MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000150 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617204740166495^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_13_K2_3.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	61.0	null	2-UNIMOD:1,19-UNIMOD:21,479-UNIMOD:21,755-UNIMOD:21,596-UNIMOD:21,628-UNIMOD:4,14-UNIMOD:21,757-UNIMOD:21,4-UNIMOD:21,17-UNIMOD:21	0.12	61.0	10	4	2
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	2-UNIMOD:1,15-UNIMOD:21	0.15	47.0	6	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	118-UNIMOD:21,120-UNIMOD:21,101-UNIMOD:21,27-UNIMOD:21,26-UNIMOD:21	0.23	46.0	12	4	2
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	721-UNIMOD:21,727-UNIMOD:21,723-UNIMOD:21	0.04	46.0	4	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	629-UNIMOD:21,637-UNIMOD:21,652-UNIMOD:21,623-UNIMOD:21,404-UNIMOD:21	0.06	44.0	6	3	2
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	373-UNIMOD:4,377-UNIMOD:21,386-UNIMOD:21,385-UNIMOD:21,173-UNIMOD:21,179-UNIMOD:4,289-UNIMOD:21,285-UNIMOD:21,64-UNIMOD:21,182-UNIMOD:21,284-UNIMOD:21	0.16	44.0	27	5	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	743-UNIMOD:21,758-UNIMOD:4,751-UNIMOD:21	0.04	43.0	8	1	0
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	202-UNIMOD:21,204-UNIMOD:21,198-UNIMOD:21,286-UNIMOD:21,312-UNIMOD:21,17-UNIMOD:21,30-UNIMOD:35,368-UNIMOD:21	0.18	42.0	21	5	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	28-UNIMOD:21	0.16	42.0	6	2	0
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	367-UNIMOD:21,298-UNIMOD:21,289-UNIMOD:21,295-UNIMOD:35,77-UNIMOD:21,306-UNIMOD:35,119-UNIMOD:21	0.17	41.0	8	4	2
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	285-UNIMOD:21,286-UNIMOD:21	0.07	40.0	5	2	0
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	11-UNIMOD:4,25-UNIMOD:4,29-UNIMOD:21,869-UNIMOD:21	0.05	40.0	2	2	2
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	232-UNIMOD:21,230-UNIMOD:21,241-UNIMOD:21,231-UNIMOD:21	0.04	40.0	4	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	712-UNIMOD:21,716-UNIMOD:4,691-UNIMOD:21,695-UNIMOD:21,1031-UNIMOD:21,1032-UNIMOD:21,1073-UNIMOD:21,435-UNIMOD:21,1715-UNIMOD:21,1290-UNIMOD:35,1296-UNIMOD:4,1297-UNIMOD:21,669-UNIMOD:4,672-UNIMOD:21,1324-UNIMOD:4,1328-UNIMOD:21,1138-UNIMOD:21,710-UNIMOD:21,715-UNIMOD:21	0.10	40.0	20	11	8
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	79-UNIMOD:4,83-UNIMOD:21,117-UNIMOD:21,108-UNIMOD:21,251-UNIMOD:21,255-UNIMOD:4,210-UNIMOD:21,213-UNIMOD:21,215-UNIMOD:21,113-UNIMOD:21,120-UNIMOD:35,58-UNIMOD:21,249-UNIMOD:21,254-UNIMOD:21	0.34	40.0	17	6	2
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	270-UNIMOD:4,272-UNIMOD:21,274-UNIMOD:4	0.08	40.0	6	1	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	147-UNIMOD:21,162-UNIMOD:21	0.10	40.0	3	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	115-UNIMOD:21,447-UNIMOD:4,455-UNIMOD:21,225-UNIMOD:21,231-UNIMOD:21,113-UNIMOD:21,164-UNIMOD:21,175-UNIMOD:21,70-UNIMOD:21,447-UNIMOD:385,61-UNIMOD:21,114-UNIMOD:21,159-UNIMOD:21,173-UNIMOD:21,163-UNIMOD:21,232-UNIMOD:21	0.19	39.0	40	9	2
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	160-UNIMOD:21,155-UNIMOD:21,159-UNIMOD:21,162-UNIMOD:21,145-UNIMOD:28	0.07	39.0	16	3	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	641-UNIMOD:21,668-UNIMOD:21	0.04	39.0	3	2	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35,106-UNIMOD:21	0.13	39.0	13	3	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	67-UNIMOD:21,60-UNIMOD:21,104-UNIMOD:21	0.10	38.0	7	3	2
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	1183-UNIMOD:21	0.03	38.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	263-UNIMOD:21,26-UNIMOD:21,229-UNIMOD:21,205-UNIMOD:21,19-UNIMOD:21,14-UNIMOD:21,40-UNIMOD:21,41-UNIMOD:21,336-UNIMOD:21,337-UNIMOD:4,339-UNIMOD:4,72-UNIMOD:21,79-UNIMOD:21,44-UNIMOD:21	0.31	38.0	22	11	5
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	47-UNIMOD:21	0.18	38.0	10	3	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	332-UNIMOD:21,405-UNIMOD:21,417-UNIMOD:21,418-UNIMOD:21,401-UNIMOD:21,331-UNIMOD:21,411-UNIