3337.3	33.52542	4	2239.964494	2239.964306	K	R	68	86
PSM	GHTDTEGRPPSPPPTSTPEK	1343	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2792.3	19.57778	4	2246.928494	2246.924624	R	C	353	373
PSM	MSGFIYQGK	1344	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	30.72313	2	1125.454647	1125.456598	R	I	487	496
PSM	KGDRSPEPGQTWTR	1345	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2868.3	21.44115	3	1693.757171	1693.757348	R	E	89	103
PSM	RLQEDPNYSPQRFPNAQR	1346	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3122.2	27.93767	4	2295.048494	2295.054593	K	A	1109	1127
PSM	QLSSGVSEIR	1347	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3159.3	28.89505	2	1154.530647	1154.533268	R	H	80	90
PSM	IFQKGESPVDYDGGR	1348	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3145.3	28.53887	3	1746.754271	1746.761431	K	T	242	257
PSM	SWDSSSPVDRPEPEAASPTTR	1349	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3213.3	30.30462	4	2351.013694	2351.006699	R	T	354	375
PSM	KISPFEHQTYCQR	1350	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3064.2	26.45462	3	1772.770571	1772.770556	K	T	55	68
PSM	NDSVIVADQTPTPTR	1351	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3155.2	28.78745	3	1772.732771	1772.738326	R	F	60	75
PSM	DNSTMGYMAAK	1352	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:35	ms_run[1]:scan=1.1.2861.3	21.27565	2	1203.490647	1203.490009	R	K	621	632
PSM	NAGVEGSLIVEK	1353	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3207.3	30.14772	2	1214.645447	1214.650667	K	I	482	494
PSM	NCQTVLAPCSPNPCENAAVCK	1354	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3307.2	32.74133	4	2468.990894	2468.994638	K	E	829	850
PSM	GGETPGSEQWK	1355	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2988.6	24.51068	2	1254.491847	1254.491798	K	F	223	234
PSM	SSEHINEGETAMLVCK	1356	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3199.3	29.9385	3	1883.778671	1883.779466	K	S	228	244
PSM	GGSGSGPTIEEVD	1357	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3289.5	32.28275	2	1283.489647	1283.491857	K	-	629	642
PSM	SASSSAAGSPGGLTSLQQQK	1358	sp|Q8NEZ2|VP37A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3187.5	29.63203	3	1940.884571	1940.884065	K	Q	10	30
PSM	EDQTEYLEER	1359	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3085.5	27.00862	2	1310.562047	1310.562640	K	R	166	176
PSM	VKLESPTVSTLTPSSPGK	1360	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3378.2	34.58317	3	1986.926471	1986.931606	R	L	290	308
PSM	GPPASSPAPAPKFSPVTPK	1361	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3307.5	32.75134	3	1991.915471	1991.915897	R	F	254	273
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1362	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2801.3	19.8137	4	2673.045694	2673.045055	K	G	134	157
PSM	LDQPVSAPPSPR	1363	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3012.6	25.13068	2	1342.625647	1342.628231	K	D	235	247
PSM	NGEVVHTPETSV	1364	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3051.6	26.1455	2	1347.569047	1347.570776	K	-	454	466
PSM	NLYPSSSPYTR	1365	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3270.3	31.79393	2	1363.578247	1363.580947	K	N	275	286
PSM	GKEDEGEEAASPMLQIQR	1366	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3100.5	27.37793	3	2082.888071	2082.892916	K	D	2400	2418
PSM	QAGGFLGPPPPSGK	1367	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3304.2	32.66322	2	1388.646647	1388.648967	K	F	224	238
PSM	GAVDGGLSIPHSTK	1368	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3168.2	29.1274	3	1417.659071	1417.660260	K	R	165	179
PSM	NGEVVHTPETSV	1369	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3082.4	26.92703	2	1427.535047	1427.537107	K	-	454	466
PSM	TLRLNQPGTPTR	1370	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2976.2	24.18632	3	1432.716671	1432.718778	K	T	386	398
PSM	SSTPLHSPSPIR	1371	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3010.2	25.06587	3	1437.604271	1437.605462	R	V	283	295
PSM	SSGPYGGGGQYFAK	1372	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3298.4	32.51343	2	1454.582647	1454.586761	R	P	285	299
PSM	NAPAAVDEGSISPR	1373	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3040.5	25.8568	2	1462.640647	1462.645338	R	T	373	387
PSM	NMAPGAVCSPGESK	1374	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2751.3	18.78605	2	1499.577247	1499.578581	R	E	1289	1303
PSM	SLYASSPGGVYATR	1375	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3342.6	33.6661	2	1507.670447	1507.670825	R	S	51	65
PSM	LRECELSPGVNR	1376	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3006.4	24.96908	3	1508.676371	1508.680678	R	D	487	499
PSM	SLAGSSGPGASSGTSGDHGELVVR	1377	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3182.5	29.50273	3	2264.002871	2264.007034	K	I	60	84
PSM	NWMVGGEGGAGGRSP	1378	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3419.6	35.66427	2	1510.600047	1510.602427	K	-	79	94
PSM	YRDVAECGPQQELDLNSPRNTTLER	1379	sp|Q9BTE3|MCMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3420.6	35.69032	4	3040.372094	3040.370978	K	Q	102	127
PSM	YADEEIPRSPFK	1380	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3345.2	33.73152	3	1530.675071	1530.675576	K	V	1497	1509
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	1381	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21,21-UNIMOD:4,25-UNIMOD:21	ms_run[1]:scan=1.1.3433.6	36.0313	4	3071.291694	3071.294441	R	V	221	251
PSM	ESAAPASPAPSPAPSPTPAPPQK	1382	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2978.5	24.2509	3	2312.010371	2312.012710	K	E	538	561
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	1383	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3390.5	34.90205	6	4716.096741	4716.094806	K	A	530	573
PSM	VAAETQSPSLFGSTK	1384	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3360.5	34.12732	2	1601.728447	1601.733819	K	L	215	230
PSM	DGSLASNPYSGDLTK	1385	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3403.4	35.23805	2	1603.675047	1603.676698	R	F	850	865
PSM	GGAAGGALPTSPGPALGAK	1386	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3332.6	33.4055	2	1628.787047	1628.792337	R	G	7	26
PSM	DMESPTKLDVTLAK	1387	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3331.2	33.36595	3	1642.753871	1642.752506	K	D	277	291
PSM	WDQTADQTPGATPK	1388	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2956.6	23.68088	2	1674.631047	1674.632799	R	K	200	214
PSM	IDEMPEAAVKSTANK	1389	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3026.3	25.48452	3	1682.756471	1682.758653	R	Y	30	45
PSM	DSSQSPSQVDQFCK	1390	sp|Q13637|RAB32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3152.6	28.72463	2	1691.644647	1691.649832	K	E	150	164
PSM	NVTELNEPLSNEER	1391	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3302.3	32.61447	3	1722.744971	1722.746174	K	N	29	43
PSM	NQVAMNPTNTVFDAK	1392	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3418.2	35.62462	3	1728.751871	1728.754237	K	R	57	72
PSM	TDSVIIADQTPTPTR	1393	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3306.2	32.71535	3	1773.759071	1773.758727	R	F	42	57
PSM	ATEPPSPDAGELSLASR	1394	sp|Q8IYB8|SUV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3424.3	35.78488	3	1776.791771	1776.793125	K	L	720	737
PSM	AGGSPAPGPETPAISPSK	1395	sp|P33316|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3043.4	25.93162	3	1779.744371	1779.748163	K	R	85	103
PSM	DVQDSLTVSNEAQTAK	1396	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3179.4	29.42117	3	1784.782271	1784.782954	K	E	211	227
PSM	KTTEEQVQASTPCPR	1397	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2755.5	18.86767	3	1810.792271	1810.792079	K	T	96	111
PSM	DGQVINETSQHHDDLE	1398	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3000.6	24.82055	3	1835.794571	1835.792199	R	-	451	467
PSM	LPQSSSSESSPPSPQPTK	1399	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2825.4	20.40705	3	1919.849171	1919.851368	K	V	412	430
PSM	NIGRDTPTSAGPNSFNK	1400	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3060.3	26.3586	3	1934.789771	1934.792487	K	G	134	151
PSM	RADLNQGIGEPQSPSRR	1401	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2915.3	22.61552	4	1959.928094	1959.927602	R	V	62	79
PSM	NGNGGPGPYVGQAGTATLPR	1402	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3338.4	33.55473	3	1962.895271	1962.894904	K	N	185	205
PSM	EAENQGLDISSPGMSGHR	1403	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3174.4	29.29017	3	1963.805771	1963.809520	K	Q	191	209
PSM	GPPASSPAPAPKFSPVTPK	1404	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3385.5	34.77457	3	2071.881971	2071.882228	R	F	254	273
PSM	KDNEESEQPPVPGTPTLR	1405	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3156.6	28.8273	3	2072.938871	2072.941580	K	N	633	651
PSM	NGVIQHTGAAAEEFNDDTD	1406	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3280.4	32.04673	3	2082.814271	2082.816773	R	-	646	665
PSM	ESEDKPEIEDVGSDEEEEK	1407	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3064.5	26.46462	3	2191.913771	2191.912828	K	K	251	270
PSM	SSSPLPTVQLHPQSPTAGKK	1408	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3242.3	31.06448	4	2219.036094	2219.038866	K	H	998	1018
PSM	MPPRTPAEASSTGQTGPQSAL	1409	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3152.5	28.7213	3	2258.921771	2258.927995	K	-	238	259
PSM	VGDSTPVSEKPVSAAVDANASESP	1410	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3329.5	33.32367	3	2393.060471	2393.063546	R	-	429	453
PSM	CSDNSSYEEPLSPISASSSTSR	1411	sp|Q8IXK0|PHC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3404.4	35.26383	3	2439.972671	2439.973745	R	R	740	762
PSM	TKTEQELPRPQSPSDLDSLDGR	1412	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3347.3	33.78702	4	2548.173694	2548.180641	K	S	90	112
PSM	HARPPDPPASAPPDSSSNSASQDTK	1413	sp|Q15642|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2783.4	19.45498	4	2596.121694	2596.119103	R	E	486	511
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1414	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3260.4	31.53753	4	2637.344494	2637.341499	R	R	31	56
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	1415	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3121.2	27.91153	5	2769.238618	2769.239553	K	V	100	125
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1416	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3131.4	28.17945	5	3112.506118	3112.507789	R	S	847	876
PSM	TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	1417	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3319.6	33.06577	4	3340.219694	3340.220589	R	G	294	325
PSM	AQETEAAPSQAPADEPEPESAAAQSQENQDTRPK	1418	sp|Q9UNF1|MAGD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3016.6	25.23502	4	3657.570894	3657.570402	K	V	138	172
PSM	NLLSVAYK	1419	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3696.2	42.59212	2	986.482647	986.483799	R	N	44	52
PSM	RASGQAFELILSPR	1420	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3729.2	43.45372	3	1623.812471	1623.813407	K	S	14	28
PSM	VLLPEYGGTK	1421	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3450.2	36.39548	2	1155.555447	1155.557692	K	V	71	81
PSM	FVLSSGKFYGDEEK	1422	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3765.2	44.37785	3	1764.702071	1764.704901	K	D	49	63
PSM	SADTLWGIQK	1423	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3684.2	42.27983	2	1197.541047	1197.543105	K	E	319	329
PSM	GTPLISPLIK	1424	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3958.2	49.18502	2	1197.579847	1197.581144	R	W	826	836
PSM	SLNILTAFQK	1425	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4258.2	54.77593	2	1213.611247	1213.610790	K	K	244	254
PSM	LDIDSPPITAR	1426	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3523.4	38.28685	2	1276.604647	1276.606433	R	N	33	44
PSM	SLNILTAFQK	1427	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4921.3	61.70782	2	1293.578047	1293.577121	K	K	244	254
PSM	DITEEIMSGAR	1428	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3763.2	44.32902	2	1300.534047	1300.537033	K	T	191	202
PSM	DATNVGDEGGFAPNILENK	1429	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3753.3	44.07752	3	1959.916571	1959.917400	K	E	203	222
PSM	SAESPTSPVTSETGSTFK	1430	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3471.4	36.9445	3	1971.774971	1971.775165	K	K	280	298
PSM	TLTPISAAYAR	1431	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3508.5	37.90145	2	1322.564847	1322.567285	K	A	295	306
PSM	LSELVQAVSDPSSPQYGK	1432	sp|O14773|TPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3591.2	40.02573	3	1983.917771	1983.919054	R	Y	61	79
PSM	KAEAAASALADADADLEER	1433	sp|O43633|CHM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3659.3	41.64818	3	1995.870671	1995.878645	K	L	197	216
PSM	TAFQEALDAAGDK	1434	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3539.5	38.7108	2	1335.629847	1335.630660	K	L	9	22
PSM	VLTPELYAELR	1435	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4074.2	51.80522	2	1382.680847	1382.684684	K	A	33	44
PSM	NLSSPFIFHEK	1436	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3666.2	41.8237	2	1397.636847	1397.638068	R	T	644	655
PSM	GLFSANDWQCK	1437	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3900.2	47.78512	2	1404.550847	1404.553352	R	T	62	73
PSM	DLLLTSSYLSDSGSTGEHTK	1438	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3658.3	41.62338	3	2110.001471	2110.006609	K	S	397	417
PSM	TLTIVDTGIGMTK	1439	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3724.3	43.32653	2	1428.693047	1428.693534	R	A	28	41
PSM	RPPEPTTPWQEDPEPEDENLYEK	1440	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3516.5	38.1103	4	2875.224494	2875.222566	K	N	47	70
PSM	DMNQVLDAYENK	1441	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3712.5	43.02302	2	1438.637847	1438.639844	R	K	142	154
PSM	SVFGTPTLETANK	1442	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3514.4	38.0551	2	1443.654447	1443.664677	K	N	1140	1153
PSM	CLELFSELAEDK	1443	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4055.2	51.34718	2	1452.678847	1452.680647	K	E	412	424
PSM	DLLLTSSYLSDSGSTGEHTK	1444	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3795.5	45.14862	3	2189.975171	2189.972940	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	1445	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3960.3	49.25063	3	2192.871971	2192.873028	R	-	228	248
PSM	DFTPVCTTELGR	1446	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3566.3	39.4024	2	1474.614247	1474.616346	R	A	42	54
PSM	DVNSSSPVMLAFK	1447	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3625.4	40.91718	2	1489.649047	1489.652398	K	S	28	41
PSM	TTPSVVAFTADGER	1448	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3547.4	38.91712	2	1529.674047	1529.676304	R	L	86	100
PSM	GTDDLNPVTSTPAKPSSPPPEFSFNTPGK	1449	sp|Q6NXT4|ZNT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3862.4	46.84782	4	3144.370894	3144.373009	K	N	366	395
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1450	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3489.6	37.41505	3	2378.078771	2378.078288	K	S	366	389
PSM	QQEPVTSTSLVFGK	1451	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3598.2	40.20752	3	1599.750371	1599.754554	K	K	1107	1121
PSM	DYEEVGVDSVEGEGEEEGEEY	1452	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3806.5	45.43815	3	2427.861971	2427.863902	K	-	431	452
PSM	IFVGGLSPDTPEEK	1453	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3742.2	43.78777	2	1647.681847	1647.683437	K	I	184	198
PSM	FSPVTPKFTPVASK	1454	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3532.2	38.51738	3	1664.763071	1664.761628	K	F	266	280
PSM	GVLFGVPGAFTPGCSK	1455	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4170.3	53.62482	2	1672.767847	1672.768430	K	T	87	103
PSM	EVAATEEDVTRLPSPTSPFSSLSQDQAATSK	1456	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3982.6	49.76517	4	3408.504894	3408.501123	K	A	975	1006
PSM	VGIDTPDIDIHGPEGK	1457	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3474.3	37.01912	3	1741.792271	1741.792396	K	L	4560	4576
PSM	SESETESEASEITIPPSTPAVPQAPVQGEDYGK	1458	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3695.5	42.57625	4	3509.562894	3509.561066	R	G	530	563
PSM	NQLTSNPENTVFDAK	1459	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3539.2	38.7008	3	1756.769471	1756.766910	K	R	82	97
PSM	DLGLPTEAYISVEEVHDDGTPTSK	1460	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4058.4	51.43805	3	2652.183371	2652.184389	K	T	130	154
PSM	SYELPDGQVITIGNER	1461	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3873.3	47.09358	3	1789.884371	1789.884643	K	F	241	257
PSM	NQLTSNPENTVFDAK	1462	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3513.2	38.02273	3	1836.732971	1836.733241	K	R	82	97
PSM	SESAPTLHPYSPLSPK	1463	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3496.4	37.58423	3	1869.795971	1869.795113	R	G	100	116
PSM	GLSLVDKENTPPALSGTR	1464	sp|P31350|RIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3505.3	37.81603	3	2013.911771	2013.917353	K	V	24	42
PSM	AIGGEFSDTNAAVEGTPLPK	1465	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3561.3	39.278	3	2052.941771	2052.940517	K	A	242	262
PSM	GSMSDGSYSPDYSLAAVDLK	1466	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3938.2	48.72445	3	2141.889071	2141.886433	K	S	479	499
PSM	KGSLESPATDVFGSTEEGEK	1467	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3503.4	37.76642	3	2146.934771	2146.930741	R	R	330	350
PSM	DLGTQNHTSELILSSPPGQK	1468	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3481.3	37.20343	3	2201.035871	2201.036543	K	V	385	405
PSM	IADPEHDHTGFLTEYVATR	1469	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3540.2	38.72709	3	2330.963471	2330.961009	R	W	190	209
PSM	TQDPAKAPNTPDILEIEFKK	1470	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3659.2	41.64485	4	2334.149294	2334.150844	K	G	210	230
PSM	DYEEVGVDSVEGEGEEEGEEY	1471	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3783.3	44.83076	3	2347.898771	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	1472	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3860.3	46.79603	3	2349.944471	2349.946922	R	-	225	247
PSM	FNSESESGSEASSPDYFGPPAK	1473	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3446.5	36.30892	3	2368.943171	2368.937282	R	N	96	118
PSM	ADLLLSTQPGREEGSPLELER	1474	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3764.2	44.35325	3	2389.148171	2389.152635	K	L	593	614
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1475	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3776.5	44.65883	3	2435.109071	2435.115856	K	A	30	54
PSM	FNEEHIPDSPFVVPVASPSGDAR	1476	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3829.4	46.02863	3	2546.143871	2546.147884	K	R	2311	2334
PSM	EATNTTSEPSAPSQDLLDLSPSPR	1477	sp|O75674|TM1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3761.5	44.2899	3	2592.157871	2592.159237	K	M	302	326
PSM	DITDPLSLNTCTDEGHVVLASPLK	1478	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.4122.4	52.73285	3	2674.257371	2674.256115	K	T	234	258
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	1479	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3497.5	37.6129	4	3159.346494	3159.347523	R	G	2037	2066
PSM	SNDSTEQNLSDGTPMPDSYPTTPSSTDAATSESK	1480	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3450.6	36.40882	4	3597.442894	3597.446172	K	E	2726	2760
PSM	VSMPDVELNLKSPK	1481	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3635.3	41.08287	3	1636.795271	1635.794311	K	V	3415	3429
PSM	SAESPTSPVTSETGSTFK	1482	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3455.3	36.52445	3	1972.778771	1971.775165	K	K	280	298
PSM	FNEEHIPDSPFVVPVASPSGDAR	1483	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3936.2	48.68342	4	2626.115294	2626.114215	K	R	2311	2334
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1484	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2828.4	20.46437	4	3105.311294	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1485	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2922.6	22.8008	3	3087.2927	3087.2954	K	S	145	174
PSM	CESAPGCGVWQRPVIDNPNYK	1486	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3836.6	46.21005	3	2509.0565	2509.0551	R	G	360	381
PSM	EDFDSLLQSAK	1487	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3805.3	45.40173	2	1331.563247	1331.564628	K	K	288	299
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1488	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3532.6	38.53072	4	3563.478894	3562.491898	K	V	60	92
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	1489	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3310.6	32.8318	3	2660.150771	2660.147901	R	-	621	645
PSM	DNLTLWTSDQQDDDGGEGNN	1490	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3942.3	48.81332	3	2193.866471	2192.873028	R	-	228	248
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1491	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3662.5	41.73215	3	2765.2240	2765.2250	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1492	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3934.4	48.63167	3	2749.2295	2749.2301	-	Y	1	25
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1493	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3721.5	43.25467	3	2435.107871	2435.115856	K	A	30	54
PSM	SAPASPTHPGLMSPR	1494	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3158.4	28.8725	3	1665.679571	1664.678309	R	S	416	431
PSM	SCEGQNPELLPKTPISPLK	1495	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3664.3	41.77742	3	2267.028671	2267.031003	K	T	308	327
PSM	GDATVSYEDPPTAK	1496	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3034.3	25.693	2	1529.627847	1529.628685	K	A	411	425
PSM	MESAIAEGGASR	1497	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3554.3	39.09673	2	1299.5163	1299.5161	-	F	1	13
PSM	MMCGAPSATQPATAETQHIADQVR	1498	sp|P04080|CYTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3848.4	46.49918	3	2772.1040	2772.1103	-	S	1	25
PSM	TFDQLTPDESK	1499	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3154.4	28.76838	2	1359.555247	1359.559543	K	E	71	82
PSM	CPNLTHLNLSGNK	1500	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3708.5	42.91545	2	1529.6694	1529.6693	K	I	87	100
PSM	RADLNQGIGEPQSPSR	1501	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2981.2	24.31568	4	1803.825694	1803.826490	R	R	62	78
PSM	SCTPSPDQISHR	1502	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2859.3	21.21437	3	1463.588471	1463.586443	R	A	271	283
PSM	CESAFLSK	1503	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3145.2	28.53553	2	1020.394647	1020.398749	K	R	36	44
PSM	VTKSPGETSKPRPFAGGGYR	1504	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2894.2	22.1145	4	2171.0540941913205	2171.0524671642997	R	L	137	157
PSM	YNEQHVPGSPFTAR	1505	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3216.2	30.37952	3	1681.722971	1681.724985	K	V	1938	1952
PSM	TTEEQVQASTPCPR	1506	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2806.2	19.93963	3	1682.695871	1682.697116	K	T	97	111
PSM	TLNEADCATVPPAIR	1507	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	33.31367	3	1706.767271	1706.769887	K	S	648	663
PSM	QNSVQEQPGTACLSK	1508	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2923.6	22.82722	3	1725.740171	1725.739315	K	F	223	238
PSM	KKPRPPPALGPEETSASAGLPK	1509	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3084.3	26.97548	4	2307.1972941913205	2307.1987970448195	K	K	14	36
PSM	WNSVSPASAGK	1510	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3005.5	24.94645	2	1182.504047	1182.507054	K	R	304	315
PSM	LPDLSPVENK	1511	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3402.2	35.20485	2	1190.558047	1190.558421	K	E	2101	2111
PSM	EAALPPVSPLK	1512	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3424.4	35.78822	2	1200.614047	1200.615542	R	A	1224	1235
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1513	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2844.2	20.8425	5	3024.364118	3024.356099	K	S	145	174
PSM	LDNTPASPPRSPAEPNDIPIAK	1514	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3406.2	35.3102	4	2459.112894	2459.113487	K	G	2311	2333
PSM	VDSPTVTTTLK	1515	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3096.4	27.27705	2	1240.591847	1240.595200	K	N	458	469
PSM	EQVANSAFVER	1516	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3051.3	26.1355	2	1248.607247	1248.609865	K	V	365	376
PSM	LEAIEDDSVKETDSSSASAATPSK	1517	sp|P54578|UBP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3090.2	27.12542	4	2517.1040941913207	2517.10071826448	K	K	215	239
PSM	LDIDSPPITAR	1518	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3436.4	36.10125	2	1276.600847	1276.606433	R	N	33	44
PSM	YCRPESQEHPEADPGSAAPYLK	1519	sp|P40763|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3158.5	28.87583	4	2581.094094	2581.094469	K	T	686	708
PSM	GNKSPSPPDGSPAATPEIR	1520	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3027.4	25.51445	3	1956.890171	1956.894236	K	V	293	312
PSM	NLSPGAVESDVR	1521	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	35.33635	2	1322.585647	1322.586761	K	G	171	183
PSM	LDQPVSAPPSPR	1522	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3004.4	24.91742	2	1342.625647	1342.628231	K	D	235	247
PSM	TRSWDSSSPVDRPEPEAASPTTR	1523	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3149.5	28.64768	4	2688.118094	2688.121820	R	T	352	375
PSM	QGAIVAVTGDGVNDSPALKK	1524	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3283.4	32.12413	3	2018.995571	2019.003786	R	A	708	728
PSM	SSTPLHSPSPIR	1525	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2982.3	24.34515	3	1357.638371	1357.639131	R	V	283	295
PSM	SSPNPFVGSPPK	1526	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3406.4	35.31687	2	1372.543247	1372.546550	K	G	393	405
PSM	SPSGPVKSPPLSPVGTTPVK	1527	sp|Q9BVC5|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3289.6	32.28608	3	2091.003671	2091.005440	K	L	182	202
PSM	ASPGTPLSPGSLR	1528	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3419.5	35.66093	2	1398.593047	1398.594562	R	S	33	46
PSM	DTPTSAGPNSFNK	1529	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2980.5	24.29988	2	1414.582447	1414.576590	R	G	138	151
PSM	NGEVVHTPETSV	1530	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3074.4	26.71852	2	1427.535047	1427.537107	K	-	454	466
PSM	SAHATAPVNIAGSR	1531	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2986.2	24.44553	3	1430.662571	1430.666742	R	T	2343	2357
PSM	SIDTQTPSVQER	1532	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2927.6	22.93037	2	1439.630247	1439.629354	R	S	345	357
PSM	LVEDERSDREETESSEGEEAAAGGGAK	1533	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2888.5	21.95962	4	2967.162894	2967.165595	K	S	335	362
PSM	EGHLSPDIVAEQK	1534	sp|P15559|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3159.2	28.89172	3	1501.680671	1501.681389	K	K	78	91
PSM	NIDINDVTPNCR	1535	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3262.6	31.59665	2	1509.627847	1509.628308	K	V	102	114
PSM	SARDHAISLSEPR	1536	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2997.2	24.7295	3	1517.699171	1517.698771	R	M	792	805
PSM	NWMVGGEGGAGGRSP	1537	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3193.5	29.78922	2	1526.596447	1526.597342	K	-	79	94
PSM	EQSHAEISPPAESGQAVEECKEEGEEK	1538	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.3108.4	27.57998	4	3063.264894	3063.265235	R	Q	246	273
PSM	SCTPSPDQISHR	1539	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2895.5	22.13765	3	1543.552271	1543.552774	R	A	271	283
PSM	FQRPGDPQSAQDK	1540	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2832.3	20.55657	3	1552.665071	1552.667136	K	A	294	307
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1541	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3172.5	29.24223	4	3117.280894	3117.283662	R	A	333	362
PSM	AKPAMPQDSVPSPR	1542	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3001.3	24.83612	3	1559.713571	1559.716729	K	S	470	484
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1543	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3288.4	32.2537	4	3173.240494	3173.243468	R	-	738	768
PSM	APVPGTPDSLSSGSSR	1544	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3068.6	26.57065	2	1593.701047	1593.703581	K	D	322	338
PSM	RITSPLMEPSSIEK	1545	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3376.2	34.53143	3	1666.798571	1666.800124	K	I	53	67
PSM	ESLKEEDESDDDNM	1546	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2719.2	18.38362	3	1670.609171	1670.610121	K	-	242	256
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	1547	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3259.5	31.51513	4	3351.395294	3351.401211	R	A	108	139
PSM	DVYLSPRDDGYSTK	1548	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3208.2	30.17023	3	1694.718971	1694.718897	R	D	204	218
PSM	TLNAETPKSSPLPAK	1549	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2986.5	24.45553	3	1712.775371	1712.778735	R	G	208	223
PSM	EADGSETPEPFAAEAK	1550	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3259.6	31.51847	2	1727.687647	1727.692742	R	F	234	250
PSM	TPKTPKGPSSVEDIK	1551	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2985.3	24.42253	3	1742.790071	1742.789299	K	A	234	249
PSM	TDSVIIADQTPTPTR	1552	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3290.3	32.30205	3	1773.759071	1773.758727	R	F	42	57
PSM	VDCTAHSDVCSAQGVR	1553	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2831.4	20.53448	3	1840.725971	1840.723348	K	G	119	135
PSM	TSPSSPAPLPHQEATPR	1554	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2977.4	24.2189	3	1851.848171	1851.851643	R	A	169	186
PSM	SAPAMQSSGSFNYARPK	1555	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3188.5	29.65853	3	1877.811071	1877.813149	R	Q	719	736
PSM	SFEAPATINSASLHPEK	1556	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3410.6	35.4284	2	1877.852447	1877.856059	K	E	219	236
PSM	IRYESLTDPSKLDSGK	1557	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3270.2	31.7906	3	1887.900071	1887.897924	K	E	54	70
PSM	EASDGTGASQEPPTTDSQEAQSPGHSSAGQEGEDTLR	1558	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3097.4	27.30792	4	3793.542094	3793.546038	K	R	142	179
PSM	FQEQECPPSPEPTRK	1559	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2898.4	22.2109	3	1908.807971	1908.807729	K	E	178	193
PSM	KPVTVSPTTPTSPTEGEAS	1560	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3037.5	25.77823	3	1964.895671	1964.897984	R	-	505	524
PSM	IRYESLTDPSKLDSGK	1561	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3311.6	32.8575	3	1967.861771	1967.864255	K	E	54	70
PSM	DSENLASPSEYPENGER	1562	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3212.4	30.28185	3	1972.765571	1972.768760	R	F	617	634
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1563	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2840.2	20.74072	4	2673.046494	2673.045055	K	G	134	157
PSM	DVDDGSGSPHSPHQLSSK	1564	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2769.3	19.16087	3	2008.757171	2008.756496	R	S	2022	2040
PSM	STPSHGSVSSLNSTGSLSPK	1565	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3030.3	25.58913	3	2008.909871	2008.910280	R	H	238	258
PSM	DGARPDVTESESGSPEYR	1566	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2977.6	24.22557	3	2030.820071	2030.821859	K	Q	425	443
PSM	DQMEGSPNSSESFEHIAR	1567	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3213.4	30.30795	3	2115.817571	2115.820479	R	S	774	792
PSM	TYLVNSSDSGSSQTESPSSK	1568	sp|Q9H079|KTBL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3023.6	25.41653	3	2139.885971	2139.884519	R	Y	120	140
PSM	MPPRTPAEASSTGQTGPQSAL	1569	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3284.6	32.15667	3	2242.929971	2242.933080	K	-	238	259
PSM	MPPRTPAEASSTGQTGPQSAL	1570	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3300.4	32.56568	3	2242.930571	2242.933080	K	-	238	259
PSM	DQQNLPYGVTPASPSGHSQGR	1571	sp|Q7KZI7|MARK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3219.6	30.47167	3	2275.002671	2275.001889	R	R	607	628
PSM	YGVQADRVDKSAVGFDYQGK	1572	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3326.4	33.24188	4	2282.038894	2282.036877	K	T	162	182
PSM	ITRKPVTVSPTTPTSPTEGEAS	1573	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3011.6	25.10502	3	2335.130171	2335.130837	R	-	502	524
PSM	NGSLDSPGKQDTEEDEEEDEK	1574	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2878.6	21.70247	3	2429.922971	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEK	1575	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2833.4	20.5853	3	2429.923871	2429.923149	K	D	134	155
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	1576	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3105.5	27.50523	3	2758.054871	2758.058931	R	E	424	448
PSM	VSEEAESQQQWDTSKGEQVSQNGLPAEQGSPR	1577	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3309.6	32.80639	4	3565.558494	3565.559443	K	M	2109	2141
PSM	SSERTPGAATASASGAAEDGACGCLPNPGTFEECHRK	1578	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,22-UNIMOD:4,24-UNIMOD:4,34-UNIMOD:4	ms_run[1]:scan=1.1.3360.4	34.12398	5	3885.610118	3885.614215	R	C	53	90
PSM	NLLSVAYK	1579	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3688.2	42.38422	2	986.482647	986.483799	R	N	44	52
PSM	ESAFEFLSSA	1580	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4921.2	61.69781	2	1166.452647	1166.453287	K	-	325	335
PSM	GTPLISPLIK	1581	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3968.2	49.39248	2	1197.579847	1197.581144	R	W	826	836
PSM	SMSAPVIFDR	1582	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3720.3	43.2317	2	1201.518647	1201.520261	K	S	117	127
PSM	DSPSVWAAVPGK	1583	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3482.3	37.22978	2	1212.612847	1212.613888	K	T	27	39
PSM	AEEYEFLTPVEEAPK	1584	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3798.4	45.22362	3	1830.797471	1830.796479	R	G	153	168
PSM	DGAVNGPSVVGDQTPIEPQTSIER	1585	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3545.2	38.85783	4	2545.176894	2545.169742	K	L	377	401
PSM	DDGVFVQEVTQNSPAAR	1586	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3579.2	39.73447	3	1911.837671	1911.836387	R	T	29	46
PSM	VMTIPYQPMPASSPVICAGGQDR	1587	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3695.3	42.56958	4	2570.133294	2570.136868	R	C	178	201
PSM	NLEELNISSAQ	1588	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3704.4	42.80785	2	1296.557647	1296.559877	K	-	120	131
PSM	SESVEGFLSPSR	1589	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3604.4	40.3709	2	1373.592247	1373.586426	R	C	1311	1323
PSM	NLSSPFIFHEK	1590	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3674.2	42.02413	2	1397.636847	1397.638068	R	T	644	655
PSM	DINTFVGTPVEK	1591	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3488.2	37.3773	2	1398.640847	1398.643213	K	L	1916	1928
PSM	LLQCDPSSASQF	1592	sp|P84074|HPCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3622.4	40.84253	2	1431.569847	1431.574147	R	-	182	194
PSM	QREEYQPATPGLGMFVEVKDPEDK	1593	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3619.4	40.76537	4	2858.283294	2858.283392	K	V	72	96
PSM	DILAQSPAAEPLK	1594	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3476.5	37.07825	2	1431.699047	1431.701062	K	N	1232	1245
PSM	EGFSIPVSADGFK	1595	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3976.3	49.60972	2	1432.628447	1432.627563	K	F	1887	1900
PSM	GVAQTPGSVEEDALLCGPVSK	1596	sp|Q9BQP7|MGME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3813.3	45.61	3	2192.998571	2193.002466	R	H	64	85
PSM	ASGQAFELILSPR	1597	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4003.4	50.21118	2	1467.713447	1467.712296	R	S	15	28
PSM	TQVLSPDSLFTAK	1598	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3994.2	50.01173	2	1485.712047	1485.711627	K	F	1717	1730
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1599	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3682.4	42.23413	4	2972.320094	2972.324602	K	Q	178	204
PSM	YQIDPDACFSAK	1600	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3526.2	38.35982	3	1493.590871	1493.589797	K	V	225	237
PSM	NCTCGLAEELEK	1601	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3507.4	37.87192	2	1502.576247	1502.578247	K	E	248	260
PSM	TLTIVDTGIGMTK	1602	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3664.4	41.78075	2	1524.651447	1524.654780	R	A	28	41
PSM	DPVASSLSPYFGTK	1603	sp|Q9UNW1|MINP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3891.5	47.56362	2	1547.689647	1547.690891	R	T	37	51
PSM	TLEAEFNSPSPPTPEPGEGPR	1604	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3575.4	39.6366	3	2367.957671	2367.966154	K	K	525	546
PSM	LPSSPVYEDAASFK	1605	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3617.5	40.71625	2	1589.699047	1589.701456	R	A	415	429
PSM	DTCYSPKPSVYLSTPSSASK	1606	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,3-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3539.6	38.71413	3	2413.920671	2413.919144	K	A	538	558
PSM	IDFSSIAVPGTSSPR	1607	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3930.2	48.53607	2	1612.746247	1612.749803	R	Q	94	109
PSM	LTFDSSFSPNTGKK	1608	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3497.6	37.61623	2	1687.690447	1687.689585	K	N	97	111
PSM	RASGQAFELILSPR	1609	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3973.3	49.52562	3	1703.780471	1703.779738	K	S	14	28
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1610	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4288.2	55.17873	4	3425.462494	3425.458138	K	-	610	647
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	1611	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4118.2	52.63095	4	3450.468494	3450.464132	R	-	226	256
PSM	SSGSEGSSPNWLQALK	1612	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3969.2	49.4148	3	1726.757471	1726.756345	K	L	1708	1724
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1613	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3877.6	47.20422	4	3522.473694	3522.472617	K	F	604	634
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	1614	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3587.4	39.9417	4	3528.534494	3528.533486	K	V	871	903
PSM	DVTNFTVGGFAPMSPR	1615	sp|O00267|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4141.2	53.09873	3	1774.777871	1774.774972	R	I	653	669
PSM	VDIDTPDINIEGSEGK	1616	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3603.2	40.33768	3	1780.776971	1780.776806	K	F	3712	3728
PSM	ISLPGQMAGTPITPLK	1617	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3980.2	49.70015	3	1782.839471	1782.839226	K	D	213	229
PSM	MESLSSHRIDEDGENTQIEDTEPMSPVLNSK	1618	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3553.5	39.07742	4	3567.533694	3567.538239	K	F	528	559
PSM	DMYTICQSAGLDGLAK	1619	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3896.2	47.68305	3	1821.768671	1821.767838	R	K	522	538
PSM	GPPQSPVFEGVYNNSR	1620	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3536.2	38.62185	3	1826.799971	1826.798879	K	M	107	123
PSM	NPDDITNEEYGEFYK	1621	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3575.6	39.64326	2	1832.775647	1832.774089	R	S	300	315
PSM	DMASPNWSILPEEER	1622	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3953.2	49.07672	3	1868.762771	1868.765196	R	N	327	342
PSM	EALAEAALESPRPALVR	1623	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3564.2	39.35022	3	1871.949371	1871.950628	R	S	271	288
PSM	FDRGYISPYFINTSK	1624	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3775.3	44.62715	3	1886.859971	1886.860416	K	G	219	234
PSM	TFEEDPAVGAIVLTGGDK	1625	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3821.3	45.81777	3	1897.870571	1897.871041	K	A	75	93
PSM	KISLPGQMAGTPITPLK	1626	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3736.2	43.63457	3	1910.935271	1910.934189	K	D	212	229
PSM	SATSSSPGSPLHSLETSL	1627	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4560.2	58.2868	3	1916.780471	1916.780585	K	-	1203	1221
PSM	SATSSSPGSPLHSLETSL	1628	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4470.3	57.57053	2	1916.777247	1916.780585	K	-	1203	1221
PSM	AAPEASSPPASPLQHLLPGK	1629	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3683.3	42.25738	3	2047.013471	2047.013957	K	A	686	706
PSM	LTPSPDIIVLSDNEASSPR	1630	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3879.2	47.24574	3	2089.990571	2089.993281	R	S	119	138
PSM	DNLTLWTSDQQDEEAGEGN	1631	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3857.2	46.71512	3	2120.872871	2120.877051	R	-	228	247
PSM	STAALSGEAASCSPIIMPYK	1632	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3701.4	42.72953	3	2132.950271	2132.952345	K	A	242	262
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	1633	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3583.6	39.84528	4	4267.658894	4267.667337	K	L	164	202
PSM	ATESGAQSAPLPMEGVDISPK	1634	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3705.4	42.83417	3	2163.976571	2163.975917	K	Q	8	29
PSM	KYEQGFITDPVVLSPKDR	1635	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3542.2	38.77905	4	2171.065694	2171.066387	K	V	109	127
PSM	SDQQAQVHQLLTPASAISNK	1636	sp|Q8NDV7|TNR6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3471.6	36.95117	3	2295.027671	2295.029757	R	E	1033	1053
PSM	SGSSSPDSEITELKFPSINHD	1637	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3925.2	48.40302	3	2325.998471	2326.000217	R	-	571	592
PSM	NSTLSDSGMIDNLPDSPDEVAK	1638	sp|Q9P0V3|SH3B4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3784.5	44.86305	3	2384.006771	2384.009067	R	E	116	138
PSM	APYTCGGDSDQYVLMSSPVGR	1639	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,5-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3867.6	46.94501	3	2418.924971	2418.926280	K	I	812	833
PSM	LRELDPSLVSANDSPSGMQTR	1640	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3590.6	40.01422	3	2432.040671	2432.044421	K	C	2148	2169
PSM	CQENGQELSPIALEPGPEPHR	1641	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3465.5	36.79122	3	2437.069271	2437.073339	R	A	202	223
PSM	ASKPLPPAPAPDEYLVSPITGEK	1642	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3660.3	41.67392	3	2456.222171	2456.224009	K	I	397	420
PSM	ISPLSSPCSSPLQGTPASSLVSK	1643	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:4,10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3830.3	46.0511	3	2459.101271	2459.105625	K	I	519	542
PSM	QSKPVTTPEEIAQVATISANGDK	1644	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3514.5	38.05843	3	2463.187871	2463.189415	K	E	158	181
PSM	ESVTDYTTPSSSLPNTVATNNTK	1645	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3483.4	37.25923	3	2506.114571	2506.111224	K	M	2185	2208
PSM	CESAPGCGVWQRPVIDNPNYK	1646	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3562.6	39.31355	3	2526.0817	2526.0816	R	G	360	381
PSM	QSKPVTTPEEIAQVATISANGDK	1647	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3568.5	39.45867	3	2543.154671	2543.155746	K	E	158	181
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	1648	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3738.6	43.69912	3	2556.085871	2556.083964	K	S	180	204
PSM	SSSSESEDEDVIPATQCLTPGIR	1649	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3698.5	42.65392	3	2557.083971	2557.089109	R	T	996	1019
PSM	VMTIPYQPMPASSPVICAGGQDR	1650	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3690.6	42.4491	3	2570.133071	2570.136868	R	C	178	201
PSM	AGEARPGPTAESASGPSEDPSVNFLK	1651	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3511.5	37.98046	3	2650.188071	2650.191206	R	N	213	239
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1652	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3899.3	47.76385	5	3465.491618	3465.481982	K	A	399	429
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1653	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	33-UNIMOD:21	ms_run[1]:scan=1.1.3593.6	40.0899	4	3596.726094	3596.728741	K	-	244	278
PSM	REPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEAR	1654	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	15-UNIMOD:4,50-UNIMOD:21	ms_run[1]:scan=1.1.4087.5	52.08345	5	5712.5282	5712.5162	K	D	294	348
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1655	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3417.6	35.61137	3	2640.192671	2639.207584	K	S	97	122
PSM	QAGPASVPLRTEEEFKK	1656	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3414.3	35.5233	3	2028.8927	2028.8954	K	F	131	148
PSM	GFPTIYFSPANK	1657	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3952.2	49.05067	2	1420.640047	1420.642819	R	K	449	461
PSM	NGSLDSPGKQDTEEDEEEDEK	1658	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2896.4	22.16632	3	2430.907571	2429.923149	K	D	134	155
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1659	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3999.6	50.15057	4	3523.460094	3522.472617	K	F	604	634
PSM	CGNTIPDDDNQVVSLSPGSR	1660	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3754.6	44.11392	3	2192.9026	2192.9040	R	Y	643	663
PSM	DNLTLWTSDQQDDDGGEGNN	1661	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3883.4	47.35335	3	2193.866171	2192.873028	R	-	228	248
PSM	MEGPLSVFGDR	1662	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4269.2	54.90682	2	1344.5401	1344.5416	-	S	1	12
PSM	QLSSGVSEIR	1663	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3624.3	40.88905	2	1137.5043	1137.5062	R	H	80	90
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1664	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4088.5	52.11094	3	2829.1987	2829.1964	-	Y	1	25
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1665	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3721.6	43.258	3	2882.1610	2882.1618	M	D	2	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1666	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3734.4	43.59012	4	2882.1872	2882.1622	M	D	2	29
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	1667	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3381.6	34.67372	3	3131.2498	3131.2545	-	T	1	27
PSM	VYELSNVQEDSQPMCYSNCPDGQSTAK	1668	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:4,19-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=1.1.3596.4	40.1613	4	3186.264094	3186.261747	K	T	78	105
PSM	DYDDMSPR	1669	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2955.2	23.64187	2	1079.347247	1077.347441	R	R	279	287
PSM	IMNTFSVVPSPK	1670	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3510.6	37.95685	2	1415.650647	1414.656755	R	V	163	175
PSM	KRHEHPPNPPVSPGK	1671	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2690.2	18.05533	4	1755.856494	1755.857003	K	T	662	677
PSM	IISSIEQKEENKGGEDK	1672	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2835.3	20.64265	4	1902.956094	1902.953451	R	L	62	79
PSM	SLTPAVPVESKPDKPSGK	1673	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3027.2	25.50778	4	1915.965694	1915.965610	K	S	133	151
PSM	VLTPTQVK	1674	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3054.2	26.20677	2	964.498047	964.499449	K	N	40	48
PSM	NSNSPPSPSSMNQR	1675	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2861.2	21.26565	3	1581.626771	1581.624285	R	R	454	468
PSM	NLETPLCK	1676	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3049.2	26.08117	2	1053.454247	1053.456598	K	N	86	94
PSM	DGYNYTLSK	1677	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3115.2	27.75528	2	1059.484847	1059.487290	K	T	28	37
PSM	PYQYPALTPEQKK	1678	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3176.4	29.343	3	1641.7781	1641.7799	M	E	2	15
PSM	ADDTDSQSWRSPLK	1679	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3196.2	29.85742	3	1684.710971	1684.709395	R	A	1464	1478
PSM	GHLSRPEAQSLSPYTTSANR	1680	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3118.3	27.83615	4	2251.0508941913204	2251.0382736521397	R	A	424	444
PSM	DLHQPSLSPASPHSQGFER	1681	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	33.02613	4	2248.927694	2248.930378	K	G	58	77
PSM	GNDPLTSSPGR	1682	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2939.4	23.23395	2	1179.490447	1179.492132	R	S	20	31
PSM	GHASAPYFGKEEPSVAPSSTGK	1683	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3191.3	29.72948	4	2362.988094	2362.987224	K	T	131	153
PSM	GCESAVDELK	1684	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3151.2	28.68668	2	1186.459247	1186.457721	K	G	441	451
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1685	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3052.3	26.16075	5	2968.359618	2968.358028	R	L	420	447
PSM	KSEHLSVRPQTALEENETQK	1686	sp|Q9Y3D9|RT23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3039.3	25.82368	4	2403.1408941913205	2403.1431326435	R	E	150	170
PSM	ADTSQEICSPRLPISASHSSK	1687	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3322.3	33.1341	4	2430.028094	2430.028771	K	T	1020	1041
PSM	QNTLVNNVSSPLPGEGK	1688	sp|Q15771|RAB30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3366.3	34.27322	3	1832.868371	1832.866958	R	S	176	193
PSM	SASWGSADQLK	1689	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3295.3	32.43228	2	1228.510647	1228.512533	R	E	221	232
PSM	DQVANSAFVER	1690	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3088.4	27.08268	2	1234.588847	1234.594215	K	L	500	511
PSM	DNSTMGYMMAK	1691	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3289.4	32.27942	2	1247.497047	1247.498465	R	K	486	497
PSM	EQPPTEPGPQSASEVEK	1692	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2989.5	24.53358	3	1888.807871	1888.809169	R	I	393	410
PSM	TSSGDPPSPLVK	1693	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3023.4	25.40987	2	1263.573847	1263.574799	K	Q	80	92
PSM	ALINSPEGAVGR	1694	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3307.4	32.748	2	1262.600247	1262.602017	R	S	66	78
PSM	ELASPVSPELR	1695	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3321.3	33.10767	2	1276.603047	1276.606433	K	Q	175	186
PSM	LMIEMDGTENK	1696	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3326.6	33.24855	2	1279.578047	1279.578824	K	S	93	104
PSM	NFSDNQLQEGK	1697	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2986.6	24.45887	2	1278.581247	1278.584044	R	N	161	172
PSM	ELISNSSDALDK	1698	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3130.3	28.14983	2	1290.622847	1290.630326	R	I	47	59
PSM	QHEAPSNRPLNELLTPQGPSPR	1699	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3430.3	35.94265	4	2597.174094	2597.178881	R	T	167	189
PSM	SSGSPYGGGYGSGGGSGGYGSR	1700	sp|P51991|ROA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3036.5	25.75207	3	1989.748571	1989.749028	R	R	355	377
PSM	TYGEPESAGPSR	1701	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2836.5	20.66475	2	1329.523247	1329.523826	R	A	104	116
PSM	NGLAAELGPASPR	1702	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3334.4	33.451	2	1331.621247	1331.623480	R	R	91	104
PSM	SHSPSSPDPDTPSPVGDSR	1703	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2859.6	21.22437	3	2000.814971	2000.811294	R	A	616	635
PSM	DLSQESSSTAPGSEVTIKQEPVSPK	1704	sp|Q15596|NCOA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3277.4	31.97133	4	2680.252494	2680.248052	K	K	714	739
PSM	NNASTDYDLSDK	1705	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2949.3	23.49013	2	1341.567047	1341.568454	K	S	301	313
PSM	DGFPSGTPALNAK	1706	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3317.4	33.00617	2	1353.594247	1353.596597	K	G	148	161
PSM	ELASPVSPELR	1707	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3396.3	35.05153	2	1356.571847	1356.572764	K	Q	175	186
PSM	EMPQDLRSPARTPPSEEDSAEAER	1708	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3111.6	27.66452	4	2777.192894	2777.196368	K	L	70	94
PSM	AEGAATEEEGTPKESEPQAAAEPAEAK	1709	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2931.5	23.03008	4	2777.192094	2777.191659	K	E	26	53
PSM	SETIQDTDTQSLVGSPSTR	1710	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3317.5	33.01283	3	2100.918671	2100.921238	K	I	327	346
PSM	IIYGGSVTGATCK	1711	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3163.4	29.00317	2	1405.629047	1405.631268	R	E	244	257
PSM	ELSVQDQPSLSPTSLQNSSSHTTTAK	1712	sp|O95628|CNOT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3410.3	35.4184	4	2822.296494	2822.297128	K	G	422	448
PSM	EGLELPEDEEEK	1713	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3294.4	32.40945	2	1415.628847	1415.630385	K	K	412	424
PSM	DALKPNSPLTER	1714	sp|Q5R3I4|TTC38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3013.3	25.1471	3	1419.675671	1419.675910	R	L	446	458
PSM	HGFREGTTPKPK	1715	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2565.2	16.8726	3	1433.682671	1433.681664	R	R	76	88
PSM	EMPQDLRSPARTPPSEEDSAEAER	1716	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3016.4	25.22835	4	2873.155294	2873.157614	K	L	70	94
PSM	TPEKLDNTPASPPRSPAEPNDIPIAK	1717	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3333.5	33.42822	4	2914.344494	2914.351486	K	G	2307	2333
PSM	STGGAPTFNVTVTK	1718	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3427.5	35.87032	2	1458.671447	1458.675576	K	T	92	106
PSM	DVSGPMPDSYSPR	1719	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3267.4	31.7207	2	1486.576447	1486.579961	K	Y	291	304
PSM	NSGSFPSPSISPR	1720	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3401.6	35.19235	2	1491.578847	1491.579641	R	-	1258	1271
PSM	NIDINDVTPNCR	1721	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3270.5	31.8006	2	1509.627847	1509.628308	K	V	102	114
PSM	SSDQPLTVPVSPK	1722	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3368.5	34.33222	2	1513.642047	1513.646658	K	F	728	741
PSM	SSSPVQVEEEPVR	1723	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3078.3	26.8197	2	1521.667647	1521.671219	R	L	116	129
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1724	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3248.5	31.22783	4	3093.273694	3093.277137	R	-	738	768
PSM	VPSPLEGSEGDGDTD	1725	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3296.5	32.46485	2	1553.575247	1553.577043	K	-	413	428
PSM	PCSEETPAISPSK	1726	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2876.6	21.6513	2	1561.5743	1561.5767	M	R	2	15
PSM	ATLLEDQQDPSPSS	1727	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3300.5	32.56902	2	1566.642847	1566.645063	K	-	968	982
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1728	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3297.5	32.49078	4	3173.240494	3173.243468	R	-	738	768
PSM	NRDSDKTDTDWR	1729	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2766.3	19.08625	3	1587.632471	1587.631479	R	A	189	201
PSM	NNAYLAQSPQLYK	1730	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3410.5	35.42507	2	1588.727047	1588.728674	K	Q	242	255
PSM	DLVAQAPLKPKTPR	1731	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3117.3	27.81068	3	1612.866371	1612.870193	K	G	523	537
PSM	KSSPSVKPAVDPAAAK	1732	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2823.4	20.3494	3	1631.826071	1631.828388	K	L	181	197
PSM	DSSGQHVDVSPTSQR	1733	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2804.2	19.88902	3	1678.694471	1678.694808	K	L	550	565
PSM	STAGDTHLGGEDFDNR	1734	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3028.6	25.5467	2	1690.716447	1690.718306	K	M	224	240
PSM	KYEMFAQTLQQSR	1735	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3202.2	30.01387	3	1724.757671	1724.759322	R	G	754	767
PSM	ERAMSTTSISSPQPGK	1736	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2890.3	22.00132	3	1755.787271	1755.786265	K	L	265	281
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1737	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3425.5	35.81758	3	2639.207171	2639.207584	K	S	97	122
PSM	KPAAAAAPGTAEKLSPK	1738	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2833.3	20.58197	3	1766.835671	1766.836918	K	A	23	40
PSM	SSDEENGPPSSPDLDR	1739	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2988.3	24.50068	3	1780.678571	1780.678883	R	I	202	218
PSM	SGKYDLDFKSPDDPSR	1740	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3246.4	31.17218	3	1905.812771	1905.814588	R	Y	254	270
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	1741	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3402.6	35.21818	3	3037.292171	3037.291647	K	E	117	144
PSM	VNQSALEAVTPSPSFQQR	1742	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3431.5	35.97569	3	2037.949571	2037.952085	R	H	390	408
PSM	NGVIQHTGAAAEEFNDDTD	1743	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3288.3	32.25037	3	2082.814271	2082.816773	R	-	646	665
PSM	TVEVAEGEAVRTPQSVTAK	1744	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3185.5	29.58003	3	2130.958571	2130.959947	R	Q	132	151
PSM	SYLMTNYESAPPSPQYKK	1745	sp|O75223|GGCT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3373.4	34.45962	3	2182.965671	2182.964624	R	I	124	142
PSM	NTNDANSCQIIIPQNQVNR	1746	sp|P31150|GDIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3277.6	31.978	3	2198.049071	2198.049828	K	K	310	329
PSM	AAAAAAAAAPAAAATAPTTAATTAATAAQ	1747	sp|P37108|SRP14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3265.5	31.67198	3	2527.129871	2527.135679	K	-	108	137
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1748	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3292.3	32.35415	4	2717.305694	2717.307830	R	R	31	56
PSM	STAQQELDGKPASPTPVIVASHTANK	1749	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3186.6	29.60952	4	2726.322894	2726.327640	R	E	847	873
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1750	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3047.5	26.03902	4	2968.358494	2968.358028	R	L	420	447
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1751	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3257.6	31.46562	3	3093.272171	3093.277137	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1752	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3279.6	32.02817	3	3093.272171	3093.277137	R	-	738	768
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEK	1753	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3325.6	33.22228	5	5158.3081	5158.3119	K	K	530	577
PSM	IGPLGLSPK	1754	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3523.2	38.28018	2	960.503047	960.504534	K	K	32	41
PSM	GLESAFTEK	1755	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3596.2	40.15463	2	1060.446647	1060.447807	K	V	1291	1300
PSM	DLLLTSSYLSDSGSTGEHTK	1756	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3792.2	45.0607	4	2189.972494	2189.972940	K	S	397	417
PSM	ALLYLCGGDD	1757	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3800.3	45.27202	2	1095.491047	1095.490661	K	-	330	340
PSM	GTPLISPLIK	1758	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3847.2	46.46162	2	1117.613447	1117.614813	R	W	826	836
PSM	EASRPPEEPSAPSPTLPAQFK	1759	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3474.2	37.01579	4	2315.080494	2315.083493	R	Q	351	372
PSM	EGEEAGPGDPLLEAVPKTGDEK	1760	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3565.2	39.37453	4	2317.035294	2317.036268	K	D	353	375
PSM	TWTTPEVTSPPPSPR	1761	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3517.3	38.12917	3	1811.752271	1811.753248	R	T	125	140
PSM	GEWFLLGSPGS	1762	sp|Q96T76|MMS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.6157.2	70.17765	2	1228.516847	1228.516556	R	-	1020	1031
PSM	ALDDFVLGSAR	1763	sp|O60831|PRAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3882.3	47.324	2	1242.563047	1242.564569	R	L	11	22
PSM	LLLDPSSPPTK	1764	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3471.3	36.94117	2	1246.618047	1246.621021	K	A	21	32
PSM	QLFHPEQLITGKEDAANNYAR	1765	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3578.4	39.71527	4	2494.166094	2494.164203	R	G	85	106
PSM	SGEISLPIKEEPSPISK	1766	sp|Q9ULH7|MRTFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3525.2	38.33307	3	1889.940971	1889.938726	K	M	909	926
PSM	VLLSDSNLHDA	1767	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3462.2	36.70352	2	1262.549847	1262.554398	K	-	302	313
PSM	NSLESYAFNMK	1768	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3611.4	40.55423	2	1302.589847	1302.591438	K	A	540	551
PSM	DGLLSPGAWNGEPSGEGSR	1769	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3999.4	50.1439	3	1964.827571	1964.826550	K	S	504	523
PSM	VWSPLVTEEGK	1770	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3686.3	42.33592	2	1323.606047	1323.611184	K	R	88	99
PSM	NDPFTSDPFTK	1771	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3880.4	47.27533	2	1347.535647	1347.538413	K	N	684	695
PSM	EFSPFGTITSAK	1772	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3853.3	46.61613	2	1363.603647	1363.606099	K	V	313	325
PSM	SIPLECPLSSPK	1773	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3527.5	38.39663	2	1406.650047	1406.651669	K	G	142	154
PSM	WPDPEDLLTPR	1774	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4141.3	53.10873	2	1417.627247	1417.627897	R	W	39	50
PSM	GFPTIYFSPANK	1775	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3943.2	48.83552	2	1420.640047	1420.642819	R	K	449	461
PSM	TSSLAPVVGTTTTTPSPSAIK	1776	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3608.3	40.47223	3	2175.012371	2175.011313	K	A	226	247
PSM	GNPTVEVDLFTSK	1777	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3782.3	44.80499	2	1485.673247	1485.675241	R	G	16	29
PSM	SRDYNPYNYSDSISPFNK	1778	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3619.5	40.7687	3	2245.932371	2245.931744	R	S	1016	1034
PSM	YISPDQLADLYK	1779	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4039.2	51.02443	2	1504.683047	1504.685078	R	S	270	282
PSM	NIEIDSPYEISR	1780	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3573.4	39.58432	2	1514.663647	1514.665405	K	A	380	392
PSM	TSDIFGSPVTATSR	1781	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3546.6	38.89732	2	1517.673247	1517.676304	K	L	91	105
PSM	VESPGTYQQDPWAMTDEEK	1782	sp|O00170|AIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3731.4	43.51275	3	2289.917471	2289.913710	K	A	157	176
PSM	DSPESPFEVIIDK	1783	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4140.4	53.08317	2	1554.684447	1554.685472	K	A	242	255
PSM	TSESTGSLPSPFLR	1784	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3727.5	43.41168	2	1557.706647	1557.707604	K	A	177	191
PSM	DYEEVGVDSVEGEGEEEGEEY	1785	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3801.4	45.30782	3	2347.903871	2347.897571	K	-	431	452
PSM	VSMPDVELNLKSPK	1786	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3623.2	40.86097	3	1635.792371	1635.794311	K	V	3415	3429
PSM	TVQGPPTSDDIFER	1787	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3581.5	39.79332	2	1640.706647	1640.708332	K	E	33	47
PSM	NSSQDDLFPTSDTPR	1788	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3454.6	36.50845	2	1758.707447	1758.709789	K	A	479	494
PSM	GNCVSLLSPSPEGDPR	1789	sp|P17813|EGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3466.5	36.8172	3	1763.753471	1763.754965	K	F	514	530
PSM	DSSTSYTETKDPSSGQEVATPPVPQLQVCEPK	1790	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,29-UNIMOD:4	ms_run[1]:scan=1.1.3612.6	40.58758	4	3541.582494	3541.580756	R	E	663	695
PSM	ISLPGQMAGTPITPLK	1791	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3972.2	49.4959	3	1782.839471	1782.839226	K	D	213	229
PSM	VYWDNGAQIISPHDK	1792	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3519.2	38.17682	3	1821.808871	1821.808715	K	G	176	191
PSM	GPPQSPVFEGVYNNSR	1793	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3520.2	38.2023	3	1826.799971	1826.798879	K	M	107	123
PSM	SWASPVYTEADGTFSR	1794	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3869.2	46.98328	3	1852.764671	1852.766910	R	L	342	358
PSM	ASSTSPVEISEWLDQK	1795	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4132.2	52.8654	3	1855.822871	1855.824091	K	L	188	204
PSM	DWILPSDYDHAEAEAR	1796	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3714.2	43.06223	3	1886.847071	1886.843506	K	H	256	272
PSM	NVSSFPDDATSPLQENR	1797	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3470.2	36.91105	3	1955.823671	1955.826216	R	N	52	69
PSM	DYNPYNYSDSISPFNK	1798	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3899.2	47.76052	3	2002.798571	2002.798604	R	S	1018	1034
PSM	GTDECAIESIAVAATPIPK	1799	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3803.3	45.35022	3	2021.939471	2021.938075	R	L	444	463
PSM	AAPEASSPPASPLQHLLPGK	1800	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3675.3	42.0522	3	2047.013471	2047.013957	K	A	686	706
PSM	TVDFTQDSNYLLTGGQDK	1801	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	46.02197	3	2080.895771	2080.899046	K	L	105	123
PSM	TIGGGDDSFNTFFSETGAGK	1802	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4123.2	52.74508	3	2086.851671	2086.852096	K	H	41	61
PSM	LHIIEVGTPPTGNQPFPK	1803	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3862.2	46.84115	3	2103.979571	2103.979560	K	K	228	246
PSM	DKPTYDEIFYTLSPVNGK	1804	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4003.3	50.20785	3	2165.992571	2165.992219	K	I	444	462
PSM	DSLGAHSITSPGGNNVQLIDK	1805	sp|Q92503|S14L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3525.3	38.3364	3	2202.025271	2202.031792	K	V	577	598
PSM	IGGDAATTVNNSTPDFGFGGQK	1806	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3658.5	41.63005	3	2232.968471	2232.968857	K	R	88	110
PSM	EIFDSRGNPTVEVDLFTSK	1807	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4350.2	56.06918	3	2312.997671	2312.996726	R	G	10	29
PSM	FVEWLQNAEEESESEGEEN	1808	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4273.3	54.95637	3	2333.888771	2333.884913	K	-	401	420
PSM	DNLTLWTSENQGDEGDAGEGEN	1809	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3870.5	47.0194	3	2349.944471	2349.946922	R	-	225	247
PSM	GVVPLAGTNGETTTQGLDGLSER	1810	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3760.4	44.26173	3	2351.094071	2351.100600	K	C	112	135
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1811	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3941.3	48.7873	3	2407.991171	2407.988786	R	-	223	246
PSM	ATTPASTANSDVATIPTDTPLKEENEGFVK	1812	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3722.6	43.2844	4	3263.453294	3263.452382	K	V	274	304
PSM	DNLTLWTADNAGEEGGEAPQEPQS	1813	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3918.4	48.23553	3	2528.094671	2528.093920	R	-	225	249
PSM	ISPLSSPCSSPLQGTPASSLVSK	1814	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4008.3	50.32243	3	2539.071371	2539.071956	K	I	519	542
PSM	SSSSESEDEDVIPATQCLTPGIR	1815	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3682.6	42.2408	3	2557.083971	2557.089109	R	T	996	1019
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1816	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3460.4	36.65837	3	2619.212171	2619.213536	R	D	175	200
PSM	DGAVNGPSVVGDQTPIEPQTSIER	1817	sp|P49321|NASP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3594.5	40.1126	3	2625.137171	2625.136073	K	L	377	401
PSM	NEETPAAPTPAGATGGSSAWLDSSSENR	1818	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3577.5	39.69208	3	2839.187471	2839.193391	R	G	385	413
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1819	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3851.6	46.57267	3	2881.092371	2881.094982	K	T	701	725
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1820	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	33-UNIMOD:21	ms_run[1]:scan=1.1.3595.5	40.13862	4	3596.726094	3596.728741	K	-	244	278
PSM	NPEVGLKPVWYSPK	1821	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3612.2	40.57425	3	1692.824771	1692.827660	K	V	536	550
PSM	ATGANATPLDFPSK	1822	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3616.4	40.68582	2	1510.6664	1510.6700	M	K	2	16
PSM	IMNTFSVVPSPK	1823	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3811.4	45.56148	2	1478.626847	1478.628171	R	V	163	175
PSM	IMNTFSVVPSPK	1824	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3518.4	38.15833	2	1415.651847	1414.656755	R	V	163	175
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1825	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3679.5	42.15933	3	2765.2240	2765.2250	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1826	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3923.4	48.35825	4	2749.2308	2749.2301	-	Y	1	25
PSM	TEWETAAPAVAETPDIK	1827	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3983.2	49.77782	3	1949.8675	1949.8654	M	L	2	19
PSM	QREEYQPATPGLGMFVEVKDPEDK	1828	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3982.4	49.7585	4	2825.2632	2825.2614	K	V	72	96
PSM	CDFTEDQTAEFK	1829	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3707.6	42.89303	2	1611.5797	1611.5795	M	E	2	14
PSM	YNLQEVVKSPKDPSQLNSK	1830	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3326.3	33.23855	4	2253.104094	2253.104229	K	Q	262	281
PSM	KLENSPLGEALRSGQAR	1831	sp|Q9NX40|OCAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3238.5	30.96682	3	1984.909571	1984.913271	K	R	104	121
PSM	SPGETSKPRPFAGGGYR	1832	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2956.2	23.66755	4	1842.844494	1842.841412	K	L	140	157
PSM	VKLDSPAGTALSPSGHTK	1833	sp|P32322|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3114.2	27.72913	4	1924.874894	1924.869675	K	L	290	308
PSM	SLSPGLDTK	1834	sp|O95900|TRUB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3033.2	25.66347	2	996.451647	996.452893	K	Q	297	306
PSM	GAVDGGLSIPHSTK	1835	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3291.2	32.32493	3	1497.625271	1497.626591	K	R	165	179
PSM	GVISTPVIR	1836	sp|Q9NZB2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3354.2	33.9659	2	1020.532647	1020.536897	R	T	987	996
PSM	TPEPSSPVKEPPPVLAKPK	1837	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3084.2	26.97215	4	2077.080894	2077.086059	K	L	639	658
PSM	NSNSPPSPSSMNQR	1838	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2870.4	21.4917	3	1581.624071	1581.624285	R	R	454	468
PSM	DINAYNCEEPTEK	1839	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3025.3	25.45868	3	1581.659771	1581.661702	K	L	85	98
PSM	SGTSEFLNK	1840	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3131.2	28.17278	2	1061.440447	1061.443056	K	M	169	178
PSM	DAYSSFGSR	1841	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3181.2	29.46658	2	1068.390247	1068.391355	K	S	67	76
PSM	DLHQPSLSPASPHSQGFER	1842	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3231.3	30.7764	4	2168.961694	2168.964047	K	G	58	77
PSM	ACKVDSPTVNTTLR	1843	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3018.4	25.27993	3	1640.758271	1640.759322	K	S	440	454
PSM	HGSYEDAVHSGALND	1844	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3073.3	26.68945	3	1650.631571	1650.631145	K	-	542	557
PSM	ISQSGDFLR	1845	sp|O95302|FKBP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3355.2	33.9915	2	1101.485847	1101.485590	R	Y	274	283
PSM	STTPPPAEPVSLPQEPPKPR	1846	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3298.2	32.50677	4	2204.086494	2204.087850	K	V	225	245
PSM	EKTPSPKEEDEEPESPPEK	1847	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2801.2	19.8037	4	2260.965694	2260.962435	K	K	200	219
PSM	DQQNLPYGVTPASPSGHSQGR	1848	sp|Q7KZI7|MARK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3224.3	30.59195	4	2275.002094	2275.001889	R	R	607	628
PSM	DYTGCSTSESLSPVK	1849	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3178.2	29.38837	3	1709.685671	1709.685548	R	Q	199	214
PSM	GLQSGVDIGVK	1850	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3405.2	35.28382	2	1151.558247	1151.558755	K	Y	135	146
PSM	QLSSGVSEIR	1851	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3186.4	29.60285	2	1154.530447	1154.533268	R	H	80	90
PSM	ESEDKPEIEDVGSDEEEEKK	1852	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2974.4	24.14112	4	2320.008894	2320.007791	K	D	251	271
PSM	DNLTSATLPR	1853	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3344.2	33.70532	2	1166.529447	1166.533268	K	N	302	312
PSM	TISPMVMDAK	1854	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3349.3	33.83922	2	1171.499047	1171.501834	K	A	793	803
PSM	ADTSQEICSPRLPISASHSSK	1855	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3241.3	31.03838	4	2350.058494	2350.062440	K	T	1020	1041
PSM	LALGDDSPALK	1856	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3351.2	33.88803	2	1178.554047	1178.558421	R	E	87	98
PSM	RTEGVGPGVPGEVEMVK	1857	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3373.3	34.45628	3	1819.852571	1819.853951	R	G	16	33
PSM	NGSLDSPGKQDTEEDEEEDEK	1858	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2841.5	20.77608	4	2429.920494	2429.923149	K	D	134	155
PSM	GVLLYGPPGTGK	1859	sp|Q8NB90|AFG2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	35.46767	2	1237.606447	1237.610790	R	T	389	401
PSM	QLVRGEPNVSYICSR	1860	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3295.4	32.43562	3	1856.859371	1856.860433	K	Y	269	284
PSM	IVRGDQPAASGDSDDDEPPPLPR	1861	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3202.4	30.02053	4	2483.098494	2483.096577	K	L	45	68
PSM	STGCDFAVSPK	1862	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3107.4	27.55385	2	1247.486447	1247.489355	K	L	501	512
PSM	ALINSPEGAVGR	1863	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3317.3	33.00283	2	1262.600247	1262.602017	R	S	66	78
PSM	TSSGDPPSPLVK	1864	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3007.5	24.99813	2	1263.575447	1263.574799	K	Q	80	92
PSM	LSASTASELSPK	1865	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3050.3	26.11027	2	1269.581047	1269.585364	R	S	451	463
PSM	NQSPVLEPVGR	1866	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3120.4	27.8926	2	1274.598847	1274.602017	R	S	713	724
PSM	VKLDSPAGTALSPSGHTK	1867	sp|P32322|P5CR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3120.5	27.89593	3	1924.867871	1924.869675	K	L	290	308
PSM	NLQYYDISAK	1868	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3431.4	35.97235	2	1293.560047	1293.564234	K	S	143	153
PSM	CSGPGLSPGMVR	1869	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3303.3	32.64052	2	1296.532447	1296.535594	K	A	1453	1465
PSM	CSGPGLSPGMVR	1870	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3311.4	32.85083	2	1296.532447	1296.535594	K	A	1453	1465
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	1871	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.2630.2	17.3932	4	2627.084094	2627.080669	K	L	460	485
PSM	TQPDGTSVPGEPASPISQR	1872	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3159.5	28.90172	3	2002.898171	2002.899715	R	L	1744	1763
PSM	SAESPTSPVTSETGSTFKK	1873	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3108.3	27.57665	3	2019.901871	2019.903797	K	F	280	299
PSM	SMGTGDTPGLEVPSSPLRK	1874	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3327.3	33.26473	3	2023.928171	2023.928573	R	A	381	400
PSM	TFDQLTPDESK	1875	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3138.4	28.3607	2	1359.555247	1359.559543	K	E	71	82
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1876	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3316.3	32.97675	4	2717.305694	2717.307830	R	R	31	56
PSM	ISVYYNEATGGK	1877	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3206.2	30.1182	2	1380.594447	1380.596263	R	Y	47	59
PSM	ESDFSDTLSPSK	1878	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3209.2	30.19665	2	1391.548247	1391.549372	K	E	444	456
PSM	AAQQAASSSGQGQQAQTPTGF	1879	sp|P48729-3|KC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3140.3	28.40882	3	2099.887871	2099.890941	K	-	305	326
PSM	INVYYNEATGGK	1880	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3195.4	29.83792	2	1407.608447	1407.607162	R	Y	47	59
PSM	NSGSFPSPSISPR	1881	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3330.5	33.34978	2	1411.610847	1411.613310	R	-	1258	1271
PSM	KLECLPPEPSPDDPESVK	1882	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3301.4	32.59143	3	2115.940271	2115.943554	R	I	346	364
PSM	GILAADESTGSIAK	1883	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3291.6	32.33827	2	1411.655847	1411.659591	K	R	29	43
PSM	NSGSFPSPSISPR	1884	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3338.5	33.55807	2	1411.610847	1411.613310	R	-	1258	1271
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	1885	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3256.3	31.42978	4	2838.175294	2838.177635	K	M	23	49
PSM	ISVREPMQTGIK	1886	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3162.3	28.97393	3	1437.706571	1437.705102	R	A	183	195
PSM	NQIHVKSPPREGSQGELTPANSQSR	1887	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2943.6	23.34438	4	2876.301294	2876.296765	R	M	462	487
PSM	GGDSIGETPTPGASK	1888	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2896.3	22.15965	2	1452.614647	1452.613369	R	R	319	334
PSM	STNEAMEWMNNK	1889	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3424.6	35.79488	2	1453.592647	1453.596599	K	L	737	749
PSM	TPQAPASANLVGPR	1890	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3158.2	28.86583	3	1457.701271	1457.702793	R	S	2329	2343
PSM	VDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1891	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3420.5	35.68699	4	2925.348894	2925.350560	K	A	461	493
PSM	ETCVSGEDPTQGADLSPDEK	1892	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3154.6	28.77505	3	2213.861771	2213.867154	K	V	468	488
PSM	DVSGPMPDSYSPR	1893	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3251.4	31.30252	2	1486.576447	1486.579961	K	Y	291	304
PSM	KYEEIDNAPEER	1894	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2888.2	21.94628	3	1491.682271	1491.684152	K	A	91	103
PSM	QQNSGRMSPMGTASGSNSPTSDSASVQR	1895	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3049.6	26.0945	4	2984.182894	2984.179094	R	A	41	69
PSM	DTYSDRSGSSSPDSEITELK	1896	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3355.6	34.00483	3	2252.924471	2252.932197	R	F	565	585
PSM	SESPKEPEQLRK	1897	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2765.2	19.06132	3	1506.708071	1506.707938	K	L	4	16
PSM	VCVPSSASALGTASK	1898	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3234.5	30.86223	2	1513.681047	1513.684760	R	A	507	522
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	1899	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3432.5	36.00188	4	3037.290494	3037.291647	K	E	117	144
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1900	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3163.5	29.0065	4	3117.280894	3117.283662	R	A	333	362
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1901	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3421.5	35.71342	3	2378.071571	2378.078288	K	S	366	389
PSM	RDPFRDSPLSSR	1902	sp|Q9UJY1|HSPB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3149.2	28.63768	3	1591.651271	1591.654537	R	L	18	30
PSM	APVPGTPDSLSSGSSR	1903	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3076.6	26.77767	2	1593.701047	1593.703581	K	D	322	338
PSM	VGDSTPVSEKPVSAAVDANASESP	1904	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3292.6	32.36415	3	2393.060171	2393.063546	R	-	429	453
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1905	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3230.6	30.76063	4	3197.249694	3197.249993	R	A	333	362
PSM	GGKPEPPAMPQPVPTA	1906	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3313.6	32.90858	2	1652.760247	1652.763345	K	-	228	244
PSM	HSGPNSADSANDGFVR	1907	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2948.3	23.4644	3	1709.677271	1709.679492	K	L	99	115
PSM	VIGSGCNLDSARFR	1908	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3381.2	34.66039	3	1710.689771	1710.695022	R	Y	158	172
PSM	DTGKTPVEPEVAIHR	1909	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3062.2	26.40468	3	1727.820971	1727.824365	K	I	5	20
PSM	HAQDSDPRSPTLGIAR	1910	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3000.5	24.81722	3	1799.829671	1799.831576	K	T	60	76
PSM	DAPTSPASVASSSSTPSSK	1911	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2950.4	23.51928	2	1842.788847	1842.788433	K	T	282	301
PSM	MLDAEDIVNTARPDEK	1912	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3420.3	35.68032	3	1895.833571	1895.833609	K	A	240	256
PSM	STSGPRPGCQPSSPCVPK	1913	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:4,13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2886.5	21.905	3	1977.842471	1977.843797	R	L	468	486
PSM	HRVIGSGCNLDSARFR	1914	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3186.2	29.59618	4	2003.858494	2003.855045	K	Y	157	173
PSM	GPPASSPAPAPKFSPVTPK	1915	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3369.3	34.3517	3	2071.881971	2071.882228	R	F	254	273
PSM	EFQDAGEQVVSSPADVAEK	1916	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3387.3	34.81861	3	2084.891771	2084.893961	K	A	77	96
PSM	DSESSNDDTSFPSTPEGIK	1917	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3359.4	34.099	3	2091.813971	2091.815770	K	D	437	456
PSM	AEPQPLSPASSSYSVSSPR	1918	sp|P18850|ATF6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3372.5	34.43685	3	2105.872871	2105.870797	K	S	88	107
PSM	SLDSDESEDEEDDYQQK	1919	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3010.5	25.07587	3	2110.737371	2110.737580	K	R	57	74
PSM	DCNDTLEEENTNLETPTK	1920	sp|Q9BZE2|PUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3245.5	31.14932	3	2201.859071	2201.867154	R	R	452	470
PSM	LQQGAGLESPQGQPEPGAASPQR	1921	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3101.5	27.40262	3	2382.093071	2382.096517	R	Q	72	95
PSM	VGDSTPVSEKPVSAAVDANASESP	1922	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3365.6	34.25658	3	2473.026371	2473.029877	R	-	429	453
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	1923	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3315.5	32.95753	3	2494.086371	2494.089063	R	L	815	839
PSM	DGVVEITGKHEERQDEHGYISR	1924	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3040.2	25.8468	5	2553.219618	2553.220792	K	C	115	137
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	1925	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3393.3	34.97357	7	4716.0985	4716.0943	K	A	530	573
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	1926	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3376.3	34.53477	5	2991.327118	2991.328110	R	V	221	251
PSM	LVDAGEECDCGTPKECELDPCCEGSTCK	1927	sp|Q13443|ADAM9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4,21-UNIMOD:4,22-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.3273.3	31.86853	4	3355.220494	3355.215468	K	L	421	449
PSM	SDGAPASDSKPGSSEAAPSSKETPAATEAPSSTPK	1928	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	31-UNIMOD:21	ms_run[1]:scan=1.1.2858.6	21.19868	4	3379.502094	3379.494049	K	A	164	199
PSM	HSDLFSSSSPWDK	1929	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3546.2	38.88398	3	1571.628971	1571.629354	K	G	779	792
PSM	GDLGIEIPAEK	1930	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3477.3	37.09843	2	1140.602047	1140.602654	R	V	295	306
PSM	DLNVLTPTGF	1931	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4673.2	59.4497	2	1155.521247	1155.521307	R	-	296	306
PSM	STFVLDEFK	1932	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3982.2	49.75183	2	1164.509247	1164.510408	K	R	286	295
PSM	ESAFEFLSSA	1933	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4895.2	61.5081	2	1166.452647	1166.453287	K	-	325	335
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1934	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3484.2	37.27818	4	2378.077694	2378.078288	K	S	366	389
PSM	VSSGYVPPPVATPFSSK	1935	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3538.4	38.68137	3	1798.854671	1798.854268	R	S	168	185
PSM	TWTTPEVTSPPPSPR	1936	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3501.4	37.71432	3	1811.752271	1811.753248	R	T	125	140
PSM	FIVSPVPESR	1937	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	37.35282	2	1209.577647	1209.579490	R	L	1258	1268
PSM	GPPQSPVFEGVYNNSR	1938	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3528.3	38.41565	3	1826.799971	1826.798879	K	M	107	123
PSM	VSTAVLSITAK	1939	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	36.6517	2	1248.575847	1248.576787	K	A	828	839
PSM	KAPLNIPGTPVLEDFPQNDDEK	1940	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3889.3	47.50537	4	2516.184494	2516.183601	R	E	41	63
PSM	QGAIVAVTGDGVNDSPALK	1941	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3501.5	37.71765	3	1890.911171	1890.908823	R	K	708	727
PSM	QSKPVTTPEEIAQVATISANGDK	1942	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3560.2	39.24935	4	2543.157694	2543.155746	K	E	158	181
PSM	SRGPATVEDLPSAFEEK	1943	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3601.5	40.29582	3	1911.858971	1911.861539	R	A	247	264
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	1944	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3741.2	43.76197	4	2556.082494	2556.083964	K	S	180	204
PSM	DAGTIAGLNVLR	1945	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3942.2	48.80665	2	1278.632247	1278.633317	K	I	160	172
PSM	NLEELNISSAQ	1946	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3696.4	42.59878	2	1296.557647	1296.559877	K	-	120	131
PSM	GRPSSPRTPLYLQPDAYGSLDR	1947	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3672.3	41.9778	4	2605.173294	2605.172733	K	A	116	138
PSM	IMGTSPLQIDR	1948	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3568.3	39.452	2	1309.605247	1309.610139	K	A	1075	1086
PSM	TLTPISAAYAR	1949	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3516.4	38.10697	2	1322.564847	1322.567285	K	A	295	306
PSM	EVYELLDSPGK	1950	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3569.3	39.47733	2	1328.588647	1328.590115	K	V	20	31
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	1951	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3492.4	37.48315	4	2676.225294	2676.233345	K	E	296	321
PSM	SIYDDISSPGLGSTPLTSR	1952	sp|Q8NFH5|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3933.2	48.59273	3	2044.935371	2044.935432	R	R	93	112
PSM	TVDSQGPTPVCTPTFLER	1953	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3706.5	42.8632	3	2083.926671	2083.928573	K	R	227	245
PSM	QEQINTEPLEDTVLSPTK	1954	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3728.2	43.42733	3	2120.985071	2120.987861	K	K	271	289
PSM	AIGSASEGAQSSLQEVYHK	1955	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3473.4	36.99627	3	2120.880071	2120.881696	R	S	169	188
PSM	GFPTIYFSPANK	1956	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3961.3	49.27648	2	1420.640047	1420.642819	R	K	449	461
PSM	AFLAELEQNSPK	1957	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3705.3	42.83083	2	1425.652047	1425.654112	K	I	4512	4524
PSM	SSTVGLVTLNDMK	1958	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3774.6	44.61212	2	1443.665047	1443.668047	K	A	62	75
PSM	FLSQESGVAQTLK	1959	sp|Q8N392|RHG18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3491.3	37.45503	2	1486.705047	1486.706876	R	K	608	621
PSM	LGGSAVISLEGKPL	1960	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4106.3	52.44263	2	1499.701247	1499.703779	K	-	153	167
PSM	TLTIVDTGIGMTK	1961	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3904.2	47.8831	2	1508.660447	1508.659865	R	A	28	41
PSM	TLTIVDTGIGMTK	1962	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3896.3	47.68638	2	1508.660447	1508.659865	R	A	28	41
PSM	EGFSIPVSADGFK	1963	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4269.3	54.91682	2	1512.593447	1512.593894	K	F	1887	1900
PSM	ESMCSTPAFPVSPETPYVK	1964	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3909.4	47.99623	3	2285.903171	2285.902691	K	T	839	858
PSM	TSESTGSLPSPFLR	1965	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3719.3	43.196	2	1557.706447	1557.707604	K	A	177	191
PSM	YHTSQSGDEMTSLSEYVSR	1966	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3735.5	43.61887	3	2335.872071	2335.870539	R	M	457	476
PSM	NLNNSNLFSPVNR	1967	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3618.4	40.73907	2	1567.709847	1567.714421	K	D	604	617
PSM	TLEAEFNSPSPPTPEPGEGPR	1968	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3592.4	40.0575	3	2367.957671	2367.966154	K	K	525	546
PSM	ALSSDSILSPAPDAR	1969	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3460.3	36.65503	2	1578.730647	1578.729068	R	A	392	407
PSM	DMSPLSETEMALGK	1970	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4090.2	52.14602	3	1587.657071	1587.656162	K	D	505	519
PSM	IIAFVGSPVEDNEK	1971	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3640.3	41.18665	2	1596.740647	1596.743655	R	D	109	123
PSM	IDFSSIAVPGTSSPR	1972	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3922.2	48.32928	2	1612.746247	1612.749803	R	Q	94	109
PSM	APNTPDILEIEFKK	1973	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3801.2	45.29448	3	1693.831271	1693.832805	K	G	216	230
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	1974	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4299.3	55.38327	4	3425.462494	3425.458138	K	-	610	647
PSM	VTNGAFTGEISPGMIK	1975	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3565.6	39.38787	2	1716.778247	1716.779389	K	D	107	123
PSM	NWTEDMEGGISSPVK	1976	sp|P08651|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3670.5	41.93423	2	1728.700847	1728.706618	R	K	312	327
PSM	NLEQILNGGESPKQK	1977	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3523.3	38.28352	3	1733.833571	1733.834930	K	G	219	234
PSM	GGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGR	1978	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3661.5	41.70637	4	3547.330094	3547.327684	R	G	229	267
PSM	VTNGAFTGEISPGMIK	1979	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3880.3	47.272	3	1780.750871	1780.750805	K	D	107	123
PSM	ISLPGQMAGTPITPLK	1980	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35,10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3775.2	44.62382	3	1798.831871	1798.834141	K	D	213	229
PSM	EAIQAYSESLMTSAPK	1981	sp|Q8WTV0-2|SCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3693.3	42.51712	3	1804.792271	1804.795433	K	G	485	501
PSM	MDATANDVPSPYEVR	1982	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3474.5	37.02578	3	1823.682371	1823.683848	K	G	434	449
PSM	SATSSSPGSPLHSLETSL	1983	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3999.3	50.14057	3	1836.814871	1836.814254	K	-	1203	1221
PSM	VSSGYVPPPVATPFSSK	1984	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3627.2	40.9598	3	1878.813371	1878.820599	R	S	168	185
PSM	VVESPDFSKDEDYLGK	1985	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3476.2	37.06825	3	1906.822571	1906.823756	K	V	923	939
PSM	RPPEPTTPWQEDPEPEDENLYEK	1986	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3524.6	38.32075	3	2875.220171	2875.222566	K	N	47	70
PSM	ALSSGGSITSPPLSPALPK	1987	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3805.2	45.3984	3	1938.909371	1938.910477	R	Y	17	36
PSM	YVASYLLAALGGNSSPSAK	1988	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4667.2	59.38383	3	1947.934871	1947.934310	R	D	3	22
PSM	SSTPPGESYFGVSSLQLK	1989	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4054.2	51.32448	3	1962.896171	1962.897590	K	G	1041	1059
PSM	FDRGYISPYFINTSK	1990	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3878.2	47.21622	3	1966.826171	1966.826747	K	G	219	234
PSM	DSSTSPGDYVLSVSENSR	1991	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3807.2	45.45358	3	1978.815371	1978.815711	R	V	39	57
PSM	SGAMSPMSWNSDASTSEAS	1992	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3812.6	45.59412	2	1981.705047	1981.707088	R	-	190	209
PSM	LATQSNEITIPVTFESR	1993	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4005.3	50.24062	3	1984.948871	1984.950688	K	A	172	189
PSM	QLLTLSSELSQARDENK	1994	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3809.4	45.50948	3	2010.955871	2010.962315	R	R	530	547
PSM	QITVNDLPVGRSVDETLR	1995	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3710.3	42.9709	3	2091.030971	2091.036149	R	L	141	159
PSM	DNLTLWTSDMQGDGEEQNK	1996	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3580.3	39.7622	3	2195.928671	2195.927707	R	E	226	245
PSM	NDSPTQIPVSSDVCRLTPA	1997	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3698.4	42.65059	3	2215.920971	2215.922181	R	-	673	692
PSM	QHPQPYIFPDSPGGTSYER	1998	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3517.5	38.13583	3	2254.967171	2254.968463	R	Y	75	94
PSM	DYEEVGVDSVEGEGEEEGEEY	1999	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3791.3	45.03742	3	2347.898771	2347.897571	K	-	431	452
PSM	SSDEENGPPSSPDLDRIAASMR	2000	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3724.4	43.32987	3	2410.010171	2410.010799	R	A	202	224
PSM	AIVDALPPPCESACTVPTDVDK	2001	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3713.5	43.04583	3	2434.089371	2434.079730	R	W	261	283
PSM	EGPYSISVLYGDEEVPRSPFK	2002	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4022.3	50.63047	3	2448.126371	2448.125024	R	V	1516	1537
PSM	DNLTLWTSDSAGEECDAAEGAEN	2003	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3954.4	49.11282	3	2453.974271	2453.976507	R	-	223	246
PSM	KFVEWLQNAEEESESEGEEN	2004	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3880.6	47.282	3	2461.976471	2461.979876	K	-	400	420
PSM	DNLTLWTADNAGEEGGEAPQEPQS	2005	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3901.6	47.82295	3	2528.094671	2528.093920	R	-	225	249
PSM	AGSEECVFYTDETASPLAPDLAK	2006	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3915.5	48.15452	3	2550.084071	2550.087318	R	A	610	633
PSM	RIADYEAASAVPGVAAEQPGVSPSGS	2007	sp|Q9Y5J6|T10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3618.6	40.74574	3	2565.172271	2565.174827	R	-	78	104
PSM	EATNTTSEPSAPSQDLLDLSPSPR	2008	sp|O75674|TM1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3803.6	45.36022	3	2592.155771	2592.159237	K	M	302	326
PSM	IDEDGENTQIEDTEPMSPVLNSK	2009	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3623.6	40.8743	3	2640.133871	2640.114989	R	F	536	559
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	2010	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21,32-UNIMOD:4	ms_run[1]:scan=1.1.3613.6	40.61355	4	3813.470494	3813.463279	R	G	32	65
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2011	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3833.5	46.1338	3	2881.092371	2881.094982	K	T	701	725
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	2012	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3615.5	40.66362	4	3464.574094	3464.574823	K	E	218	249
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	2013	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,17-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3711.5	42.9936	4	3544.540894	3544.541154	K	E	218	249
PSM	SNDSTEQNLSDGTPMPDSYPTTPSSTDAATSESK	2014	sp|Q7Z6Z7|HUWE1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3458.6	36.61282	4	3597.442894	3597.446172	K	E	2726	2760
PSM	EKEPSYPMPVQETQAPESPGENSEQALQTLSPR	2015	sp|Q7Z434|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3761.6	44.29323	4	3813.648094	3813.648198	R	A	135	168
PSM	SAESPTSPVTSETGSTFK	2016	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3487.4	37.35948	3	1972.778771	1971.775165	K	K	280	298
PSM	RFSEGVLQSPSQDQEK	2017	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3147.4	28.59297	3	1914.846971	1913.852037	R	L	427	443
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2018	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3709.6	42.94508	3	3442.3997	3442.4027	K	L	104	135
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	2019	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3344.4	33.71198	4	2898.289694	2898.290225	K	L	281	308
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	2020	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2983.4	24.37423	5	3486.475118	3485.482619	K	D	124	155
PSM	NGSLDSPGKQDTEEDEEEDEK	2021	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2931.6	23.03342	3	2430.908471	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2022	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2845.3	20.87158	4	2594.066094	2593.078724	K	G	134	157
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	2023	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3719.4	43.19933	3	2574.985571	2573.998594	R	G	239	267
PSM	ESVPEFPLSPPK	2024	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3805.4	45.40507	2	1405.650647	1405.653049	K	K	30	42
PSM	ASGVAVSDGVIK	2025	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3700.2	42.69608	2	1303.5449	1303.5457	M	V	2	14
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2026	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3544.6	38.84503	4	3563.478894	3562.491898	K	V	60	92
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	2027	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3621.6	40.82375	3	2758.1462	2758.1503	M	D	2	33
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDK	2028	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,42-UNIMOD:21	ms_run[1]:scan=1.1.3566.6	39.4124	4	4593.1184	4593.1139	M	K	2	53
PSM	SSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKK	2029	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,43-UNIMOD:21	ms_run[1]:scan=1.1.3451.4	36.42662	5	4721.2106	4721.2089	M	V	2	54
PSM	ATAEVLNIGKK	2030	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3539.4	38.70747	2	1264.6407	1264.6423	M	L	2	13
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2031	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3892.5	47.58947	3	2749.2295	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2032	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3750.6	44.00975	3	2845.1905	2845.1913	-	Y	1	25
PSM	TEWETAAPAVAETPDIK	2033	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3967.4	49.37	3	1949.8675	1949.8654	M	L	2	19
PSM	AADVSVTHRPPLSPK	2034	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3224.2	30.58862	3	1696.8352	1695.8342	M	S	2	17
PSM	NVSSFPDDATSPLQENR	2035	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3445.6	36.28808	2	1956.826047	1955.826216	R	N	52	69
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	2036	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3738.3	43.68912	4	2882.1872	2882.1622	M	D	2	29
PSM	VASGGGGVGDGVQEPTTGNWR	2037	sp|O00429-2|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	32.79972	3	2079.896471	2079.901112	K	G	559	580
PSM	AENVVEPGPPSAK	2038	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3272.3	31.84397	2	1415.6298	1415.6329	M	R	2	15
PSM	MNPVYSPGSSGVPYANAK	2039	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3828.2	45.99613	3	1959.8444	1959.8433	-	G	1	19
PSM	SGPDVETPSAIQICR	2040	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3691.6	42.47543	2	1750.7549	1750.7592	M	I	2	17
PSM	AEQDVENDLLDYDEEEEPQAPQESTPAPPKK	2041	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,25-UNIMOD:21	ms_run[1]:scan=1.1.4083.3	51.97882	4	3632.5568	3632.5562	M	D	2	33
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	2042	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3205.6	30.10565	3	3147.2453	3147.2495	-	T	1	27
PSM	MDLFGDLPEPERSPRPAAGK	2043	sp|Q9H0C8|ILKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4156.2	53.45415	3	2304.0590	2304.0605	-	E	1	21
PSM	CESAFLSK	2044	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3985.2	49.83313	2	1003.3703	1003.3717	K	R	36	44
PSM	AAPEEHDSPTEASQPIVEEEETK	2045	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3376.6	34.54477	3	2644.1041	2644.1060	M	T	2	25
PSM	MQSPAVLVTSR	2046	sp|Q53T59|H1BP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3774.3	44.60212	2	1309.6075	1309.6096	-	R	1	12
PSM	AQQNNVEHKVETFSGVYK	2047	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3260.2	31.53087	4	2236.952094	2236.955530	K	K	161	179
PSM	QNSLHGSFHSADVLK	2048	sp|Q9NSY1|BMP2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,10-UNIMOD:21	ms_run[1]:scan=1.1.3840.2	46.30639	2	1701.7652	1701.7502	R	M	1105	1120
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2049	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2884.5	21.85325	4	2674.025294	2673.045055	K	G	134	157
PSM	NASTFEDVTQVSSAYQK	2050	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3474.6	37.02912	3	1955.823671	1953.835718	K	T	320	337
PSM	LQANLTFDPAALLPGASPK	2051	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4151.2	53.36332	3	2083.982771	2082.979225	K	S	89	108
PSM	SKPIPIMPASPQK	2052	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.2949.2	23.4868	3	1488.743771	1488.741153	K	G	607	620
PSM	LDPFADGGKTPDPK	2053	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3236.2	30.90423	3	1536.6829	1536.6856	R	M	133	147
PSM	ESQRSGNVAELALK	2054	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3222.2	30.53678	3	1580.754371	1580.755951	K	A	658	672
PSM	AASPFRSSVQGASSR	2055	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2981.3	24.32235	3	1586.718971	1586.720234	R	E	262	277
PSM	ILVPKSPVK	2056	sp|Q9Y232|CDYL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3009.2	25.03975	2	1059.606647	1059.609334	K	S	196	205
PSM	HVTLPSSPR	2057	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2911.2	22.52445	2	1072.505647	1072.506660	R	S	2713	2722
PSM	DANNGNLQLR	2058	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2961.3	23.79978	2	1113.549847	1113.552684	K	N	288	298
PSM	GRNAPAAVDEGSISPR	2059	sp|P28715|ERCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2950.3	23.51595	3	1675.761371	1675.767913	R	T	371	387
PSM	VDALLSAQPK	2060	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3204.2	30.06605	2	1120.549247	1120.552941	K	G	950	960
PSM	EKTPSPKEEDEEPESPPEK	2061	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2793.3	19.6029	4	2260.965294	2260.962435	K	K	200	219
PSM	DYGNSPLHR	2062	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2839.3	20.71855	2	1137.462447	1137.460438	K	F	429	438
PSM	NLQTVNVDEN	2063	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3088.3	27.07935	2	1144.535247	1144.536031	K	-	116	126
PSM	SVEAAAELSAK	2064	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3004.3	24.91408	2	1154.520247	1154.522035	K	D	5	16
PSM	QLSSGVSEIR	2065	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3167.2	29.10103	2	1154.530647	1154.533268	R	H	80	90
PSM	DNLTSATLPR	2066	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3336.3	33.49958	2	1166.529447	1166.533268	K	N	302	312
PSM	YLSEVASGDNK	2067	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2899.5	22.24028	2	1181.555247	1181.556432	R	Q	130	141
PSM	SILVSPTGPSR	2068	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3238.3	30.96015	2	1192.581447	1192.585304	K	V	702	713
PSM	KKPRPPPALGPEETSASAGLPK	2069	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3146.3	28.56425	4	2387.1608941913205	2387.1651280448195	K	K	14	36
PSM	DPNSPLYSVK	2070	sp|Q9NUU7|DD19A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3247.3	31.19497	2	1198.523447	1198.527120	R	S	82	92
PSM	THSTSSSLGSGESPFSR	2071	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3064.3	26.45795	3	1802.743271	1802.747237	R	S	329	346
PSM	DITSDTSGDFR	2072	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3171.4	29.21283	2	1212.523447	1212.525861	K	N	167	178
PSM	LEGQGDVPTPK	2073	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2967.4	23.95918	2	1219.546847	1219.548584	K	Q	257	268
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	2074	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3285.4	32.17597	4	2449.047694	2449.048187	R	A	90	114
PSM	GPTTGEGALDLSDVHSPPKSPEGK	2075	sp|O95684|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3250.2	31.26993	4	2455.126894	2455.126815	K	T	141	165
PSM	GEAAAERPGEAAVASSPSK	2076	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2793.5	19.60957	3	1863.835871	1863.836387	K	A	12	31
PSM	SFEAPATINSASLHPEK	2077	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3405.3	35.28715	3	1877.853971	1877.856059	K	E	219	236
PSM	SRLTPVSPESSSTEEK	2078	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2917.4	22.67062	3	1892.783471	1892.780585	R	S	266	282
PSM	TTLPQDCSNPAPLSSPLNGVHDR	2079	sp|P16278|BGAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3428.3	35.89002	4	2555.145694	2555.147567	R	A	420	443
PSM	DGVVEITGKHEERQDEHGYISR	2080	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3042.4	25.90527	4	2553.215694	2553.220792	K	C	115	137
PSM	YIHSANVLHR	2081	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2963.2	23.84818	3	1288.601771	1288.607771	K	D	139	149
PSM	SSPNPFVGSPPK	2082	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3343.3	33.68218	2	1292.577847	1292.580219	K	G	393	405
PSM	ISVYYNEATGGK	2083	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3165.4	29.05557	2	1300.620247	1300.629932	R	Y	47	59
PSM	ASPGTPLSPGSLR	2084	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3353.3	33.94352	2	1318.622847	1318.628231	R	S	33	46
PSM	VIGSGCNLDSAR	2085	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3075.3	26.74163	2	1327.558447	1327.559166	R	F	158	170
PSM	EQVANSAFVER	2086	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3133.6	28.23793	2	1328.571247	1328.576196	K	V	365	376
PSM	TLNMTTSPEEK	2087	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3009.5	25.04975	2	1329.550647	1329.552349	K	R	326	337
PSM	TVSGPGTPEPRPATPGASSVEQLRK	2088	sp|Q9H3U1|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3180.5	29.45057	4	2678.2456	2678.2461	M	E	2	27
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	2089	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3175.5	29.31993	4	2712.261694	2712.264371	K	T	139	165
PSM	HSPNLSFEPNFCQDNPRSPTSSK	2090	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3425.3	35.81092	4	2725.158894	2725.159194	K	E	107	130
PSM	GPPASSPAPAPKFSPVTPK	2091	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3393.5	34.98023	3	2071.881971	2071.882228	R	F	254	273
PSM	NQIHVKSPPREGSQGELTPANSQSR	2092	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2943.5	23.34105	4	2796.332894	2796.330434	R	M	462	487
PSM	TQYNQVPSEDFERTPQSPTLPPAK	2093	sp|P78310|CXAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3427.4	35.86698	4	2809.294494	2809.296005	K	V	316	340
PSM	DSVFLSCSEDNR	2094	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3272.4	31.8473	2	1427.595847	1427.598708	K	I	180	192
PSM	QISSSSTGCLSSPNATVQSPKHEWK	2095	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,9-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3208.5	30.18023	4	2875.223694	2875.224905	K	I	266	291
PSM	TPRTPRTPQLK	2096	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2799.2	19.76365	3	1453.685471	1453.684381	R	D	782	793
PSM	AMSTTSISSPQPGK	2097	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2939.6	23.24062	2	1470.641847	1470.642561	R	L	267	281
PSM	AEKQEDSESSEEESDSEEAAASPAQVK	2098	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2888.4	21.95295	4	2946.180094	2946.177526	K	T	756	783
PSM	GTDTQTPAVLSPSK	2099	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3062.5	26.41468	2	1480.679047	1480.681055	K	T	722	736
PSM	SPPKSPEEEGAVSS	2100	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2778.2	19.33007	2	1479.612247	1479.613035	K	-	208	222
PSM	SPPKSPEEEGAVSS	2101	sp|Q01130|SRSF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2767.3	19.10447	2	1479.612247	1479.613035	K	-	208	222
PSM	NVPESSPHSPCEGLPSEAALTPRPEGK	2102	sp|A7E2V4|ZSWM8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,11-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3328.6	33.30083	4	3002.285294	3002.288234	K	V	1084	1111
PSM	NHCGIASAASYPTV	2103	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3426.4	35.84067	2	1526.617447	1526.622494	R	-	320	334
PSM	GDATVSYEDPPTAK	2104	sp|Q01844|EWS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3026.4	25.48785	2	1529.627847	1529.628685	K	A	411	425
PSM	PFSAPKPQTSPSPK	2105	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2959.3	23.74792	3	1547.736371	1547.738510	K	R	299	313
PSM	FLMECRNSPVTK	2106	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3150.5	28.672	2	1560.678847	1560.682986	K	T	58	70
PSM	NDAPTPGTSTTPGLR	2107	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3014.5	25.18015	2	1563.689647	1563.693017	R	S	324	339
PSM	VLGTSPEAIDSAENR	2108	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	32.89525	3	1637.729771	1637.729796	R	F	1034	1049
PSM	QLRFEDVVNQSSPK	2109	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3419.3	35.65427	3	1725.804671	1725.808715	K	N	190	204
PSM	NSFREQLEEEEEAK	2110	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3260.3	31.5342	3	1736.779571	1736.785323	K	H	1339	1353
PSM	FSEGVLQSPSQDQEK	2111	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3245.3	31.14265	3	1757.748671	1757.750926	R	L	428	443
PSM	SLSSQIETMRSPDGSK	2112	sp|P05997|CO5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3279.2	32.01483	3	1801.789571	1801.791745	K	K	1274	1290
PSM	RTEGVGPGVPGEVEMVK	2113	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3211.3	30.25217	3	1835.846471	1835.848866	R	G	16	33
PSM	RTEGVGPGVPGEVEMVK	2114	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3203.3	30.04322	3	1835.847371	1835.848866	R	G	16	33
PSM	VPSEGPKETPSSANGPSR	2115	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2757.5	18.9141	3	1875.837971	1875.836387	R	E	54	72
PSM	ERSPALKSPLQSVVVR	2116	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3401.4	35.18568	3	1924.953371	1924.953679	R	R	246	262
PSM	SGPKPFSAPKPQTSPSPK	2117	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2985.2	24.4192	4	1996.907294	1996.906060	R	R	295	313
PSM	TPSPKEEDEEPESPPEK	2118	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2824.5	20.3783	4	2003.827294	2003.824878	K	K	202	219
PSM	FIHQQPQSSSPVYGSSAK	2119	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3023.5	25.4132	3	2026.915271	2026.914971	R	T	76	94
PSM	GPSPSSPTPPAAAAPAEQAPR	2120	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3062.4	26.41135	3	2035.933871	2035.936435	R	A	103	124
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENK	2121	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3232.5	30.80972	4	4076.766894	4076.772015	K	I	530	567
PSM	VKLESPTVSTLTPSSPGK	2122	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3371.5	34.41093	3	2066.898371	2066.897937	R	L	290	308
PSM	DSESSNDDTSFPSTPEGIK	2123	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3367.6	34.30953	3	2091.813971	2091.815770	K	D	437	456
PSM	EGAASPAPETPQPTSPETSPK	2124	sp|Q9Y3X0|CCDC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2921.2	22.76562	3	2237.911571	2237.913056	K	E	372	393
PSM	KLEKEEEEGISQESSEEEQ	2125	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2918.5	22.69825	3	2235.984971	2235.986661	K	-	89	108
PSM	VSEEQTQPPSPAGAGMSTAMGR	2126	sp|Q16666|IF16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3313.5	32.90525	3	2267.948471	2267.955198	K	S	144	166
PSM	EHYPVSSPSSPSPPAQPGGVSR	2127	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3126.5	28.05185	3	2378.990771	2378.993372	K	N	2036	2058
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	2128	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3273.4	31.87187	3	2541.170171	2541.174827	K	I	50	74
PSM	SVTSNQSDGTQESCESPDVLDRHQTMEVSC	2129	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,14-UNIMOD:4,30-UNIMOD:4	ms_run[1]:scan=1.1.3352.6	33.9275	3	3462.362171	3462.364709	R	-	346	376
PSM	ETQTPVMAQPKEDEEEDDDVVAPKPPIEPEEEK	2130	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3429.5	35.9231	4	3827.681294	3827.686009	K	T	159	192
PSM	DSLIDSLT	2131	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3946.2	48.90378	2	862.428047	862.428378	R	-	238	246
PSM	EIIDLVLDR	2132	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4002.2	50.19148	2	1084.611247	1084.612825	K	I	113	122
PSM	AVDSLVPIGR	2133	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3626.2	40.93517	2	1105.549247	1105.553276	K	G	195	205
PSM	LNDPFQPFPGNDSPK	2134	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3882.2	47.32067	3	1751.757371	1751.755617	K	E	802	817
PSM	VPPAPVPCPPPSPGPSAVPSSPK	2135	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3503.2	37.75975	4	2378.078494	2378.078288	K	S	366	389
PSM	VPPAPVPCPPPSPGPSAVPSSPK	2136	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3472.3	36.96725	4	2378.077694	2378.078288	K	S	366	389
PSM	DIDISSPEFK	2137	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3584.2	39.85612	2	1229.520647	1229.521701	K	I	172	182
PSM	ADSEPESPLNASYVYK	2138	sp|Q5T1V6|DDX59_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3492.2	37.47648	3	1848.782471	1848.781891	K	E	154	170
PSM	LLLDPSSPPTK	2139	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3463.3	36.73332	2	1246.618047	1246.621021	K	A	21	32
PSM	GPLQSVQVFGR	2140	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3713.2	43.03583	2	1266.613647	1266.612187	K	K	5	16
PSM	CPSLDNLAVPESPGVGGGK	2141	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3618.2	40.7324	3	1932.868871	1932.865244	R	A	2249	2268
PSM	IACRSPQPDPVGTPTIFKPQSK	2142	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3446.4	36.30558	4	2583.195294	2583.195777	K	R	2219	2241
PSM	GFDPTASPFCQ	2143	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3752.2	44.04867	2	1305.472047	1305.473705	K	-	1293	1304
PSM	QQGFNYCTSAISSPLTK	2144	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3634.3	41.06165	3	1980.862571	1980.865244	K	S	1671	1688
PSM	ADLINNLGTIAK	2145	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3684.3	42.28316	2	1321.660047	1321.664283	K	F	96	108
PSM	GLSLVDKENTPPALSGTR	2146	sp|P31350|RIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3513.3	38.02607	3	2013.911771	2013.917353	K	V	24	42
PSM	GRDSPYQSRGSPHYFSPFRPY	2147	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	4-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3799.3	45.25583	4	2740.0736941913206	2740.0662330193095	R	-	201	222
PSM	ELQSAVPRDVEDVPITVE	2148	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3998.2	50.12472	3	2074.984571	2074.982382	R	-	420	438
PSM	FNEEHIPDSPFVVPVASPSGDARR	2149	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3770.3	44.50377	4	2782.213694	2782.215326	K	L	2311	2335
PSM	QFTPCQLLADHANSPNK	2150	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3699.3	42.67385	3	2099.854871	2099.853707	K	K	743	760
PSM	ESVPEFPLSPPK	2151	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3824.4	45.89858	2	1405.650647	1405.653049	K	K	30	42
PSM	EQFLDGDGWTSR	2152	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3595.3	40.13195	2	1409.618847	1409.621158	K	W	25	37
PSM	VNQSALEAVTPSPSFQQR	2153	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3480.2	37.17365	3	2117.916971	2117.918416	R	H	390	408
PSM	PVTTPEEIAQVATISANGDK	2154	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3755.3	44.13052	3	2120.001071	2120.003846	K	E	161	181
PSM	TVIIEQSWGSPK	2155	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3546.5	38.89398	2	1423.672647	1423.674847	R	V	61	73
PSM	EFSPFGSITSAK	2156	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4136.2	52.97102	2	1429.555847	1429.556780	K	V	313	325
PSM	LNSPTDSTPALLSATVTPQK	2157	sp|Q9H4X1|RGCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3788.4	44.96978	3	2199.997271	2200.006562	K	A	95	115
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	2158	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3596.3	40.15797	4	2964.315694	2964.313840	K	-	178	207
PSM	SLPTPAVLLSPTK	2159	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3938.3	48.73445	2	1482.711447	1482.713615	K	E	632	645
PSM	NQAIDACDANTTPGGVTDVIK	2160	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3523.5	38.29018	3	2238.981371	2238.982793	K	N	2144	2165
PSM	GFSVVADTPELQR	2161	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3548.3	38.9398	2	1497.683247	1497.686475	K	I	97	110
PSM	SDPVVSYRETVSEESNVLCLSKSPNK	2162	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3730.6	43.49298	4	3003.389294	3003.389648	K	H	573	599
PSM	SCEGQNPELLPKTPISPLK	2163	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3647.4	41.36675	3	2267.028671	2267.031003	K	T	308	327
PSM	GYISPYFINTSK	2164	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4015.2	50.49787	3	1548.630371	1548.630279	R	G	222	234
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	2165	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	37.55227	4	3114.467294	3114.465924	K	R	65	93
PSM	RPPSPDVIVLSDNEQPSSPR	2166	sp|Q86YP4|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3540.3	38.73042	3	2349.041771	2349.040322	R	V	97	117
PSM	ISMQDVDLSLGSPK	2167	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3883.2	47.34668	3	1568.714171	1568.715726	K	L	500	514
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	2168	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3584.4	39.86278	4	3194.433694	3194.432255	K	R	65	93
PSM	DMSPLSETEMALGK	2169	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3869.5	46.99328	2	1603.647247	1603.651077	K	D	505	519
PSM	DVTPPPETEVVLIK	2170	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3824.5	45.90192	2	1615.807047	1615.811007	K	N	519	533
PSM	AAVPSGASTGIYEALELRDNDK	2171	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4050.4	51.24283	3	2436.058271	2436.061117	R	T	33	55
PSM	TDIQIALPSGCYGR	2172	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3752.4	44.05533	2	1629.717047	1629.722209	K	V	156	170
PSM	LTFDTTFSPNTGKK	2173	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3467.2	36.83298	3	1635.753671	1635.754554	K	S	108	122
PSM	IFVGGLSPDTPEEK	2174	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3709.4	42.93842	2	1647.681847	1647.683437	K	I	184	198
PSM	NTSLPPLWSPEAER	2175	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3894.2	47.6314	3	1675.759271	1675.760702	K	S	201	215
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2176	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:35,32-UNIMOD:21	ms_run[1]:scan=1.1.3971.2	49.48045	4	3441.452494	3441.453053	K	-	610	647
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2177	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	12-UNIMOD:35,24-UNIMOD:21	ms_run[1]:scan=1.1.3979.2	49.68723	4	3441.4519	3441.4525	K	-	610	647
PSM	NTPASASLEGLAQTAGR	2178	sp|Q96Q45|TM237_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3723.2	43.29698	3	1722.794771	1722.793793	K	R	43	60
PSM	EATNTTSEPSAPSQDLLDLSPSPR	2179	sp|O75674|TM1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3811.5	45.56482	3	2592.155771	2592.159237	K	M	302	326
PSM	NLEQILNGGESPKQK	2180	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3515.2	38.07472	3	1733.833571	1733.834930	K	G	219	234
PSM	SESETESEASEITIPPSTPAVPQAPVQGEDYGK	2181	sp|O95831|AIFM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3905.4	47.921	4	3509.566494	3509.561066	R	G	530	563
PSM	NQLTSNPENTVFDAK	2182	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3571.5	39.5349	2	1756.774447	1756.766910	K	R	82	97
PSM	DCEECIQLEPTFIK	2183	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.3852.3	46.5877	3	1780.801271	1780.801173	K	G	416	430
PSM	VSSGYVPPPVATPFSSK	2184	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3549.4	38.96945	3	1798.854671	1798.854268	R	S	168	185
PSM	VLLPEYGGTKVVLDDK	2185	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3661.2	41.69637	3	1824.926771	1824.927433	K	D	71	87
PSM	ASSTSPVEISEWLDQK	2186	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4140.2	53.06983	3	1855.822871	1855.824091	K	L	188	204
PSM	VSSGYVPPPVATPFSSK	2187	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3619.2	40.7587	3	1878.813371	1878.820599	R	S	168	185
PSM	SATSSSPGSPLHSLETSL	2188	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4540.2	58.0723	2	1916.778847	1916.780585	K	-	1203	1221
PSM	TAESQTPTPSATSFFSGK	2189	sp|P55265|DSRAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3668.3	41.87729	3	1922.826671	1922.829904	K	S	596	614
PSM	DFAARSPSASITDEDSNV	2190	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3476.3	37.07158	3	1960.806971	1960.805146	K	-	994	1012
PSM	SSSPAPADIAQTVQEDLR	2191	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4087.4	52.08012	2	1963.888447	1963.888816	K	T	230	248
PSM	QIQTEAAQLLTSFSEKN	2192	sp|Q96DB5|RMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4015.4	50.50453	3	1986.926771	1986.929953	K	-	298	315
PSM	LSGSNPYTTVTPQIINSK	2193	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3545.3	38.86117	3	1998.965171	1998.966338	K	W	605	623
PSM	CSPTVAFVEFPSSPQLK	2194	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,2-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4363.3	56.23001	3	2052.864071	2052.866898	R	N	669	686
PSM	DTQSPSTCSEGLLGWSQK	2195	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3850.3	46.53803	3	2059.855271	2059.855802	K	D	709	727
PSM	LDNVPHTPSSYIETLPK	2196	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3915.3	48.14785	3	2069.911571	2069.911205	R	A	45	62
PSM	LGLQEGSNNSSPVDFVNNK	2197	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3641.3	41.21112	3	2097.932771	2097.936829	K	R	56	75
PSM	DYEEVGADSADGEDEGEEY	2198	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3501.6	37.72098	2	2157.703447	2157.705945	K	-	431	450
PSM	GSGGLFSPSTAHVPDGALGQR	2199	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3811.3	45.55815	3	2169.922871	2169.924564	R	D	1023	1044
PSM	AAVPSGASTGIYEALELRDNDK	2200	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3727.4	43.40835	3	2276.130371	2276.128455	R	T	33	55
PSM	ESMCSTPAFPVSPETPYVK	2201	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:35,4-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3790.4	45.01525	3	2301.896771	2301.897606	K	T	839	858
PSM	EASRPPEEPSAPSPTLPAQFK	2202	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3470.4	36.91772	3	2315.081171	2315.083493	R	Q	351	372
PSM	DNLTLWTSENQGDEGDAGEGEN	2203	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3826.4	45.95088	3	2349.947171	2349.946922	R	-	225	247
PSM	SASSYSDIEEIATPDSSAPSSPK	2204	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3627.5	40.9698	3	2405.020571	2405.015927	K	L	1233	1256
PSM	NTFTAWSDEESDYEIDDRDVNK	2205	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3776.6	44.66217	3	2728.080071	2728.081381	K	I	621	643
PSM	ESIDGKLPSTDQQESCSSTPGLEEPLFK	2206	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3791.4	45.04075	4	3158.403694	3158.400272	R	A	1242	1270
PSM	TASTPTPPQTGGGLEPQANGETPQVAVIVRPDDR	2207	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3724.6	43.33653	4	3615.659694	3615.660752	R	S	202	236
PSM	DGDSYDPYDFSDTEEEMPQVHTPKTADSQETK	2208	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3808.5	45.48683	4	3821.447694	3821.448889	K	E	701	733
PSM	SAESPTSPVTSETGSTFK	2209	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3463.5	36.73998	3	1972.778771	1971.775165	K	K	280	298
PSM	LELQGPRGSPNAR	2210	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2992.2	24.60088	3	1473.710771	1473.708941	R	S	555	568
PSM	TEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQR	2211	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3676.6	42.08692	4	4846.122894	4845.146130	K	E	1088	1139
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	2212	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3990.4	49.92962	4	3523.460094	3522.472617	K	F	604	634
PSM	ASGVAVSDGVIK	2213	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3537.3	38.65132	2	1223.5788	1223.5794	M	V	2	14
PSM	ATNFLAHEK	2214	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3498.3	37.63273	2	1151.5013	1151.5007	M	I	2	11
PSM	LGMLSPEGTCK	2215	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3338.3	33.5514	2	1271.527247	1271.529111	R	A	203	214
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2216	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3644.5	41.29099	3	2765.2240	2765.2250	-	Y	1	25
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2217	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3883.6	47.36002	3	3013.340171	3013.339266	K	V	8	36
PSM	NSLDCEIVSAK	2218	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3228.4	30.70045	2	1314.549847	1314.552684	K	S	423	434
PSM	SSAPTTPPSVDKVDGFSRK	2219	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	34.07062	3	2096.9725	2096.9774	M	S	2	21
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	2220	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3735.4	43.61553	4	2882.1872	2882.1622	M	D	2	29
PSM	SETAPAAPAAPAPAEKTPVKK	2221	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.2952.6	23.57768	3	2153.0743	2153.0764	M	K	2	23
PSM	SETAPAAPAAPAPAEKTPVK	2222	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.3065.2	26.48008	3	2024.9780	2024.9815	M	K	2	22
PSM	SDAAVDTSSEITTK	2223	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3191.4	29.73282	2	1545.6421	1545.6442	M	D	2	16
PSM	SDAAVDTSSEITTK	2224	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3112.6	27.69032	2	1545.6395	1545.6442	M	D	2	16
PSM	AAGGDHGSPDSYRSPLASR	2225	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3143.6	28.49712	3	2101.8221	2101.8251	M	Y	2	21
PSM	ADEAALALQPGGSPSAAGADREAASSPAGEPLRK	2226	sp|Q96EB6|SIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,13-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3685.5	42.31595	4	3419.5359	3419.5390	M	R	2	36
PSM	AGGPATPLSPTR	2227	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2926.5	22.9011	2	1283.538247	1283.531234	R	L	29	41
PSM	TNGVTLYPYQISQLMTESSREGLTEAVLNR	2228	sp|Q2KJY2|KI26B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3085.3	27.00195	6	3530.618541	3529.620132	R	Y	324	354
PSM	SPAVATSTAAPPPPSSPLPSK	2229	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3146.5	28.57092	3	2038.993571	2038.997638	K	S	439	460
PSM	VADPDHDHTGFLTEYVATR	2230	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3579.5	39.74446	3	2385.883571	2382.896040	R	W	173	192
PSM	LYGPSSVSFADDFVRSSK	2231	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3992.2	49.95587	3	2120.886671	2120.885719	R	Q	134	152
PSM	DVKPHNVMIDHEHRK	2232	sp|P68400|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2756.5	18.89252	4	1853.933694	1853.931885	R	L	156	171
PSM	AGFAGDDAPR	2233	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2881.2	21.76608	2	975.438847	975.441009	K	A	21	31
PSM	HEQNIDCGGGYVK	2234	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2871.3	21.51733	3	1475.641571	1475.646327	K	L	99	112
PSM	DFSPEALK	2235	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3391.2	34.91807	2	985.414847	985.415779	K	K	181	189
PSM	NIIHGSDSVESAEK	2236	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2903.4	22.33965	3	1484.710871	1484.710701	R	E	115	129
PSM	DGLTDVYNK	2237	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3147.2	28.5863	2	1023.481847	1023.487290	K	I	182	191
PSM	RASPGTPLSPGSLR	2238	sp|Q96BD0|SO4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3226.2	30.64135	3	1554.702671	1554.695674	R	S	32	46
PSM	SAGLFQNPK	2239	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	30.48465	2	1040.466247	1040.469212	R	Q	233	242
PSM	IESPKLER	2240	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2876.2	21.63797	3	1050.510371	1050.511076	K	T	807	815
PSM	AAHSEGNTTAGLDMR	2241	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2928.3	22.9457	3	1609.656971	1609.655585	R	E	467	482
PSM	EFHLNESGDPSSKSTEIK	2242	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	30.30128	4	2163.874094	2163.876276	K	W	155	173
PSM	SCNCLLLK	2243	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3359.2	34.09233	2	1086.456647	1086.460304	K	V	336	344
PSM	DYDDMSPR	2244	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2664.2	17.747	2	1093.339247	1093.342356	R	R	279	287
PSM	ASAVSELSPR	2245	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3006.5	24.97242	2	1095.494047	1095.496155	R	E	236	246
PSM	NREPLMPSPQFIK	2246	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3340.2	33.60035	3	1651.790471	1651.779330	K	S	246	259
PSM	ATAGDTHLGGEDFDNR	2247	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3032.2	25.6377	3	1674.725471	1674.723391	K	L	221	237
PSM	DLEGSDIDTR	2248	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2989.4	24.53025	2	1119.503847	1119.504397	R	R	373	383
PSM	AGDLLEDSPK	2249	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3129.4	28.12712	2	1123.477047	1123.479836	R	R	158	168
PSM	GHASAPYFGKEEPSVAPSSTGK	2250	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3142.3	28.46082	4	2283.017694	2283.020893	K	T	131	153
PSM	YIDQEELNK	2251	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2976.3	24.18965	2	1150.546647	1150.550619	K	T	198	207
PSM	LKGEATVSFDDPPSAK	2252	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3218.3	30.43515	3	1740.795671	1740.797147	K	A	333	349
PSM	LITPAVVSER	2253	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3393.2	34.97023	2	1163.593447	1163.595140	K	L	67	77
PSM	TEAQDLCRASPEPPGPESSSR	2254	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3032.3	25.64103	4	2349.991294	2349.989669	R	W	663	684
PSM	QALLDSPLNK	2255	sp|Q8TCU4|ALMS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3342.2	33.65277	2	1177.568047	1177.574405	R	E	1630	1640
PSM	WNSVSPASAGK	2256	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2997.4	24.73617	2	1182.504047	1182.507054	K	R	304	315
PSM	SASVAPFTCK	2257	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3239.4	30.98957	2	1226.443047	1226.444393	K	T	1057	1067
PSM	AGSSTPGDAPPAVAEVQGR	2258	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3205.3	30.09565	3	1845.824171	1845.825822	R	S	2885	2904
PSM	AVEHINKTIAPALVSK	2259	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3217.4	30.41265	3	1849.910171	1849.910417	K	K	65	81
PSM	NKSPAAVTEPETNKFDSTGYDK	2260	sp|O75449|KTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3130.2	28.1465	4	2478.088894	2478.095180	K	D	168	190
PSM	TSSGDPPSPLVK	2261	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3015.4	25.20228	2	1263.575447	1263.574799	K	Q	80	92
PSM	QVVESAYEVIK	2262	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3357.5	34.05215	2	1263.667047	1263.671068	K	L	233	244
PSM	TSVQTEDDQLIAGQSAR	2263	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3235.3	30.8816	3	1897.838771	1897.841866	R	A	654	671
PSM	ELISNASDALDK	2264	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3272.2	31.84063	2	1274.633447	1274.635411	R	I	103	115
PSM	GKGGEIQPVSVK	2265	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2919.4	22.71945	2	1277.637047	1277.638068	K	V	55	67
PSM	VGNESPVQELK	2266	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3072.6	26.67353	2	1278.581447	1278.585698	K	Q	46	57
PSM	SSPNPFVGSPPK	2267	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3228.3	30.69712	2	1292.578647	1292.580219	K	G	393	405
PSM	AVPMAPAPASPGSSNDSSAR	2268	sp|Q66K74|MAP1S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3067.5	26.54123	3	1948.832171	1948.835006	K	S	750	770
PSM	APASVLPAATPR	2269	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3221.3	30.5139	2	1309.582047	1309.583269	R	Q	45	57
PSM	NSNPALNDNLEK	2270	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2978.4	24.24423	2	1327.635047	1327.636808	K	G	120	132
PSM	GVNTVFHCASPPPSSNNK	2271	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3112.4	27.68365	3	1991.856371	1991.856076	K	E	97	115
PSM	QRTNPSPTNPFSSDLQK	2272	sp|P49757|NUMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3327.2	33.2614	3	1995.901871	1995.905135	K	T	629	646
PSM	EITALAPSTMK	2273	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3175.4	29.3166	2	1336.536047	1336.538687	K	I	318	329
PSM	STPSHGSVSSLNSTGSLSPK	2274	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3038.5	25.8042	3	2008.909871	2008.910280	R	H	238	258
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	2275	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3216.4	30.38618	4	2692.286494	2692.288766	R	Q	24	52
PSM	DGFPSGTPALNAK	2276	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3325.2	33.20895	2	1353.594247	1353.596597	K	G	148	161
PSM	DKPHVNVGTIGHVDHGK	2277	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2898.2	22.20423	4	1808.929694	1808.928179	R	T	54	71
PSM	EIDCLSPEAQK	2278	sp|Q32MZ4|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3075.5	26.7483	2	1368.563447	1368.563248	R	L	11	22
PSM	NGTSGSDSPGQAVEAEEIVK	2279	sp|Q05D32|CTSL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3426.3	35.83733	3	2053.885571	2053.884125	K	Q	158	178
PSM	DVTADFEGQSPK	2280	sp|Q9UHL4|DPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3246.5	31.17552	2	1372.552247	1372.554792	R	C	204	216
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	2281	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2935.6	23.13662	4	2750.194094	2750.193331	R	T	13	39
PSM	AAQQAASSSGQGQQAQTPTGF	2282	sp|P48729-3|KC1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3132.5	28.20898	3	2099.887871	2099.890941	K	-	305	326
PSM	SMGTGDTPGLEVPSSPLRK	2283	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3411.4	35.44798	3	2103.897071	2103.894904	R	A	381	400
PSM	NQSPVDQGATGASQGLLDRK	2284	sp|P18827|SDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3208.4	30.1769	3	2120.981171	2120.985176	R	E	231	251
PSM	DTGKPKGEATVSFDDPPSAK	2285	sp|Q92804|RBP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3067.6	26.54457	3	2125.954571	2125.956896	K	A	278	298
PSM	NSVTPLASPEPTK	2286	sp|Q16875|F263_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3080.5	26.87798	2	1419.662247	1419.664677	R	K	460	473
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	2287	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3264.3	31.63907	4	2838.175294	2838.177635	K	M	23	49
PSM	RRSPSPYYSR	2288	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2763.2	19.01158	3	1427.573771	1427.574830	R	Y	258	268
PSM	AHSPMIAVGSDDSSPNAMAK	2289	sp|Q96EE3|SEH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3286.3	32.19838	3	2144.833571	2144.830923	R	V	177	197
PSM	SILAKPSSSPDPR	2290	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2939.3	23.23062	3	1433.691371	1433.691560	K	Y	1011	1024
PSM	SGAQASSTPLSPTR	2291	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2876.5	21.64797	2	1438.645047	1438.645338	R	I	12	26
PSM	AMKPPGGESSNLFGSPEEATPSSRPNR	2292	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3287.6	32.23437	4	2879.2896	2879.2904	R	M	16	43
PSM	ALDVSASDDEIAR	2293	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	32.8697	2	1440.611247	1440.613369	K	L	181	194
PSM	STIGVMVTASHNPEEDNGVK	2294	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3313.3	32.89858	3	2163.945971	2163.950764	K	L	55	75
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	2295	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.3243.6	31.10052	4	2914.280894	2914.285140	K	L	281	308
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	2296	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,15-UNIMOD:35,26-UNIMOD:35	ms_run[1]:scan=1.1.3055.6	26.24473	4	2930.275694	2930.280055	K	L	281	308
PSM	SCFESSPDPELK	2297	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3230.5	30.7573	2	1474.568847	1474.568728	R	S	871	883
PSM	TTPSYVAFTDTER	2298	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3394.3	34.9997	2	1486.690447	1486.693989	R	L	37	50
PSM	NDSLVTPSPQQAR	2299	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3008.5	25.02413	2	1491.668047	1491.671887	R	V	144	157
PSM	DVSGPMPDSYSPR	2300	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.3008.6	25.02747	2	1502.572247	1502.574876	K	Y	291	304
PSM	RPPSPDVIVLSDNEQPSSPR	2301	sp|Q86YP4|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3427.6	35.87365	3	2269.072571	2269.073991	R	V	97	117
PSM	STSQGSINSPVYSR	2302	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2976.6	24.19965	2	1561.674247	1561.677367	R	H	450	464
PSM	GDRSPEPGQTWTR	2303	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2965.5	23.91065	3	1565.671871	1565.662385	K	E	90	103
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	2304	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3271.5	31.82565	4	3156.392894	3156.395856	K	G	306	335
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	2305	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3222.4	30.54345	4	3197.252094	3197.249993	R	A	333	362
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	2306	sp|Q9Y478|AAKB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,5-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3359.6	34.10567	4	3213.339694	3213.342046	K	F	173	200
PSM	AGMTSSPDATTGQTFG	2307	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3368.6	34.33555	2	1607.615847	1607.617468	R	-	779	795
PSM	ETPHSPGVEDAPIAK	2308	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	24.47175	3	1626.728471	1626.729068	R	V	486	501
PSM	VIGSGCNLDSARFR	2309	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	31.29585	3	1630.730471	1630.728691	R	Y	158	172
PSM	GGKPEPPAMPQPVPTA	2310	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3321.5	33.11433	2	1652.760247	1652.763345	K	-	228	244
PSM	AGGPTTPLSPTRLSR	2311	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3261.2	31.55717	3	1669.755071	1669.759002	R	L	15	30
PSM	TAAKGEAAAERPGEAAVASSPSK	2312	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2767.2	19.0978	4	2235.053294	2235.053256	K	A	8	31
PSM	VLSPTAAKPSPFEGK	2313	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3295.2	32.42895	3	1687.757171	1687.762356	K	T	311	326
PSM	IDEMPEAAVKSTANK	2314	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2921.3	22.77562	2	1698.752047	1698.753568	R	Y	30	45
PSM	TLNAETPKSSPLPAK	2315	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2978.2	24.23757	3	1712.775371	1712.778735	R	G	208	223
PSM	GDQCCYSHSPPTPR	2316	sp|Q9NXH9|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2823.5	20.35607	3	1740.638171	1740.638556	R	V	617	631
PSM	SVTSNQSDGTQESCESPDVLDRHQTMEVSC	2317	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:4,16-UNIMOD:21,26-UNIMOD:35,30-UNIMOD:4	ms_run[1]:scan=1.1.3192.6	29.76638	4	3478.357294	3478.359624	R	-	346	376
PSM	LREVVETPLLHPER	2318	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3315.2	32.94753	3	1766.9086	1766.9075	K	F	187	201
PSM	RGPAEESSSWRDSSR	2319	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2830.3	20.51572	3	1785.754871	1785.743155	R	R	1250	1265
PSM	RRDEDMLYSPELAQR	2320	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3330.3	33.34312	3	1957.873271	1957.871726	R	G	229	244
PSM	ATAQDNPKSATEQSGTGIR	2321	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2810.2	20.02475	3	2010.900971	2010.900778	K	S	511	530
PSM	LSSWDQAETPGHTPSLR	2322	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3427.2	35.86032	3	2040.835571	2040.834352	K	W	215	232
PSM	KPVTVSPTTPTSPTEGEAS	2323	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3049.5	26.09117	3	2044.862771	2044.864315	R	-	505	524
PSM	SQSLPNSLDYTQTSDPGR	2324	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3432.6	36.00522	2	2044.865447	2044.873894	R	H	44	62
PSM	NQGGYGGSSSSSSYGSGRRF	2325	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3029.6	25.573	3	2076.827171	2076.828675	R	-	353	373
PSM	EYIPGQPPLSQSSDSSPTR	2326	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3396.4	35.05487	3	2124.936371	2124.936495	K	N	871	890
PSM	AQTPPGPSLSGSKSPCPQEK	2327	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2942.5	23.31515	3	2131.959071	2131.960935	K	S	1001	1021
PSM	HTGCCGDNDPIDVCEIGSK	2328	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3243.4	31.09385	3	2132.857271	2132.856139	K	V	110	129
PSM	MPPRTPAEASSTGQTGPQSAL	2329	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3144.6	28.52307	3	2258.921771	2258.927995	K	-	238	259
PSM	GSLAEAVGSPPPAATPTPTPPTR	2330	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3430.4	35.94598	3	2331.0509	2331.0544	R	K	446	469
PSM	SWDSSSPVDRPEPEAASPTTR	2331	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3210.5	30.23292	3	2351.002271	2351.006699	R	T	354	375
PSM	ITRKPVTVSPTTPTSPTEGEAS	2332	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3034.5	25.69967	3	2415.094871	2415.097168	R	-	502	524
PSM	ITRKPVTVSPTTPTSPTEGEAS	2333	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3050.4	26.1136	3	2415.094871	2415.097168	R	-	502	524
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	2334	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3377.6	34.57048	3	2539.246571	2539.247205	R	D	175	200
PSM	ELEKPIQSKPQSPVIQAAAVSPK	2335	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3243.3	31.09052	4	2604.296894	2604.296537	R	F	207	230
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	2336	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3212.6	30.28852	3	2692.283471	2692.288766	R	Q	24	52
PSM	SGSMEEDVDTSPGGDYYTSPSSPTSSSR	2337	sp|P08651|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3396.6	35.06153	3	2962.129871	2962.133552	K	N	284	312
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	2338	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3223.6	30.57622	3	3197.252171	3197.249993	R	A	333	362
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	2339	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3161.6	28.95767	4	3290.595694	3290.597273	K	E	178	210
PSM	IGPLGLSPK	2340	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3531.2	38.49117	2	960.503047	960.504534	K	K	32	41
PSM	EGMTAFVEK	2341	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3454.2	36.49512	2	1090.438047	1090.440614	K	R	274	283
PSM	ALLLLCGEDD	2342	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3978.2	49.64832	2	1117.530447	1117.532526	K	-	311	321
PSM	ELIFQETAR	2343	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3538.3	38.67803	2	1185.544047	1185.543105	K	F	362	371
PSM	HVPDSGATATAYLCGVK	2344	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3451.2	36.41995	3	1825.808171	1825.807001	K	G	110	127
PSM	GVLLFGPPGTGK	2345	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3906.3	47.93572	2	1221.615047	1221.615876	K	T	211	223
PSM	NQYDNDVTVWSPQGR	2346	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	38.36315	3	1857.767471	1857.768307	R	I	4	19
PSM	ALSSGGSITSPPLSPALPK	2347	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3813.2	45.60667	3	1938.909371	1938.910477	R	Y	17	36
PSM	YFEADPPGQVAASPDPTT	2348	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3530.3	38.46848	3	1941.805871	1941.803355	R	-	157	175
PSM	YADLTEDQLPSCESLK	2349	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3634.2	41.05499	3	1947.814271	1947.817291	R	D	142	158
PSM	GRPSSPRTPLYLQPDAYGSLDR	2350	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3681.3	42.20462	4	2605.173294	2605.172733	K	A	116	138
PSM	EITALAPSTMK	2351	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3529.2	38.43875	2	1320.541047	1320.543772	K	I	318	329
PSM	ADIDVSGPKVDIDTPDIDIHGPEGK	2352	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3701.3	42.7262	4	2682.245694	2682.242573	K	L	4087	4112
PSM	QVVESAYEVIK	2353	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3536.3	38.62518	2	1343.639047	1343.637399	K	L	233	244
PSM	EFSPFGSITSAK	2354	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3877.4	47.19755	2	1349.587647	1349.590449	K	V	313	325
PSM	SFSTALYGESDL	2355	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4375.2	56.46585	2	1368.550847	1368.548644	K	-	900	912
PSM	IFRDGEEAGAYDGPRTADGIVSHLK	2356	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3500.3	37.6848	4	2753.266894	2753.281024	K	K	105	130
PSM	DLPTIPGVTSPSSDEPPMEASQSHLR	2357	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3914.2	48.11878	4	2827.275694	2827.273555	R	N	74	100
PSM	TLTIVDTGIGMTK	2358	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3671.4	41.95612	2	1428.689247	1428.693534	R	A	28	41
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2359	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3850.4	46.54137	4	2881.096094	2881.094982	K	T	701	725
PSM	ATLPSPDKLPGFK	2360	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3615.2	40.65362	3	1449.726371	1449.726883	K	M	831	844
PSM	SVWGSLAVQNSPK	2361	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3661.3	41.6997	2	1451.677047	1451.680995	K	G	343	356
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	2362	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3740.2	43.73645	4	2908.394894	2908.396782	R	S	67	92
PSM	DLGTQNHTSELILSSPPGQK	2363	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3489.4	37.40838	3	2201.035871	2201.036543	K	V	385	405
PSM	LTFDSSFSPNTGK	2364	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3591.4	40.0324	2	1479.625247	1479.628291	K	K	97	110
PSM	LTFDSSFSPNTGK	2365	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3600.3	40.26305	2	1479.625247	1479.628291	K	K	97	110
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	2366	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3588.3	39.95907	4	2964.315694	2964.313840	K	-	178	207
PSM	GALQNIIPASTGAAK	2367	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3533.5	38.55359	2	1490.749647	1490.749409	R	A	201	216
PSM	QASPNIVIALSGNK	2368	sp|P20339|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3738.4	43.69245	2	1490.747247	1490.749409	R	A	121	135
PSM	LTFDTTFSPNTGK	2369	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3692.6	42.50148	2	1507.659847	1507.659591	K	K	108	121
PSM	GPVSPSVSFQPLAR	2370	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3716.3	43.11755	2	1520.736447	1520.738845	R	S	219	233
PSM	VEGIYTYSLSPSK	2371	sp|O95197|RTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3608.4	40.47557	2	1522.694447	1522.695642	K	V	220	233
PSM	DGDSYRSPWSNKYDPPLEDGAMPSAR	2372	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3741.5	43.77197	4	3070.216094	3070.220548	R	L	67	93
PSM	DEILPTTPISEQK	2373	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3467.4	36.83965	2	1549.725047	1549.727671	K	G	215	228
PSM	EAAFGGGLLSPGPEAT	2374	sp|Q01201|RELB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4093.3	52.20432	2	1552.680847	1552.681055	R	-	564	580
PSM	GALQNIIPASTGAAK	2375	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3684.6	42.29317	2	1570.711047	1570.715740	R	A	201	216
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	2376	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3683.5	42.26405	5	3932.710618	3932.709658	K	T	6	40
PSM	GALQNIIPASTGAAK	2377	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3701.5	42.73287	2	1570.711047	1570.715740	R	A	201	216
PSM	DMESPTKLDVTLAK	2378	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3508.2	37.89145	3	1626.757871	1626.757591	K	D	277	291
PSM	QEEEQDLDGEKGPSSEGPEEEDGEGFSFK	2379	sp|P84157|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3560.4	39.25602	4	3264.275694	3264.277968	R	Y	114	143
PSM	ADLLLSTQPGREEGSPLELER	2380	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3913.4	48.1064	3	2469.121271	2469.118966	K	L	593	614
PSM	NQVAMNPTNTVFDAK	2381	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3467.5	36.84298	2	1728.751047	1728.754237	K	R	57	72
PSM	AFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFR	2382	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3791.5	45.04408	4	3497.571294	3497.569417	R	E	1323	1356
PSM	LSEKLDSTDFTGTIK	2383	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3573.3	39.58098	3	1813.774871	1813.778794	K	L	131	146
PSM	EALLSSAVDHGSDEVK	2384	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3604.3	40.36757	3	1815.730271	1815.732907	R	F	139	155
PSM	ILDSVGIEADDDRLNK	2385	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3491.2	37.4517	3	1851.856271	1851.861539	K	V	26	42
PSM	VGINYQPPTVVPGGDLAK	2386	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3757.3	44.18208	3	1903.940771	1903.944480	K	V	353	371
PSM	DGPNALTPPPTTPEWIK	2387	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3876.4	47.17113	3	1912.891871	1912.897196	R	F	75	92
PSM	TDGFAEAIHSPQVAGVPR	2388	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3514.3	38.05177	3	1930.891871	1930.893842	R	F	2146	2164
PSM	LSPPYSSPQEFAQDVGR	2389	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3785.2	44.8791	3	1956.866171	1956.861873	K	M	751	768
PSM	TLNEADCATVPPAIRSY	2390	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4,9-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3687.2	42.358	3	2036.829971	2036.831575	K	-	648	665
PSM	DNLTLWTSDQQDEEAGEGN	2391	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3875.3	47.1413	3	2120.872871	2120.877051	R	-	228	247
PSM	TDKSSASAPDVDDPEAFPALA	2392	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3910.2	48.01532	3	2182.930871	2182.930741	R	-	388	409
PSM	QQPPEPEWIGDGESTSPSDK	2393	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3542.5	38.78905	3	2262.930371	2262.931803	K	V	7	27
PSM	DNLTLWTSENQGDEGDAGEGEN	2394	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3852.5	46.59437	3	2349.947171	2349.946922	R	-	225	247
PSM	GQIPPLVTTDCMIQDQGNASPR	2395	sp|O94855|SC24D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3822.3	45.84423	3	2477.107271	2477.108010	R	F	289	311
PSM	GISCMNTTLSESPFKCDPDAAR	2396	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3595.4	40.13528	3	2536.039571	2536.043362	K	A	239	261
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	2397	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3822.2	45.8409	4	2644.237694	2644.238156	R	L	55	81
PSM	DLPTIPGVTSPSSDEPPMEASQSHLR	2398	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3914.4	48.12545	3	2827.270271	2827.273555	R	N	74	100
PSM	IADPEHDHTGFLTEYVATRWYR	2399	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3898.3	47.73782	4	2836.206094	2836.204762	R	A	190	212
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2400	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3616.6	40.69248	3	2897.087471	2897.089897	K	T	701	725
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	2401	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:4,22-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3703.2	42.77463	5	3544.543618	3544.541154	K	E	218	249
PSM	LPSAQTPNGTDYVASGK	2402	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3161.2	28.94433	3	1784.798771	1784.798210	R	S	1960	1977
PSM	NGSLDSPGKQDTEEDEEEDEK	2403	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2916.6	22.65138	3	2430.912371	2429.923149	K	D	134	155
PSM	AIVDALPPPCESACTVPTDVDK	2404	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3672.6	41.9878	3	2436.084071	2434.079730	R	W	261	283
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	2405	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3310.3	32.8218	4	2660.148494	2660.147901	R	-	621	645
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	2406	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4088.3	52.10093	3	2676.272771	2674.268000	R	Y	147	174
PSM	ELASPVSPELR	2407	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3329.3	33.317	2	1276.603047	1276.606433	K	Q	175	186
PSM	ASGVTVNDEVIK	2408	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3566.2	39.39907	2	1352.6206	1352.6220	M	V	2	14
PSM	QPLEQNQTISPLSTYEESK	2409	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,10-UNIMOD:21	ms_run[1]:scan=1.1.3977.4	49.62915	3	2253.9994	2254.0037	K	V	403	422
PSM	AENVVEPGPPSAK	2410	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3264.2	31.63573	2	1415.6298	1415.6329	M	R	2	15
PSM	ESDFSDTLSPSK	2411	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3201.3	29.9906	2	1391.548247	1391.549372	K	E	444	456
PSM	LALGDDSPALK	2412	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3359.3	34.09566	2	1178.554047	1178.558421	R	E	87	98
PSM	AAAMDVDTPSGTNSGAGKK	2413	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3087.4	27.05727	3	1898.8033	1898.8076	M	R	2	21
PSM	YSLADQTSGDQSPLPPCTPTPPCAEMREDSAR	2414	sp|Q06124|PTN11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,17-UNIMOD:4,18-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.3573.6	39.59098	4	3693.482494	3693.482395	K	V	547	579
PSM	ACARPLISVYSEKGESSGK	2415	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3593.5	40.08657	3	2239.9549	2239.9580	M	N	2	21
PSM	DVMLENYSNLTSLGYQVGKPSLISHLEQEEEPR	2416	sp|Q96PQ6|ZN317_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:35,15-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3092.3	27.18708	5	3950.772118	3950.768648	K	T	84	117
PSM	AVEHINKTIAPALVSK	2417	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3218.4	30.43848	3	1849.910171	1849.910417	K	K	65	81
PSM	FVLSSGK	2418	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3106.2	27.52137	2	816.377247	816.378271	K	F	49	56
PSM	LILDSAR	2419	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3190.2	29.70003	2	866.425247	866.426284	K	A	544	551
PSM	ELTSTCSPIISKPKPK	2420	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2989.2	24.52358	4	1864.937694	1864.936952	K	V	774	790
PSM	DISLSDYK	2421	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3287.2	32.22104	2	939.454447	939.454927	K	G	28	36
PSM	SGPKPFSAPKPQTSPSPK	2422	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2926.3	22.89443	4	1916.939294	1916.939729	R	R	295	313
PSM	VLTPTQVK	2423	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3046.2	26.00293	2	964.498047	964.499449	K	N	40	48
PSM	EAQERLTGDAFR	2424	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3113.2	27.7033	3	1471.647671	1471.645672	K	K	153	165
PSM	QKTEDEVLTSKGDAWAK	2425	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3139.3	28.38303	4	1984.913694	1984.914303	K	Y	136	153
PSM	EIAEAYLGK	2426	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3207.2	30.14438	2	992.514647	992.517862	K	T	129	138
PSM	DAIHFYNK	2427	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3104.2	27.46905	2	1006.486247	1006.487230	K	S	318	326
PSM	DWDDDQND	2428	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2996.2	24.70325	2	1021.325647	1021.326098	K	-	541	549
PSM	SGKPAELLK	2429	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2945.3	23.38647	2	1021.518647	1021.520913	R	M	595	604
PSM	DLEEDHACIPIKK	2430	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3072.2	26.6602	3	1566.768971	1566.771193	K	S	560	573
PSM	AQTPPGPSLSGSKSPCPQEK	2431	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2946.3	23.41243	4	2131.960094	2131.960935	K	S	1001	1021
PSM	MLVSGAGDIK	2432	sp|Q92526|TCPW_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	33.39217	2	1069.489047	1069.487898	K	L	46	56
PSM	GVVFDVTSGK	2433	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	35.67698	2	1087.495047	1087.495092	K	E	70	80
PSM	INNFSADIK	2434	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	32.61113	2	1100.488647	1100.490341	K	D	289	298
PSM	IIAEGANGPTTPEADK	2435	sp|P00367|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2956.4	23.67422	3	1662.748271	1662.750197	K	I	400	416
PSM	IYQYIQSR	2436	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3011.3	25.09502	2	1149.521847	1149.521975	R	F	318	326
PSM	QLSSGVSEIR	2437	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3194.3	29.8083	2	1154.530447	1154.533268	R	H	80	90
PSM	LKGEATVSFDDPPSAK	2438	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3208.3	30.17357	3	1740.795671	1740.797147	K	A	333	349
PSM	TISPMVMDAK	2439	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3357.4	34.04882	2	1171.499047	1171.501834	K	A	793	803
PSM	GNDPLTSSPGR	2440	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2931.2	23.02008	2	1179.490447	1179.492132	R	S	20	31
PSM	AVTPVPTKTEEVSNLK	2441	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3126.2	28.04185	3	1791.895871	1791.901947	R	T	524	540
PSM	LQKLESPVAH	2442	sp|Q86TM6|SYVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2915.2	22.61218	3	1200.589571	1200.590389	R	-	608	618
PSM	ADTSQEICSPRLPISASHSSK	2443	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3314.2	32.92118	4	2430.028094	2430.028771	K	T	1020	1041
PSM	RKIDAGTMAEPSASPSK	2444	sp|Q8IXQ3|CI040_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2871.4	21.524	3	1824.844271	1824.844114	K	R	56	73
PSM	APASVLPAATPR	2445	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	29.18305	2	1229.613047	1229.616938	R	Q	45	57
PSM	DRVTDALNATR	2446	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3178.4	29.39503	2	1230.628847	1230.631663	K	A	419	430
PSM	RDYDDMSPR	2447	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2863.4	21.32028	2	1233.447647	1233.448553	R	R	278	287
PSM	HGLLLPASPVR	2448	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3374.3	34.48258	2	1238.654847	1238.653658	R	M	69	80
PSM	EITALAPSTMK	2449	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3305.3	32.69255	2	1240.574647	1240.577441	K	I	318	329
PSM	TTWGDGGENSPCNVVSK	2450	sp|O00161|SNP23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3251.3	31.29918	3	1886.760671	1886.750608	K	Q	101	118
PSM	ALINSPEGAVGR	2451	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3301.2	32.58477	2	1262.600247	1262.602017	R	S	66	78
PSM	DGNGYISAAELR	2452	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3394.2	34.99637	2	1264.603647	1264.604780	K	H	96	108
PSM	TSPSSPAPLPHQEATPR	2453	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3006.6	24.97575	3	1931.818571	1931.817974	R	A	169	186
PSM	GCLLYGPPGTGK	2454	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3382.4	34.6933	2	1298.571047	1298.573025	K	T	169	181
PSM	QHEAPSNRPLNELLTPQGPSPR	2455	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3422.2	35.72927	4	2597.174094	2597.178881	R	T	167	189
PSM	VNTPTTTVYR	2456	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3011.4	25.09835	2	1310.527247	1310.530900	K	C	244	254
PSM	APASVLPAATPR	2457	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3212.3	30.27852	2	1309.582047	1309.583269	R	Q	45	57
PSM	LMIEMDGTENK	2458	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,5-UNIMOD:35	ms_run[1]:scan=1.1.2910.5	22.49675	2	1311.577647	1311.568654	K	S	93	104
PSM	AGGPTTPLSPTR	2459	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2947.5	23.44478	2	1313.539447	1313.541799	R	L	15	27
PSM	SLVESVSSSPNK	2460	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3025.6	25.46868	2	1312.589847	1312.591177	R	E	309	321
PSM	GSLSNAGDPEIVKSPSDPK	2461	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3114.3	27.73247	3	1976.904371	1976.909217	R	Q	93	112
PSM	NSLESYAFNMK	2462	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3375.4	34.51205	2	1318.584847	1318.586353	K	A	540	551
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2463	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2793.6	19.6129	4	2673.045694	2673.045055	K	G	134	157
PSM	EQISDIDDAVR	2464	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3428.5	35.89668	2	1339.566647	1339.565691	K	K	115	126
PSM	EAGVEMGDEDDLSTPNEK	2465	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3240.2	31.00895	3	2014.771271	2014.771463	R	L	357	375
PSM	LAIQGPEDSPSR	2466	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3119.2	27.85933	3	1348.601471	1348.602411	R	Q	230	242
PSM	DGFPSGTPALNAK	2467	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3333.3	33.42155	2	1353.594247	1353.596597	K	G	148	161
PSM	GVQVETISPGDGR	2468	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3122.5	27.94767	2	1393.6195	1393.6233	M	T	2	15
PSM	AGMSSNQSISSPVLDAVPRTPSRER	2469	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:35,11-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3408.4	35.36883	4	2817.251294	2817.251789	K	S	1394	1419
PSM	GGGTPDANSLAPPGK	2470	sp|Q9BRQ0|PYGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3014.4	25.17682	2	1417.623847	1417.623874	R	A	299	314
PSM	NSEPAGLETPEAK	2471	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2972.5	24.09573	2	1421.607047	1421.607556	R	V	890	903
PSM	TTTWNDPRVPSEGPKETPSSANGPSR	2472	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3153.6	28.7498	4	2847.283694	2847.282480	R	E	46	72
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	2473	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	20-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3016.3	25.22502	4	2858.107294	2858.104652	K	M	639	664
PSM	EMPQDLRSPARTPPSEEDSAEAER	2474	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3151.5	28.69668	4	2857.162494	2857.162699	K	L	70	94
PSM	SSDQPLTVPVSPK	2475	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3295.5	32.43895	2	1433.677647	1433.680327	K	F	728	741
PSM	NTGIICTIGPASR	2476	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3414.5	35.52997	2	1438.666647	1438.663965	R	S	44	57
PSM	TKTPGPGAQSALR	2477	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2870.2	21.48503	3	1442.634071	1442.632011	R	A	105	118
PSM	EVDEQMLNVQNK	2478	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:35	ms_run[1]:scan=1.1.2954.6	23.6298	2	1461.674447	1461.676959	K	N	325	337
PSM	CTGGEVGATSALAPK	2479	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3114.5	27.73913	2	1497.650247	1497.653460	R	I	17	32
PSM	MPPRTPAEASSTGQTGPQSAL	2480	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3292.5	32.36082	3	2242.930571	2242.933080	K	-	238	259
PSM	AEEDEILNRSPR	2481	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3065.6	26.49342	2	1507.665447	1507.666802	K	N	574	586
PSM	AFGPGLQGGSAGSPAR	2482	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3203.4	30.04655	2	1508.675047	1508.677307	K	F	1072	1088
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	2483	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21,17-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3103.6	27.4566	4	3048.320494	3048.324359	R	L	420	447
PSM	DELTESPKYIQK	2484	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3104.3	27.47238	3	1529.701871	1529.701456	K	Q	229	241
PSM	SLPTTVPESPNYR	2485	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3302.5	32.62113	2	1539.695047	1539.697039	R	N	766	779
PSM	YLLGDAPVSPSSQK	2486	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3426.5	35.844	2	1540.713047	1540.717440	K	L	195	209
PSM	LGNNEACSSCHCSPVGSLSTQCDSYGR	2487	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:4,13-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3223.4	30.56955	4	3082.163694	3082.167470	R	C	389	416
PSM	CPNLTHLNLSGNK	2488	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3288.2	32.24703	3	1546.695971	1546.696328	K	I	87	100
PSM	EPVEAAPAAEPVPAST	2489	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3210.6	30.23625	2	1614.715647	1614.717834	K	-	262	278
PSM	HRVIGSGCNLDSAR	2490	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.2943.4	23.33772	3	1620.718571	1620.719189	K	F	157	171
PSM	EVVKPVPITSPAVSK	2491	sp|Q96HC4|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3171.2	29.20617	3	1629.870671	1629.874276	K	V	102	117
PSM	HLAEHSPYYEAMK	2492	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3029.2	25.55967	3	1654.685771	1654.685094	R	K	506	519
PSM	SSGGREDLESSGLQR	2493	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2986.4	24.4522	3	1656.712571	1656.710458	K	R	70	85
PSM	SAMPFTASPASSTTAR	2494	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3374.5	34.48925	2	1661.710447	1661.712038	R	V	123	139
PSM	NQLTSNPENTVFDAK	2495	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3364.6	34.2312	2	1676.798047	1676.800579	K	R	82	97
PSM	LESPTVSTLTPSSPGK	2496	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3362.2	34.16737	3	1679.796071	1679.801898	K	L	292	308
PSM	TLETQPLAPDCCPSDQDPAPAHPSPHASPMNK	2497	sp|Q9BUR4|TCAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:4,12-UNIMOD:4,24-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3325.5	33.21895	4	3625.467694	3625.471437	K	N	3	35
PSM	LVQDVANNTNEEAGDGTTTATVLAR	2498	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3407.6	35.34968	3	2719.172471	2719.173915	K	S	97	122
PSM	VIVVGNPANTNCLTASK	2499	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3367.4	34.30287	3	1836.877571	1836.880500	K	S	126	143
PSM	EQGQAPITPQQGQALAK	2500	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3109.4	27.60597	3	1843.881671	1843.882943	K	Q	131	148
PSM	QASTDAGTAGALTPQHVR	2501	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2931.3	23.02342	3	1859.852771	1859.852705	R	A	107	125
PSM	GNKSPSPPDGSPAATPEIR	2502	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3035.4	25.7225	3	1956.890171	1956.894236	K	V	293	312
PSM	KPVTVSPTTPTSPTEGEAS	2503	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3029.4	25.56633	3	1964.895671	1964.897984	R	-	505	524
PSM	TPSPKEEDEEPESPPEK	2504	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2813.3	20.10362	3	2003.830271	2003.824878	K	K	202	219
PSM	KPVTVSPTTPTSPTEGEAS	2505	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3041.6	25.886	3	2044.862771	2044.864315	R	-	505	524
PSM	DCDRAIEINPDSAQPYK	2506	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3341.5	33.63663	3	2070.873971	2070.871786	R	W	170	187
PSM	ITITNDQNRLTPEEIER	2507	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3391.6	34.9314	3	2121.006671	2121.010328	K	M	524	541
PSM	STTPPPAEPVSLPQEPPKPR	2508	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3289.2	32.27275	4	2204.086494	2204.087850	K	V	225	245
PSM	GHTDTEGRPPSPPPTSTPEK	2509	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2769.2	19.15087	4	2246.928494	2246.924624	R	C	353	373
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	2510	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2869.6	21.47273	3	2611.088471	2611.085754	K	L	460	485
PSM	DGEDQTQDTELVETRPAGDGTFQK	2511	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3288.6	32.26037	3	2636.178371	2636.183798	R	W	244	268
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	2512	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3281.6	32.0796	4	3156.392894	3156.395856	K	G	306	335
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	2513	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3294.6	32.41611	3	3173.243171	3173.243468	R	-	738	768
PSM	GLFIIDDK	2514	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3686.2	42.33258	2	919.499447	919.501484	R	G	129	137
PSM	SDLLSAIR	2515	sp|Q9Y6W5|WASF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3821.2	45.81443	2	953.457647	953.458313	R	Q	438	446
PSM	QFSQYIK	2516	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3504.2	37.7866	2	992.434447	992.436849	K	N	222	229
PSM	WLCPLSGK	2517	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3573.2	39.57765	2	1039.454047	1039.456204	K	K	713	721
PSM	MLTFNPNK	2518	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3469.2	36.8849	2	1043.448247	1043.451119	R	R	310	318
PSM	AIVDALPPPCESACTVPTDVDK	2519	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3735.2	43.60887	4	2434.075294	2434.079730	R	W	261	283
PSM	SVDFDSLTVR	2520	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3769.2	44.47577	2	1217.534847	1217.532934	K	T	458	468
PSM	QVPDSAATATAYLCGVK	2521	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3715.3	43.0914	3	1830.819371	1830.822317	R	A	107	124
PSM	TVFSPTLPAAR	2522	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3609.3	40.4984	2	1238.603447	1238.606039	K	S	375	386
PSM	GVLLYGPPGTGK	2523	sp|Q8NB90|AFG2H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3515.4	38.08138	2	1237.606247	1237.610790	R	T	389	401
PSM	DAGQISGLNVLR	2524	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3601.4	40.29248	2	1241.669047	1241.672800	K	V	207	219
PSM	NLFEDQNTLTSICEK	2525	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3851.2	46.55933	3	1890.805271	1890.807061	K	V	332	347
PSM	LDIDSPPITAR	2526	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3505.2	37.8127	2	1276.604647	1276.606433	R	N	33	44
PSM	KKIEEAMDGSETPQLFTVLPEK	2527	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3745.3	43.86917	4	2569.236094	2569.238673	K	R	769	791
PSM	GDNITLLQSVSN	2528	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3819.2	45.7622	2	1339.599047	1339.602076	K	-	81	93
PSM	ELISNASDALDK	2529	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3597.4	40.18767	2	1354.600047	1354.601742	R	I	103	115
PSM	AAMYDIISSPSK	2530	sp|Q6KC79|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3574.4	39.60985	2	1361.593047	1361.593820	K	D	342	354
PSM	EFSPFGTITSAK	2531	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3924.2	48.37762	2	1363.604247	1363.606099	K	V	313	325
PSM	ESVPEFPLSPPK	2532	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	45.26868	3	1405.653671	1405.653049	K	K	30	42
PSM	ESVPEFPLSPPK	2533	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3774.5	44.60878	2	1405.650647	1405.653049	K	K	30	42
PSM	DINTFLGTPVQK	2534	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3726.3	43.37872	2	1411.671047	1411.674847	K	L	1794	1806
PSM	LGGSAVISLEGKPL	2535	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3915.4	48.15118	2	1419.735847	1419.737448	K	-	153	167
PSM	EFSPFGSITSAK	2536	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4123.3	52.75175	2	1429.555847	1429.556780	K	V	313	325
PSM	TDSVIIADQTPTPTRFLK	2537	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3870.3	47.01273	3	2162.004671	2162.006168	R	N	42	60
PSM	TKPIWTRNPDDITQEEYGEFYK	2538	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3856.4	46.6928	4	2889.230494	2889.229974	K	S	285	307
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	2539	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3726.4	43.38205	4	2896.362894	2896.363082	K	A	2621	2646
PSM	ESDQTLAALLSPK	2540	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4014.3	50.48518	2	1451.689847	1451.690891	K	E	1687	1700
PSM	ILATPPQEDAPSVDIANIR	2541	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4005.4	50.24395	3	2178.997571	2178.996332	K	M	284	303
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2542	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3751.3	44.02587	4	2933.372094	2933.372935	K	V	8	36
PSM	GYISPYFINTSK	2543	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3787.4	44.93752	2	1468.662447	1468.663948	R	G	222	234
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	2544	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3796.5	45.1747	4	2952.317294	2952.317863	K	I	350	377
PSM	SLPTPAVLLSPTK	2545	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3948.3	48.95023	2	1482.711447	1482.713615	K	E	632	645
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	2546	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3716.2	43.11422	4	2972.319694	2972.324602	K	Q	178	204
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2547	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3870.4	47.01607	4	3013.336494	3013.339266	K	V	8	36
PSM	DGDSYDPYDFSDTEEEMPQVHTPKTADSQETK	2548	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3810.5	45.53882	5	3821.457118	3821.448889	K	E	701	733
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRK	2549	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4136.3	52.98102	4	3109.364894	3109.368258	R	A	139	166
PSM	GQASSPTPEPGVGAGDLPGPTSAPVPSGSQSGGR	2550	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3503.5	37.76975	4	3138.425694	3138.425516	K	G	960	994
PSM	SSDEENGPPSSPDLDRIAASMR	2551	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3716.4	43.12088	3	2410.010171	2410.010799	R	A	202	224
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	2552	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3614.6	40.6397	4	3246.387294	3246.383770	K	V	233	262
PSM	QAGGFLGPPPPSGKFS	2553	sp|Q9UM00|TMCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3625.5	40.92052	2	1622.746247	1622.749409	K	-	224	240
PSM	NREPLMPSPQFIK	2554	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3615.3	40.65695	3	1635.792371	1635.784415	K	S	246	259
PSM	SAPELKTGISDVFAK	2555	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3669.2	41.8993	3	1641.800471	1641.801505	K	N	319	334
PSM	MGQAPSQSLLPPAQDQPRSPVPSAFSDQSR	2556	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3739.5	43.72127	4	3338.484894	3338.479222	R	C	2431	2461
PSM	ELAPEPWVERATPT	2557	sp|Q9BTY7|HGH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3674.4	42.0308	2	1674.763247	1674.765453	R	-	377	391
PSM	QASSETPGCTDRGNSDDFILISKDDDGSSAR	2558	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3461.5	36.68775	4	3380.414894	3380.410002	K	G	698	729
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2559	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4257.3	54.76083	4	3425.462494	3425.458138	K	-	610	647
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	2560	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3527.6	38.39997	4	3448.568494	3448.567155	K	V	871	903
PSM	ELPAAEPVLSPLEGTK	2561	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3792.3	45.06403	3	1729.853771	1729.853934	K	M	266	282
PSM	NSPEDLGLSLTGDSCK	2562	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3656.6	41.58413	2	1771.732247	1771.733561	K	L	499	515
PSM	VLLPEYGGTKVVLDDK	2563	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3673.6	42.01266	2	1824.923847	1824.927433	K	D	71	87
PSM	NQLTSNPENTVFDAK	2564	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3521.5	38.23877	2	1836.732447	1836.733241	K	R	82	97
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	2565	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:35,12-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.3753.4	44.08085	3	2779.125371	2779.124174	K	D	208	233
PSM	CFSPGVIEVQEVQGKK	2566	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3534.3	38.57298	3	1883.884871	1883.885251	R	V	256	272
PSM	SLGNAPNTPDFYQQLR	2567	sp|Q13370|PDE3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3751.2	44.02253	3	1899.841271	1899.851643	R	N	554	570
PSM	SMDEFTASTPADLGEAGR	2568	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	40.05083	3	1933.785371	1933.776488	R	L	380	398
PSM	SVPTSTVFYPSDGVATEK	2569	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3628.2	40.9842	3	1963.879871	1963.881605	R	A	439	457
PSM	LATQSNEITIPVTFESR	2570	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4135.5	52.95207	3	2064.916271	2064.917019	K	A	172	189
PSM	EYIPTVFDNYSAQSAVDGR	2571	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4032.3	50.88503	3	2210.951171	2210.952145	K	T	31	50
PSM	SIQTPQSHGTLTAELWDNK	2572	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3859.4	46.77038	3	2284.974071	2284.976659	K	V	1977	1996
PSM	NVVVVDGVRTPFLLSGTSYK	2573	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4098.2	52.33058	3	2310.111071	2310.106217	R	D	53	73
PSM	DTCYSPKPSVYLSTPSSASK	2574	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,3-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3437.5	36.12935	3	2333.952071	2333.952813	K	A	538	558
PSM	IADYEAASAVPGVAAEQPGVSPSGS	2575	sp|Q9Y5J6|T10B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3740.3	43.74312	3	2409.074171	2409.073716	R	-	79	104
PSM	APSEEDSLSSVPISPYKDEPWK	2576	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3868.5	46.96762	3	2620.103771	2620.102313	K	Y	36	58
PSM	SSSLEMTPYNTPQLSPATTPANKK	2577	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3555.5	39.12882	3	2722.206371	2722.196231	K	N	452	476
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	2578	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.4039.4	51.03777	3	2763.130571	2763.129259	K	D	208	233
PSM	TLPLTTAPEAGEVTPSDSGGQEDSPAK	2579	sp|O95359|TACC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3576.6	39.66963	3	2814.191771	2814.188562	K	G	2233	2260
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	2580	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:21,21-UNIMOD:35	ms_run[1]:scan=1.1.3566.5	39.40907	3	2851.268471	2851.269533	R	T	350	376
PSM	AGSEECVFYTDETASPLAPDLAKASPK	2581	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,15-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3866.5	46.91623	3	3013.295171	3013.270518	R	R	610	637
PSM	TASTPTPPQTGGGLEPQANGETPQVAVIVRPDDR	2582	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3627.6	40.97313	4	3535.698094	3535.694421	R	S	202	236
PSM	VYSLPDGTFSSDEDEEEEEEEEEEEEEEET	2583	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4146.2	53.2359	3	3647.282171	3647.289105	R	-	519	549
PSM	RFSEGVLQSPSQDQEK	2584	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3155.5	28.79745	3	1914.846971	1913.852037	R	L	427	443
PSM	NYLQSLPSK	2585	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3358.2	34.06728	2	1128.516247	1128.521641	R	T	279	288
PSM	ESEPESPMDVDNSK	2586	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2980.6	24.30322	2	1643.603047	1642.606963	K	N	297	311
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	2587	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3980.5	49.71348	4	3523.460094	3522.472617	K	F	604	634
PSM	ESVPEFPLSPPK	2588	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3791.2	45.03408	2	1405.650647	1405.653049	K	K	30	42
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2589	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:4,15-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3536.5	38.63185	5	3563.476618	3562.491898	K	V	60	92
PSM	DNLTLWTSDQQDDDGGEGNN	2590	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3899.4	47.76719	3	2193.864371	2192.873028	R	-	228	248
PSM	AEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTK	2591	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,29-UNIMOD:21,33-UNIMOD:4	ms_run[1]:scan=1.1.3615.6	40.66695	4	3691.6099	3691.6092	M	S	2	41
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2592	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.3711.6	42.99693	3	2765.2267	2765.2250	-	Y	1	25
PSM	DNLTLWTSDTQGDEAEAGEGGEN	2593	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3940.3	48.76702	3	2409.011171	2407.988786	R	-	223	246
PSM	WLKSPTTPIDPEK	2594	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3426.2	35.834	3	1670.735471	1670.735807	K	Q	859	872
PSM	SAPASPTHPGLMSPR	2595	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3166.3	29.079	3	1665.679571	1664.678309	R	S	416	431
PSM	SGGLQTPECLSR	2596	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3144.5	28.51973	2	1384.583647	1383.585381	R	E	431	443
PSM	AFKDTGKTPVEPEVAIHR	2597	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3397.3	35.07752	4	2195.9983	2196.0012	M	I	2	20
PSM	SSAPTTPPSVDKVDGFSR	2598	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3537.5	38.65798	3	1968.8756	1968.8825	M	K	2	20
PSM	TAASGVEANSRPLDHAQPPSSLVIDK	2599	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3389.3	34.86983	4	2739.323694	2739.322889	K	E	167	193
PSM	FLMECRNSPVTK	2600	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2948.2	23.46107	3	1576.679171	1576.677901	K	T	58	70
PSM	AENVVEPGPPSAKRPK	2601	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3036.3	25.7454	3	1796.8817	1796.8817	M	L	2	18
PSM	EAAGGNDSSGATSPINPAVALE	2602	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3791.2	45.03408	3	2106.913571	2106.910674	K	-	1236	1258
PSM	SAEVCKQDSPFSR	2603	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2915.5	22.62218	3	1589.654771	1589.654523	K	V	161	174
PSM	PRPDPSPEIEGDLQPATHGSR	2604	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3197.3	29.88617	4	2335.058894	2335.059404	R	F	146	167
PSM	ASGADSKGDDLSTAILK	2605	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3574.2	39.60318	3	1769.8078	1769.8079	M	Q	2	19
PSM	QAGGFLGPPPPSGK	2606	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=1.1.3717.3	43.14338	2	1371.6225	1371.6219	K	F	224	238
PSM	NSSTPGLQVPVSPTVPIQNQK	2607	sp|Q03164|KMT2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3717.4	43.14672	3	2350.097471	2350.097109	R	Y	3025	3046
PSM	GEAAPGPAPPAPEATPPPASAAGK	2608	sp|Q9NSI2|F207A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3127.6	28.08175	3	2267.980271	2267.986496	K	D	20	44
PSM	ATSPQKSPSVPKSPTPK	2609	sp|Q9NVD7|PARVA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2889.3	21.97547	3	1937.8886	1937.8896	M	S	2	19
PSM	VQAEDEANGLQTTPASR	2610	sp|P30622|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2975.4	24.16705	3	1865.822171	1865.815651	K	A	128	145
PSM	RPWEDDPPNVHIIGNLPFSVSTPLIIK	2611	sp|Q8WVM0|TFB1M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21,21-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3052.4	26.16408	5	3295.510118	3293.532835	K	W	127	154
PSM	VGDSTPVSEKPVSAAVDANASESP	2612	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3373.6	34.46628	3	2473.026371	2473.029877	R	-	429	453
PSM	APTTVEDRVGDSTPVSEKPVSAAVDANASESP	2613	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,31-UNIMOD:21	ms_run[1]:scan=1.1.3426.6	35.84733	4	3342.454894	3342.454173	K	-	421	453
PSM	IMNTFSVVPSPK	2614	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3502.4	37.74087	2	1415.650647	1414.656755	R	V	163	175
PSM	TASTPTPPQTGGGLEPQANGETPQVAVIVRPDDR	2615	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3751.6	44.03587	4	3616.644094	3615.660752	R	S	202	236
PSM	RKEDEVEEWQHR	2616	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2895.3	22.13098	4	1639.768894	1639.770282	R	A	437	449
PSM	KETPPPLVPPAAR	2617	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3190.4	29.7067	3	1451.754071	1451.753766	R	E	3	16
PSM	APLKPYPVSPSDK	2618	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3074.2	26.71185	3	1477.721471	1477.721798	K	V	1039	1052
PSM	FANLTPSR	2619	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3132.2	28.19898	2	984.438847	984.442997	K	T	2050	2058
PSM	SCNCLLLK	2620	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3166.2	29.07567	2	1006.492447	1006.493973	K	V	336	344
PSM	GNLTPLTGR	2621	sp|O75683|SURF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3125.2	28.01555	2	1007.475647	1007.480111	K	N	226	235
PSM	DWDDDQND	2622	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2988.2	24.49735	2	1021.325647	1021.326098	K	-	541	549
PSM	TVSPALISR	2623	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3172.2	29.23223	2	1022.514047	1022.516162	K	F	374	383
PSM	LRVQSPEPPAPER	2624	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2992.3	24.60422	3	1554.759071	1554.755557	R	A	1471	1484
PSM	GLTSVINQK	2625	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3387.2	34.81528	2	1038.508847	1038.511076	R	L	300	309
PSM	MLTFNPNK	2626	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3210.2	30.22292	2	1059.445047	1059.446034	R	R	310	318
PSM	ENLSAAFSR	2627	sp|P15170-2|ERF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3398.2	35.10037	2	1073.453447	1073.454290	R	Q	59	68
PSM	DLVAQAPLKPKTPR	2628	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3109.2	27.5993	3	1612.866371	1612.870193	K	G	523	537
PSM	DGEIVGLSGR	2629	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3291.3	32.32827	2	1081.479847	1081.480505	K	V	86	96
PSM	GGEIQPVSVK	2630	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3048.2	26.05508	2	1092.518847	1092.521641	K	V	57	67
PSM	QLEHVMDSAAEDPQSPKTPPHFQTHLAK	2631	sp|Q9NS87|KIF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3310.2	32.81847	6	3298.453341	3298.451945	R	L	1127	1155
PSM	LVEPGSPAEK	2632	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2839.2	20.71188	2	1105.505647	1105.505657	R	A	41	51
PSM	SPGAPGPLTLK	2633	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3349.2	33.83588	2	1116.555047	1116.558027	R	E	344	355
PSM	DLEEAEEYK	2634	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3082.2	26.92037	2	1124.485847	1124.487350	K	E	87	96
PSM	LQTPNTFPK	2635	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3120.3	27.88927	2	1124.523447	1124.526726	K	R	605	614
PSM	DCGSVDGVIK	2636	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3108.2	27.57332	2	1128.449047	1128.452241	K	E	26	36
PSM	GHASAPYFGKEEPSVAPSSTGK	2637	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3162.4	28.97727	4	2283.023694	2283.020893	K	T	131	153
PSM	GTGLLSSDYR	2638	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3368.2	34.32222	2	1147.489447	1147.491069	K	I	402	412
PSM	VGSLTPPSSPK	2639	sp|Q2M2I8|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2983.3	24.3709	2	1148.545647	1148.547856	K	T	616	627
PSM	RVTNDISPESSPGVGR	2640	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2962.3	23.82573	3	1749.801671	1749.804692	K	R	59	75
PSM	LALGDDSPALK	2641	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3354.3	33.96923	2	1178.554047	1178.558421	R	E	87	98
PSM	HGEVCPAGWKPGSDTIKPDVQK	2642	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3134.3	28.25442	4	2405.172494	2405.179779	K	S	169	191
PSM	RPPAAPENTPLVPSGVK	2643	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3143.3	28.48712	3	1808.911271	1808.918600	K	S	124	141
PSM	ELAEDDSILK	2644	sp|P56385|ATP5I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3371.2	34.40093	2	1211.532647	1211.532265	R	-	60	70
PSM	YATALYSAASK	2645	sp|P48047|ATPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3226.5	30.65135	2	1224.540447	1224.542771	R	Q	41	52
PSM	WNSVSPASAGK	2646	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3055.4	26.23807	2	1262.470247	1262.473385	K	R	304	315
PSM	GISCMNTTLSESPFKCDPDAAR	2647	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,5-UNIMOD:35,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3405.4	35.29048	4	2552.040094	2552.038277	K	A	239	261
PSM	SLGSAGPSGTLPR	2648	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3207.4	30.15105	2	1278.589847	1278.596931	R	S	332	345
PSM	GGSGSGPTIEEVD	2649	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3257.4	31.45895	2	1283.490247	1283.491857	K	-	629	642
PSM	SLIGVEYKPVSATGAEDK	2650	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3429.2	35.9131	3	1942.927271	1942.928890	K	D	944	962
PSM	ADSGPTQPPLSLSPAPETK	2651	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3433.5	36.02797	3	1971.915971	1971.919054	R	R	2071	2090
PSM	DITEEIMSGAR	2652	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3367.5	34.3062	2	1316.533247	1316.531948	K	T	191	202
PSM	GSLSNAGDPEIVKSPSDPK	2653	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3111.5	27.66118	3	1976.904371	1976.909217	R	Q	93	112
PSM	EITALAPSTMK	2654	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3413.3	35.49723	2	1320.538847	1320.543772	K	I	318	329
PSM	SLSPGAASSSSGDGDGKEGLEEPKGPR	2655	sp|Q6ZN18|AEBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3027.5	25.51778	4	2651.172494	2651.171199	R	G	139	166
PSM	SGTSSPQSPVFR	2656	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3051.5	26.14217	2	1328.572047	1328.576196	K	H	661	673
PSM	GILAADESTGSIAK	2657	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3205.4	30.09898	2	1331.688047	1331.693260	K	R	29	43
PSM	TPKGPSSVEDIK	2658	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2976.4	24.19298	2	1336.623647	1336.627563	K	A	237	249
PSM	SSTPLHSPSPIR	2659	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2990.2	24.54928	3	1357.638371	1357.639131	R	V	283	295
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2660	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3365.5	34.25325	4	2717.306494	2717.307830	R	R	31	56
PSM	GEPNVSYICSR	2661	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3171.6	29.2195	2	1360.547647	1360.548267	R	Y	273	284
PSM	LQAPDSATLLEK	2662	sp|Q9BUL5|PHF23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3427.3	35.86365	2	1364.654247	1364.658863	R	M	119	131
PSM	ADGYEPPVQESV	2663	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3397.5	35.08418	2	1369.543647	1369.543893	R	-	253	265
PSM	SSPNPFVGSPPK	2664	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3414.4	35.52663	2	1372.543247	1372.546550	K	G	393	405
PSM	DLLHPSPEEEK	2665	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3196.4	29.86408	2	1372.588847	1372.591177	K	R	6	17
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	2666	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3113.6	27.71663	4	2769.240494	2769.239553	K	V	100	125
PSM	SAGLEQPTDPVAR	2667	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3149.6	28.65102	2	1419.637247	1419.639524	K	D	361	374
PSM	NSEPAGLETPEAK	2668	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2964.6	23.88738	2	1421.607047	1421.607556	R	V	890	903
PSM	LHNGDLCSPKRSPTSSAIPLQSPR	2669	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3231.6	30.7864	4	2857.237294	2857.238461	K	N	1234	1258
PSM	DVSGPLPPAYSPR	2670	sp|Q5ST30|SYVM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3384.4	34.74545	2	1434.652247	1434.654446	K	Y	95	108
PSM	SSTPLHSPSPIR	2671	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3002.2	24.86242	3	1437.604271	1437.605462	R	V	283	295
PSM	AMKPPGGESSNLFGSPEEATPSSRPNR	2672	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3304.3	32.66655	4	2879.284894	2879.290937	R	M	16	43
PSM	DKKDEEEDMSLD	2673	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2973.6	24.12127	2	1452.590047	1452.592620	K	-	396	408
PSM	CVSPIPVSPTSR	2674	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3197.5	29.89283	2	1458.601447	1458.597934	R	I	811	823
PSM	NPSDSAVHSPFTK	2675	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2951.2	23.53857	3	1465.621871	1465.623874	K	R	408	421
PSM	SKPIPIMPASPQK	2676	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3200.4	29.96807	2	1472.743447	1472.746238	K	G	607	620
PSM	PCSEETPAISPSK	2677	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2901.5	22.29145	2	1481.6085	1481.6104	M	R	2	15
PSM	IIYGGSVTGATCK	2678	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3211.6	30.26217	2	1485.596047	1485.597599	R	E	244	257
PSM	SSSSASSEASETCQSVSECSSPTSDWSK	2679	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:4,19-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3286.4	32.20172	4	3034.137694	3034.132901	K	V	353	381
PSM	ELAQRQEEEAAQQGPVVVSPASDYKDK	2680	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3209.4	30.20332	4	3051.417294	3051.418640	K	Y	140	167
PSM	SPVSTRPLPSASQK	2681	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2889.2	21.97213	3	1533.753371	1533.755223	R	A	216	230
PSM	PCSEETPAISPSK	2682	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2884.6	21.85658	2	1561.5743	1561.5767	M	R	2	15
PSM	AQGAGVTLPPTPSGSR	2683	sp|Q6P996|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3139.5	28.3897	2	1574.742047	1574.745387	K	T	681	697
PSM	TQSPGGCSAEAVLAR	2684	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3244.5	31.12327	2	1582.677447	1582.681072	R	K	74	89
PSM	YAGGNPVCVRPTPK	2685	sp|Q15004|PAF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3012.3	25.12068	3	1594.734671	1594.732714	K	W	47	61
PSM	SQDSYPGSPSLSPR	2686	sp|Q6VN20|RBP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3200.6	29.97473	2	1636.620247	1636.617148	K	H	358	372
PSM	SAPASPTHPGLMSPR	2687	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3150.6	28.67533	2	1664.674647	1664.678309	R	S	416	431
PSM	NDSPTQIPVSSDVCR	2688	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3258.4	31.48527	2	1753.729047	1753.734230	R	L	673	688
PSM	QLEDGRTLSDYNIQK	2689	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3223.3	30.56622	3	1778.875871	1778.879892	K	E	49	64
PSM	RLQSIGTENTEENRR	2690	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2797.4	19.7067	3	1801.899071	1801.903087	K	F	43	58
PSM	HVPDSGATATAYLCGVK	2691	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3422.6	35.7426	2	1825.802647	1825.807001	K	G	110	127
PSM	TAENATSGETLEENEAGD	2692	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3035.6	25.72917	2	1836.752247	1836.749725	K	-	377	395
PSM	GVQVETISPGDGRTFPK	2693	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3371.4	34.4076	3	1866.8825	1866.8872	M	R	2	19
PSM	AELLQSDENGIPSSPQK	2694	sp|Q14542|S29A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3332.4	33.39883	3	1891.853471	1891.856453	K	V	239	256
PSM	SASQGALTSPSVSFSNHR	2695	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3219.3	30.46167	3	1911.846371	1911.847620	R	T	475	493
PSM	EVNVSPCPTQPCQLSK	2696	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3163.2	28.9965	3	1922.821871	1922.826750	K	G	36	52
PSM	TAGNSEFLGKTPGQNAQK	2697	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3098.4	27.32557	3	2006.848571	2006.850002	K	W	32	50
PSM	TVEVAEGEAVRTPQSVTAK	2698	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3117.6	27.82068	3	2050.989371	2050.993616	R	Q	132	151
PSM	IASPVSRKEPPLTPVPLK	2699	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3336.5	33.50625	3	2088.073871	2088.078545	K	R	207	225
PSM	NNEESPTATVAEQGEDITSK	2700	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3352.4	33.92083	3	2198.917571	2198.921632	K	K	9	29
PSM	MPPRTPAEASSTGQTGPQSAL	2701	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3312.3	32.87303	3	2242.931471	2242.933080	K	-	238	259
PSM	DTCYSPKPSVYLSTPSSASK	2702	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3384.5	34.74878	3	2253.991271	2253.986482	K	A	538	558
PSM	NTNDANSCQIIIPQNQVNR	2703	sp|P31150|GDIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3358.5	34.07728	3	2278.014971	2278.016159	K	K	310	329
PSM	SISSPSVSSETMDKPVDLSTR	2704	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3422.3	35.7326	3	2302.035071	2302.039973	K	K	2802	2823
PSM	SSERTPGAATASASGAAEDGACGCLPNPGTFEECHRK	2705	sp|O96008|TOM40_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:21,22-UNIMOD:4,24-UNIMOD:4,34-UNIMOD:4	ms_run[1]:scan=1.1.3408.5	35.37217	5	3965.587618	3965.580546	R	C	53	90
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDK	2706	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3256.6	31.43978	3	2625.085571	2625.090171	R	L	221	248
PSM	EDGNEEDKENQGDETQGQQPPQRR	2707	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2569.2	16.91642	4	2783.204094	2783.197885	R	Y	257	281
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	2708	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3418.6	35.63795	3	2807.198171	2807.201193	R	G	70	97
PSM	ITIADCGQLE	2709	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3437.2	36.11935	2	1118.522647	1118.527775	K	-	156	166
PSM	DQLIYNLLK	2710	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4005.2	50.23728	2	1118.632447	1118.633560	K	E	6	15
PSM	VTNGAFTGEISPGMIK	2711	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3549.2	38.96278	3	1716.779171	1716.779389	K	D	107	123
PSM	VLLPEYGGTK	2712	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3458.2	36.59948	2	1155.555447	1155.557692	K	V	71	81
PSM	STFVLDEFK	2713	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3974.2	49.54482	2	1164.509247	1164.510408	K	R	286	295
PSM	DQIYDIFQK	2714	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3824.3	45.89525	2	1168.576247	1168.576440	K	L	194	203
PSM	DGEEAGAYDGPRTADGIVSHLK	2715	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3504.3	37.78993	4	2337.028894	2337.027435	R	K	108	130
PSM	DGFVTVDELK	2716	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3733.2	43.55713	2	1201.525647	1201.526786	K	D	85	95
PSM	DLLTPCYSR	2717	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3471.2	36.93783	2	1203.496847	1203.499526	K	Q	304	313
PSM	KLSSWDQAETPGHTPSLRWDETPGR	2718	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3599.4	40.24002	5	3010.301618	3010.301181	K	A	214	239
PSM	AIVDALPPPCESACTVPTDVDK	2719	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:4,14-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3725.3	43.3529	4	2434.087694	2434.079730	R	W	261	283
PSM	QVPDSAATATAYLCGVK	2720	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3699.2	42.67052	3	1830.819371	1830.822317	R	A	107	124
PSM	DIDISSPEFK	2721	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3593.3	40.0799	2	1229.520647	1229.521701	K	I	172	182
PSM	DLFDPIIEDR	2722	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4029.2	50.8044	2	1231.606647	1231.608468	K	H	87	97
PSM	APVPEPGLDLSLSPRPDSPQPR	2723	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3832.3	46.10209	4	2484.141694	2484.145122	R	H	35	57
PSM	DLRSPLIATPTFVADK	2724	sp|P49116|NR2C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	48.09307	3	1902.889571	1902.889348	K	D	216	232
PSM	HGTDLWIDNMSSAVPNHSPEKK	2725	sp|Q8N6H7|ARFG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3503.3	37.76308	4	2542.136494	2542.131188	R	D	129	151
PSM	FCFTPHTEEGCLSER	2726	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3510.4	37.95018	3	1948.744271	1948.748500	K	A	1117	1132
PSM	DVLSVAFSSDNR	2727	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3717.2	43.14005	2	1308.628447	1308.630994	K	Q	107	119
PSM	QPSVLSSGYQKTPQEWAPQTAR	2728	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3527.3	38.38997	4	2618.166894	2618.156749	K	I	275	297
PSM	SGFGEISSPVIR	2729	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3639.2	41.15888	2	1327.610847	1327.617332	R	E	4	16
PSM	NNIPYFETSAK	2730	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3563.4	39.33245	2	1362.583447	1362.585698	K	E	147	158
PSM	EFSPFGTITSAK	2731	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3861.3	46.81892	2	1363.603647	1363.606099	K	V	313	325
PSM	DFTPVCTTELGR	2732	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3468.3	36.8621	2	1394.646047	1394.650015	R	A	42	54
PSM	ESVPEFPLSPPK	2733	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3765.4	44.38452	2	1405.650647	1405.653049	K	K	30	42
PSM	TPQSPAPCVLLR	2734	sp|Q9Y613|FHOD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3459.2	36.6255	2	1417.672247	1417.678887	R	A	495	507
PSM	SATLASIDAELQK	2735	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3803.4	45.35355	2	1425.674447	1425.675241	K	L	527	540
PSM	EFSPFGTITSAK	2736	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4085.2	52.02723	2	1443.572047	1443.572430	K	V	313	325
PSM	NLEQILNGGESPK	2737	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3779.4	44.7324	2	1477.678247	1477.681389	K	Q	219	232
PSM	ELENANDLLSATK	2738	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3544.4	38.83837	2	1496.674447	1496.675970	K	R	352	365
PSM	DQLLLGPTYATPK	2739	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3739.3	43.7146	2	1495.725847	1495.732362	K	V	349	362
PSM	YISPDQLADLYK	2740	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4050.3	51.2395	2	1504.683047	1504.685078	R	S	270	282
PSM	DTPENNPDTPFDFTPENYK	2741	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3893.2	47.605	3	2319.923171	2319.920904	R	R	43	62
PSM	QLSSTSPLAPYPTSQMVSSDR	2742	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3659.4	41.65152	3	2331.040871	2331.045393	R	S	408	429
PSM	AASQLAVPSTPLSPHSAASGTAAGSQPSSPR	2743	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,21-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=1.1.3496.6	37.5909	4	3127.342094	3127.341406	R	Y	299	330
PSM	GDLNDCFIPCTPK	2744	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3622.6	40.8492	2	1615.639447	1615.641181	R	G	138	151
PSM	CQDLLSQTSSPLSQNDSCTGR	2745	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,8-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3456.4	36.55342	3	2432.991071	2432.993769	R	S	849	870
PSM	GGPGSAVSPYPTFNPSSDVAALHK	2746	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3847.4	46.46828	3	2515.079771	2515.082187	K	A	30	54
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2747	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:35,24-UNIMOD:21	ms_run[1]:scan=1.1.4021.3	50.60458	4	3441.455694	3441.453053	K	-	610	647
PSM	WATDQEDCSDQDLAGTPDLGPQKSPLWEK	2748	sp|O75128|COBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4,16-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3902.4	47.84077	4	3446.408094	3446.405114	K	N	432	461
PSM	SAMPFTASPASSTTAR	2749	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3501.2	37.70765	3	1741.675871	1741.678369	R	V	123	139
PSM	CIPALDSLTPANEDQK	2750	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3611.2	40.54757	3	1770.847871	1770.845815	R	I	447	463
PSM	DVTNFTVGGFAPMSPR	2751	sp|O00267|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3908.5	47.97673	2	1790.767647	1790.769887	R	I	653	669
PSM	LEFQQQLGEAPSDASP	2752	sp|Q9BUW7|CI016_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3767.5	44.4368	2	1795.764447	1795.766576	R	-	68	84
PSM	SSASAPDVDDPEAFPALA	2753	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4256.3	54.73483	2	1838.760447	1838.761156	K	-	391	409
PSM	SATSSSPGSPLHSLETSL	2754	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4571.2	58.47863	3	1916.780471	1916.780585	K	-	1203	1221
PSM	DLKPSNLLLNTTCDLK	2755	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3786.3	44.9083	3	1923.941771	1923.937681	R	I	149	165
PSM	KEESEESDDDMGFGLFD	2756	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4092.3	52.18282	2	1948.750247	1948.752033	K	-	98	115
PSM	SGAMSPMSWNSDASTSEAS	2757	sp|Q13158|FADD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3804.5	45.38275	2	1981.705047	1981.707088	R	-	190	209
PSM	MASPPAPSPAPPAISPIIK	2758	sp|Q00587|BORG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3875.2	47.13797	3	2000.939471	2000.944754	R	N	99	118
PSM	GTIVLASPGWTTHSISDGK	2759	sp|Q14914|PTGR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3698.3	42.64725	3	2005.944071	2005.951022	K	D	82	101
PSM	GPSLDIDTPDVNIEGPEGK	2760	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3775.4	44.63048	3	2031.900971	2031.903797	K	L	4423	4442
PSM	VAPEEHPVLLTEAPLNPK	2761	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3578.5	39.7186	3	2033.021471	2033.023459	R	A	96	114
PSM	LSGSNPYTTVTPQIINSK	2762	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3663.4	41.7548	3	2078.932871	2078.932669	K	W	605	623
PSM	DRYMSPMEAQEFGILDK	2763	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3796.3	45.16803	3	2124.892871	2124.889744	R	V	227	244
PSM	DNLTLWTSDQQDDDGGEGNN	2764	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3933.4	48.5994	3	2192.869571	2192.873028	R	-	228	248
PSM	IADPEHDHTGFLTEYVATR	2765	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3466.2	36.8072	4	2250.992894	2250.994678	R	W	190	209
PSM	AAVPSGASTGIYEALELRDNDK	2766	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3878.5	47.22622	3	2356.089671	2356.094786	R	T	33	55
PSM	SAMDSPVPASMFAPEPSSPGAAR	2767	sp|O00178|GTPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4016.4	50.53027	3	2418.965771	2418.962665	R	A	8	31
PSM	ELGGLEGDPSPEEDEGIQKASPLTHSPPDEL	2768	sp|Q9BT09|CNPY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3821.5	45.82443	4	3322.474494	3322.476608	K	-	248	279
PSM	DSGSDTASAIIPSTTPSVDSDDESVVK	2769	sp|Q6WKZ4|RFIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3698.6	42.65725	3	2759.181071	2759.190991	K	D	183	210
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2770	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.3624.6	40.89905	3	2897.087471	2897.089897	K	T	701	725
PSM	FSISPDEDSSSYSSNSDFNYSYPTK	2771	sp|Q96QD8|S38A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3862.6	46.85448	3	2903.124671	2903.133476	R	Q	9	34
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2772	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:35,29-UNIMOD:21	ms_run[1]:scan=1.1.3989.3	49.91027	4	3441.452494	3441.453053	K	-	610	647
PSM	EITALAPSTMK	2773	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3183.2	29.51855	2	1336.536047	1336.538687	K	I	318	329
PSM	IADPEHDHTGFLTEYVATRWYR	2774	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4025.2	50.7008	4	2916.172894	2916.171093	R	A	190	212
PSM	ASGVAVSDGVIK	2775	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3708.3	42.90878	2	1303.5449	1303.5457	M	V	2	14
PSM	QPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGAR	2776	sp|Q96S55|WRIP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,35-UNIMOD:21	ms_run[1]:scan=1.1.3194.6	29.8183	4	4180.614894	4180.617956	K	L	82	122
PSM	DSPSVWAAVPGK	2777	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3622.3	40.8392	2	1293.592647	1292.580219	K	T	27	39
PSM	DNLTLWTSDQQDDDGGEGNN	2778	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3891.3	47.55695	3	2193.866171	2192.873028	R	-	228	248
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2779	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3739.2	43.71127	4	2845.1919	2845.1913	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2780	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3924.3	48.38095	4	2749.2308	2749.2301	-	Y	1	25
PSM	SVTEQGAELSNEER	2781	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2967.2	23.95252	3	1548.716471	1547.706344	K	N	28	42
PSM	DTCYSPKPSVYLSTPSSASK	2782	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3449.4	36.3779	3	2333.952071	2333.952813	K	A	538	558
PSM	MPPRTPAEASSTGQTGPQSAL	2783	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3170.6	29.19305	3	2258.926571	2258.927995	K	-	238	259
PSM	MPPRTPAEASSTGQTGPQSAL	2784	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3160.5	28.92888	3	2258.921771	2258.927995	K	-	238	259
PSM	TVEVAEGEAVRTPQSVTAK	2785	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3195.3	29.83458	4	2130.962494	2130.959947	R	Q	132	151
PSM	ATSEEDVSIKSPICEK	2786	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3115.4	27.76195	3	1871.820971	1871.822376	K	Q	1606	1622
PSM	QFSQYIK	2787	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4297.2	55.32315	2	975.4083	975.4098	K	N	222	229
PSM	QQPPEPEWIGDGESTSPSDK	2788	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3552.5	39.05122	3	2263.933871	2262.931803	K	V	7	27
PSM	MEVAEPSSPTEEEEEEEEHSAEPRPR	2789	sp|Q9NWV8|BABA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3204.6	30.07938	4	3147.2488	3147.2495	-	T	1	27
PSM	DGFPSGTPALNAK	2790	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3341.4	33.6333	2	1354.594647	1353.596597	K	G	148	161
PSM	CESAFLSK	2791	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3977.3	49.62582	2	1003.3703	1003.3717	K	R	36	44
PSM	ASSEQAEQPSQPSSTPGSENVLPREPLIATAVK	2792	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.3894.5	47.64473	4	3526.6819	3526.6823	M	F	2	35
PSM	EQNSPIYISR	2793	sp|O14910|LIN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3127.4	28.07508	2	1285.569247	1285.570382	K	I	127	137
PSM	DSSFTEVPRSPK	2794	sp|O95425|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3057.6	26.2942	2	1428.625647	1428.628625	R	H	236	248
PSM	KISLDSAQSSRSTSYSPR	2795	sp|Q86WS4|CL040_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	3-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3602.5	40.32195	3	2208.8672	2208.8852	K	P	469	487
PSM	NCREAFTADGDQVFAGRYYSSENTR	2796	sp|Q96SB8|SMC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3353.6	33.95352	3	2993.2453	2993.2394	K	P	632	657
PSM	ASVPREPGGPSPR	2797	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2826.2	20.43257	3	1386.660671	1385.645279	K	V	1052	1065
PSM	GSTIETEQKEDKGEDSEPVTSK	2798	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21	ms_run[1]:scan=1.1.2782.5	19.42998	4	2473.075294	2473.074504	K	A	462	484
PSM	LQAANAEDIKSGK	2799	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2860.2	21.23662	3	1423.675271	1423.670825	K	L	72	85
PSM	VLPGVDALSNI	2800	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4363.2	56.22335	2	1176.578647	1176.579156	K	-	407	418
PSM	TPKTPKGPSSVEDIK	2801	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2916.2	22.63805	4	1662.825694	1662.822968	K	A	234	249
PSM	SHGLEPAAPSPR	2802	sp|Q9ULL5|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2899.3	22.23362	3	1297.582871	1297.581616	R	L	856	868
PSM	HAQDSDPRSPTLGIAR	2803	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3005.2	24.93645	4	1799.829294	1799.831576	K	T	60	76
PSM	LVPVLSAK	2804	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3348.2	33.81002	2	905.495047	905.498721	K	A	270	278
PSM	NIILEEGK	2805	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3106.3	27.5247	2	914.505047	914.507297	K	E	46	54
PSM	SAITPGGLR	2806	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3118.2	27.83282	2	950.456047	950.458647	R	L	417	426
PSM	SSTPLHSPSPIR	2807	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3018.2	25.27327	3	1437.604871	1437.605462	R	V	283	295
PSM	TPRTPRTPQLK	2808	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2791.2	19.5623	3	1453.685471	1453.684381	R	D	782	793
PSM	FANLTPSR	2809	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3124.3	27.99337	2	984.438847	984.442997	K	T	2050	2058
PSM	DYSSGFGGK	2810	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3025.2	25.45535	2	996.357447	996.358992	K	Y	153	162
PSM	AMAPTSPQI	2811	sp|Q9BYD2|RM09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3124.4	27.9967	2	1010.412447	1010.414399	K	-	259	268
PSM	SSLGPVGLDK	2812	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3277.2	31.96467	2	1051.494047	1051.495092	K	M	34	44
PSM	DATLTALDR	2813	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3375.2	34.50538	2	1054.468447	1054.469606	K	G	391	400
PSM	AAGARPLTSPESLSR	2814	sp|P46379|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3113.3	27.70663	3	1591.766471	1591.771936	K	D	1073	1088
PSM	SGLTVPTSPK	2815	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3099.2	27.3433	2	1065.507847	1065.510742	R	G	87	97
PSM	DGGFCEVCK	2816	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2983.2	24.36757	2	1070.413647	1070.416116	K	K	405	414
PSM	HVTLPSSPR	2817	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2902.3	22.32035	2	1072.505647	1072.506660	R	S	2713	2722
PSM	DLSLEEIQK	2818	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3421.2	35.70341	2	1073.558647	1073.560455	K	K	44	53
PSM	NAGFTPQER	2819	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2933.3	23.0784	2	1098.455447	1098.449539	K	Q	229	238
PSM	VSGAGFSPSSK	2820	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2910.3	22.49008	2	1102.468847	1102.469606	R	M	1132	1143
PSM	DAQRLSPIPEEVPK	2821	sp|Q96T23|RSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	33.67885	3	1657.804871	1657.807653	K	S	599	613
PSM	MSGFIYQGK	2822	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3433.2	36.01797	2	1109.458447	1109.461683	R	I	487	496
PSM	HGGPKDEERHVGDLGNVTADK	2823	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2946.4	23.41577	4	2230.072094	2230.072672	K	D	72	93
PSM	WDQTADQTPGATPK	2824	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2958.4	23.72565	3	1674.630971	1674.632799	R	K	200	214
PSM	KVEPVPVTKQPTPPSEAAASK	2825	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2991.2	24.57513	4	2240.144094	2240.145365	K	K	142	163
PSM	LGIHEDSTNR	2826	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2775.2	19.24187	3	1140.552971	1140.552350	K	R	439	449
PSM	NQIHVKSPPREGSQGELTPANSQSR	2827	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2945.4	23.3898	5	2876.297118	2876.296765	R	M	462	487
PSM	TPKTPKGPSSVEDIK	2828	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3001.5	24.84278	3	1742.7896	1742.7888	K	A	234	249
PSM	GASLKSPLPSQ	2829	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3121.4	27.9182	2	1163.553847	1163.558755	K	-	113	124
PSM	DNSTMGYMAAK	2830	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3063.2	26.42968	2	1187.495047	1187.495094	R	K	621	632
PSM	ERKLECLPPEPSPDDPESVK	2831	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3232.3	30.80305	4	2401.086494	2401.087258	K	I	344	364
PSM	EAALPPVSPLK	2832	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3432.4	35.99855	2	1200.614047	1200.615542	R	A	1224	1235
PSM	SNSPLPVPPSK	2833	sp|Q13247|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3031.3	25.61518	2	1201.570447	1201.574405	R	A	301	312
PSM	RELHGQNPVVTPCNK	2834	sp|Q16630|CPSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2802.4	19.83893	3	1827.846671	1827.845118	K	Q	147	162
PSM	SISSPSVSSETMDKPVDLSTRK	2835	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3131.3	28.17612	4	2446.126094	2446.129851	K	E	2802	2824
PSM	NHSGSRTPPVALNSSR	2836	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2886.4	21.90167	3	1838.781371	1838.782591	R	M	2098	2114
PSM	AGGPTTPLSPTR	2837	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2996.3	24.70992	2	1233.574847	1233.575468	R	L	15	27
PSM	DETVSDCSPHIANIGR	2838	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3263.3	31.61327	3	1849.765871	1849.766593	K	L	200	216
PSM	EEGSPLELER	2839	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3238.4	30.96348	2	1237.521647	1237.522763	R	L	604	614
PSM	VIGSGCNLDSAR	2840	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2960.5	23.78067	2	1247.590647	1247.592835	R	F	158	170
PSM	YNDWSDDDDDSNESK	2841	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3029.3	25.563	3	1883.597171	1883.600692	R	S	57	72
PSM	EITALAPSTMK	2842	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3098.3	27.32223	2	1256.568047	1256.572356	K	I	318	329
PSM	SRLTPVSPESSSTEEK	2843	sp|Q13501|SQSTM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2925.6	22.8786	3	1892.783471	1892.780585	R	S	266	282
PSM	DNSTMGYMMAK	2844	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:35	ms_run[1]:scan=1.1.3079.3	26.84578	2	1263.485847	1263.493380	R	K	486	497
PSM	SQDATFSPGSEQAEKSPGPIVSR	2845	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3303.2	32.63718	4	2534.072894	2534.072745	R	T	329	352
PSM	EAAENSLVAYK	2846	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3144.3	28.51307	2	1273.552647	1273.559149	K	A	143	154
PSM	YVECSALTQK	2847	sp|P60953|CDC42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3103.3	27.4466	2	1277.541847	1277.536305	K	G	154	164
PSM	SSPNPFVGSPPK	2848	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3252.5	31.33195	2	1292.578647	1292.580219	K	G	393	405
PSM	AVLIDKDQSPK	2849	sp|Q6NVY1|HIBCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2871.2	21.51067	3	1292.637971	1292.637734	R	W	348	359
PSM	EGNTTEDDFPSSPGNGNK	2850	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3009.4	25.04642	3	1944.738671	1944.737460	R	S	295	313
PSM	SVNGGPGSPDLAR	2851	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2942.3	23.30848	2	1305.576247	1305.571445	R	H	982	995
PSM	AGEAPTENPAPPTQQSSAE	2852	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2937.4	23.18825	3	1960.803071	1960.805146	K	-	354	373
PSM	YSQVLANGLDNK	2853	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3185.4	29.5767	2	1320.664447	1320.667380	K	L	95	107
PSM	NLSPGAVESDVR	2854	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3399.5	35.1362	2	1322.585647	1322.586761	K	G	171	183
PSM	QEMQEVQSSRSGRGGNFGFGDSR	2855	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3281.4	32.07293	4	2675.058894	2675.058508	R	G	191	214
PSM	NGNTNSLNLSSPNPMENK	2856	sp|Q9UPQ9|TNR6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3388.4	34.84773	3	2009.850671	2009.851385	K	G	375	393
PSM	EQNPPPARSEDMPFSPK	2857	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3211.4	30.2555	3	2005.856171	2005.860493	K	A	251	268
PSM	RRSPSPYYSR	2858	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2756.4	18.88585	3	1347.610871	1347.608499	R	Y	258	268
PSM	AVAGNISDPGLQK	2859	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3100.3	27.37127	2	1348.627847	1348.638796	K	S	803	816
PSM	TPQEWAPQTAR	2860	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3099.4	27.34997	2	1363.587847	1363.592180	K	I	286	297
PSM	KPVTVSPTTPTSPTEGEAS	2861	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3076.5	26.77433	3	2044.864571	2044.864315	R	-	505	524
PSM	ALPSLNTGSSSPR	2862	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3242.5	31.07115	2	1365.620847	1365.628960	R	G	317	330
PSM	SGTPPRQGSITSPQANEQSVTPQRR	2863	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2970.6	24.04337	4	2758.313294	2758.314784	K	S	846	871
PSM	SGSLDSELSVSPK	2864	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3347.4	33.79035	2	1384.610047	1384.612307	K	R	2718	2731
PSM	EAVREGSPANWK	2865	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2965.4	23.90732	3	1422.626171	1422.629294	K	R	227	239
PSM	GGGGNFGPGPGSNFR	2866	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3274.4	31.89682	2	1456.590447	1456.588492	R	G	214	229
PSM	NPSDSAVHSPFTK	2867	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2959.2	23.74458	3	1465.621871	1465.623874	K	R	408	421
PSM	SKPIPIMPASPQK	2868	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3206.4	30.12487	2	1472.743447	1472.746238	K	G	607	620
PSM	SVDPDSPAEASGLR	2869	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3134.5	28.26108	2	1479.620647	1479.624268	R	A	181	195
PSM	RRGNDPLTSSPGR	2870	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2786.2	19.51112	3	1491.692471	1491.694354	R	S	18	31
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	2871	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3386.5	34.80015	4	2991.330094	2991.328110	R	V	221	251
PSM	AAVVTSPPPTTAPHK	2872	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2873.3	21.56862	3	1552.766171	1552.765059	R	E	7	22
PSM	TSADAQEPASPVVSPQQSPPTSPHTWRK	2873	sp|Q96D71|REPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3212.5	30.28518	4	3145.386494	3145.390725	R	H	153	181
PSM	ELTSTCSPIISKPK	2874	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3096.2	27.27038	3	1639.788671	1639.789226	K	P	774	788
PSM	GGKPEPPAMPQPVPTA	2875	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3319.2	33.05243	3	1652.772071	1652.763345	K	-	228	244
PSM	GNDTPLALESTNTEK	2876	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3227.2	30.66807	3	1668.739571	1668.724376	K	E	1719	1734
PSM	WLKSPTTPIDPEK	2877	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3423.2	35.75512	3	1670.735471	1670.735807	K	Q	859	872
PSM	AGGGPTLQCPPPSSPEK	2878	sp|Q96N66|MBOA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3010.4	25.07253	3	1758.760871	1758.764802	R	A	272	289
PSM	IQAAASTPTNATAASDANTGDRGQTNNAASASASNST	2879	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2961.6	23.80978	4	3544.531294	3544.529934	R	-	384	421
PSM	AGGSPAPGPETPAISPSK	2880	sp|P33316|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3035.5	25.72583	2	1779.743647	1779.748163	K	R	85	103
PSM	IISTTASKTETPIVSK	2881	sp|O95292|VAPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3063.3	26.43302	3	1834.872671	1834.873029	K	S	140	156
PSM	LEEPPELNRQSPNPR	2882	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3133.3	28.22793	3	1854.859271	1854.862542	K	R	165	180
PSM	SGPKPFSAPKPQTSPSPK	2883	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2977.2	24.21223	4	1996.907294	1996.906060	R	R	295	313
PSM	SHSGVSENDSRPASPSAESDHESERGSDNEGSGQGSGNESEPEGSNNEASDRGSEHGSDDSD	2884	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2761.3	18.96193	6	6367.42634128698	6367.420414258732	R	-	1112	1174
PSM	DGLNQTTIPVSPPSTTKPSR	2885	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3394.4	35.00303	3	2255.021171	2255.023609	K	A	573	593
PSM	EEDCHSPTSKPPKPDQPLK	2886	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2781.4	19.39838	4	2269.011694	2269.008614	K	V	454	473
PSM	IYQEEEMPESGAGSEFNRK	2887	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3263.4	31.6166	3	2279.934671	2279.940594	K	L	56	75
PSM	DTSSITSCGDGNVVKQEQLSPK	2888	sp|Q9Y6Q9|NCOA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3215.5	30.36358	3	2429.076071	2429.078150	K	K	709	731
PSM	DISLSDYK	2889	sp|Q06830|PRDX1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3502.2	37.7342	2	1019.418647	1019.421258	K	G	28	36
PSM	DYEEVGADSADGEDEGEEY	2890	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3437.6	36.13268	2	2077.735447	2077.739614	K	-	431	450
PSM	DVIEEYFK	2891	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3786.2	44.90497	2	1041.497247	1041.501878	K	C	122	130
PSM	GLATFCLDK	2892	sp|O00264|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3688.3	42.38755	2	1103.467847	1103.472248	R	E	124	133
PSM	SQPEPSPVLSQLSQR	2893	sp|Q5T6F2|UBAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3508.3	37.89478	3	1731.823271	1731.819280	K	Q	427	442
PSM	ESAFEFLSSA	2894	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4944.2	61.909	2	1166.452647	1166.453287	K	-	325	335
PSM	DAGTIAGLNVLR	2895	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3730.2	43.47965	2	1198.666047	1198.666986	K	I	160	172
PSM	VLENAEGARTTPSVVAFTADGER	2896	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3535.3	38.59929	4	2469.1564941913202	2469.1536973271996	K	L	77	100
PSM	DYPDFSPSVDAEAIQK	2897	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3820.3	45.79156	3	1860.782771	1860.781891	R	A	14	30
PSM	APSEEDSLSSVPISPYKDEPWK	2898	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3789.3	44.98588	4	2540.136094	2540.135982	K	Y	36	58
PSM	TMIISPERLDPFADGGKTPDPK	2899	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4133.2	52.89435	4	2544.137294	2544.137259	R	M	125	147
PSM	SQIFSTASDNQPTVTIK	2900	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3532.3	38.52072	3	1915.892471	1915.892839	K	V	448	465
PSM	IETVNESWNALATPSDK	2901	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3719.2	43.19267	3	1953.864071	1953.872103	K	L	616	633
PSM	VWSPLVTEEGK	2902	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3702.3	42.75222	2	1323.606047	1323.611184	K	R	88	99
PSM	ETYTDDLPPPPVPPPAIKSPTAQSK	2903	sp|Q9Y6N7|ROBO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3628.3	40.98753	4	2725.323694	2725.325180	R	T	1474	1499
PSM	FNVWDTAGQEK	2904	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3513.5	38.03273	2	1373.564847	1373.565297	K	F	61	72
PSM	TLEEDEEELFK	2905	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3784.3	44.85638	2	1380.629647	1380.629657	K	M	40	51
PSM	CTNSEVTVQPSPYLSYR	2906	sp|O75794|CD123_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3562.4	39.30688	3	2079.902171	2079.897273	R	L	289	306
PSM	ESVPEFPLSPPK	2907	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3782.2	44.80165	2	1405.650647	1405.653049	K	K	30	42
PSM	AAPEASSPPASPLQHLLPGK	2908	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3812.4	45.58745	3	2126.976671	2126.980288	K	A	686	706
PSM	TVDSQGPTPVCTPTFLER	2909	sp|Q9BYG3|MK67I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3789.5	44.99255	3	2163.896471	2163.894904	K	R	227	245
PSM	LNSPTDSTPALLSATVTPQK	2910	sp|Q9H4X1|RGCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3780.5	44.76112	3	2199.997271	2200.006562	K	A	95	115
PSM	DGQAMLWDLNEGK	2911	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3850.5	46.5447	2	1475.661047	1475.671479	K	H	213	226
PSM	STETSDFENIESPLNERDSSASVDNR	2912	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3567.3	39.42735	4	2978.239294	2978.241463	K	E	899	925
PSM	DSAGQDINLNSPNK	2913	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3557.5	39.18128	2	1551.6537	1551.6561	M	G	2	16
PSM	EAAFGGGLLSPGPEAT	2914	sp|Q01201|RELB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4084.2	51.99803	2	1552.680847	1552.681055	R	-	564	580
PSM	EAGMYHCVCCDSPLFSSEK	2915	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3515.6	38.08805	3	2355.861071	2355.866977	K	K	84	103
PSM	DMSPLSETEMALGK	2916	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4083.2	51.97215	2	1587.655247	1587.656162	K	D	505	519
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQRK	2917	sp|O00299|CLIC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3829.3	46.0253	4	3199.448094	3199.444580	K	F	139	167
PSM	DTCYSPKPSVYLSTPSSASK	2918	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,3-UNIMOD:4,13-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3531.4	38.49783	3	2413.920671	2413.919144	K	A	538	558
PSM	INDFVLSPGPQPYK	2919	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3746.2	43.89197	3	1653.792971	1653.780375	K	V	170	184
PSM	ELGGLEGDPSPEEDEGIQKASPLTHSPPDEL	2920	sp|Q9BT09|CNPY3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3810.6	45.54215	4	3322.474494	3322.476608	K	-	248	279
PSM	NGYELSPTAAANFTR	2921	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3689.3	42.41368	2	1690.734447	1690.735216	R	R	71	86
PSM	RASGQAFELILSPR	2922	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3954.2	49.09948	3	1703.780471	1703.779738	K	S	14	28
PSM	ADPHLEFQQFPQSP	2923	sp|Q96NT5|PCFT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3782.5	44.81498	2	1719.723047	1719.729402	K	-	446	460
PSM	SRSAMDSPVPASMFAPEPSSPGAAR	2924	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3743.5	43.8237	3	2662.098371	2662.095805	R	A	6	31
PSM	SMAASGNLGHTPFVDEL	2925	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3970.2	49.44438	3	1824.774971	1824.775366	K	-	437	454
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	2926	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3500.5	37.69147	3	2845.284671	2845.280749	R	R	67	93
PSM	EVDGLLTSEPMGSPVSSK	2927	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3696.3	42.59545	3	1911.855071	1911.853676	K	T	582	600
PSM	EVDGLLTSEPMGSPVSSK	2928	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3704.3	42.80452	3	1911.855071	1911.853676	K	T	582	600
PSM	YVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQR	2929	sp|Q4V326|GAG2E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3903.5	47.86855	4	3920.734494	3920.727437	R	Q	17	51
PSM	CSPTVAFVEFPSSPQLK	2930	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4061.2	51.50163	3	1972.899971	1972.900567	R	N	669	686
PSM	SCGSSTPDEFPTDIPGTK	2931	sp|P41091|IF2G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3558.6	39.2105	2	1974.787047	1974.791804	R	G	104	122
PSM	SVPTSTVFYPSDGVATEK	2932	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3746.3	43.89863	3	2043.845771	2043.847936	R	A	439	457
PSM	AAPEASSPPASPLQHLLPGK	2933	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3667.3	41.8523	3	2047.013471	2047.013957	K	A	686	706
PSM	EMFPYEASTPTGISASCR	2934	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3755.2	44.12718	3	2082.842771	2082.842794	K	R	347	365
PSM	AAPEASSPPASPLQHLLPGK	2935	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3862.3	46.84448	3	2126.976671	2126.980288	K	A	686	706
PSM	SATLSSTESTASEMQEEMK	2936	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3635.5	41.08953	3	2125.854671	2125.843247	K	G	640	659
PSM	RGTGQSDDSDIWDDTALIK	2937	sp|Q16637|SMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3851.3	46.56267	3	2171.933771	2171.937223	R	A	23	42
PSM	DNLTLWTSDQQDDDGGEGNN	2938	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3830.2	46.04777	3	2192.871071	2192.873028	R	-	228	248
PSM	LGLQEGSNNSSPVDFVNNKR	2939	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3480.3	37.17698	3	2254.0202	2254.0372	K	T	56	76
PSM	DDTDDEIAKYDGKWEVEEMK	2940	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3690.2	42.43577	4	2415.044494	2415.042402	K	E	91	111
PSM	APVPEPGLDLSLSPRPDSPQPR	2941	sp|Q8TAP8|PPR35_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3828.5	46.00947	3	2484.143771	2484.145122	R	H	35	57
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRKAER	2942	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3942.4	48.81998	4	3465.547294	3465.549076	R	T	139	169
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	2943	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	33-UNIMOD:21	ms_run[1]:scan=1.1.3594.6	40.11593	4	3596.726094	3596.728741	K	-	244	278
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	2944	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	33-UNIMOD:21	ms_run[1]:scan=1.1.3596.5	40.16463	4	3596.726094	3596.728741	K	-	244	278
PSM	HCGLGFSEVEDHDGEGDVAGDDDDDDDDSPDPESPDDSESDSESEKEESAEELQAAEHPDEVEDPK	2945	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	2-UNIMOD:4,34-UNIMOD:21	ms_run[1]:scan=1.1.3687.6	42.37133	6	7236.7118	7236.7042	R	N	99	165
PSM	VSMPDVELNLKSPK	2946	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3311.2	32.84417	3	1651.787171	1651.789226	K	V	3415	3429
PSM	TIAPALVSK	2947	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3168.3	29.13073	2	978.5117	978.5146	K	K	72	81
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2948	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:35,32-UNIMOD:21	ms_run[1]:scan=1.1.4011.2	50.39732	4	3442.451694	3441.453053	K	-	610	647
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	2949	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,18-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3519.4	38.18348	4	3013.330894	3013.323630	K	K	62	95
PSM	SSPNPFVGSPPK	2950	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3398.4	35.10703	2	1372.543247	1372.546550	K	G	393	405
PSM	MDSAGQDINLNSPNK	2951	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3255.3	31.40395	3	1740.6992	1740.7021	-	G	1	16
PSM	DNNQFASASLDR	2952	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3162.5	28.9806	2	1337.604647	1336.600757	K	T	154	166
PSM	IMNTFSVVPSPK	2953	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3526.4	38.36648	2	1415.651847	1414.656755	R	V	163	175
PSM	VQISPDSGGLPER	2954	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3243.5	31.09718	2	1433.649447	1433.655175	K	S	178	191
PSM	EAALPPVSPLK	2955	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3450.3	36.39882	2	1201.618647	1200.615542	R	A	1224	1235
PSM	IDEMPEAAVKSTANK	2956	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2919.2	22.71278	3	1698.752171	1698.753568	R	Y	30	45
PSM	AMLDSGIYPPGSPGK	2957	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3343.5	33.68885	2	1584.688247	1584.689512	R	-	122	137
PSM	QSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDR	2958	sp|Q92734|TFG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,6-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=1.1.3825.3	45.92535	6	5109.3432	5109.3272	K	S	156	204
PSM	DTGKPKGEATVSFDDPPSAK	2959	sp|Q92804|RBP56_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3066.3	26.50895	4	2125.957694	2125.956896	K	A	278	298
PSM	IPGSPPESMGR	2960	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3069.4	26.59002	2	1206.508447	1206.510425	K	G	58	69
PSM	FLMECRNSPVTK	2961	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3158.3	28.86917	3	1560.680171	1560.682986	K	T	58	70
PSM	AGGSPAPGPETPAISPSK	2962	sp|P33316|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3035.3	25.71917	3	1779.744371	1779.748163	K	R	85	103
PSM	AENVVEPGPPSAK	2963	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3265.4	31.66865	2	1415.6298	1415.6329	M	R	2	15
PSM	TAHNSEADLEESFNEHELEPSSPK	2964	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3485.2	37.30378	4	2777.169294	2776.150129	K	S	134	158
PSM	MNLLPNIESPVTRQEK	2965	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.3891.2	47.55362	3	2005.9520	2005.9539	-	M	1	17
PSM	AAGGDHGSPDSYRSPLASR	2966	sp|P30566|PUR8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3164.4	29.02988	3	2021.8564	2021.8587	M	Y	2	21
PSM	NSSTPGLQVPVSPTVPIQNQK	2967	sp|Q03164|KMT2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3725.5	43.35957	3	2350.097471	2350.097109	R	Y	3025	3046
PSM	AQESPKNSAAEIPVTSNGEVDDSREHSFNR	2968	sp|P53367|ARFP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3304.6	32.67655	4	3392.4908	3392.4901	M	D	2	32
PSM	TLRLNQPGTPTRTAV	2969	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3231.4	30.77973	3	1783.836071	1783.838315	K	-	386	401
PSM	KVPYLASSPSTSDGGTDSPGTASPSPTK	2970	sp|Q9Y597|KCTD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	25-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.3300.6	32.57235	3	2851.213871	2851.220197	K	T	769	797
PSM	QLLKSPELPSPQAEK	2971	sp|Q9H078|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3425.2	35.80758	3	1823.844071	1823.847148	K	R	659	674
PSM	SNTEPQSPPIASPK	2972	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2934.4	23.10418	3	1612.6792	1611.6582	K	A	66	80
PSM	QVTDAETKPKSPCT	2973	sp|O43684|BUB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2681.3	17.96278	3	1640.710871	1640.711703	R	-	315	329
PSM	LMYEHNLQRTACNMTYGSFGGVK	2974	sp|Q3SYG4|PTHB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	12-UNIMOD:4	ms_run[1]:scan=1.1.3589.2	39.97658	4	2676.2276	2676.2242	K	G	125	148
PSM	SAPASPTHPGLMSPR	2975	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3142.2	28.45748	3	1665.679571	1664.678309	R	S	416	431
PSM	RGGSGSHNWGTVKDELTESPK	2976	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3165.2	29.0489	4	2321.042494	2321.043754	K	Y	216	237
PSM	LYGSAGPPPTGEEDTAEKDEL	2977	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3608.5	40.4789	3	2335.924871	2334.918201	K	-	634	655
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	2978	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3881.5	47.30803	3	3013.340171	3013.339266	K	V	8	36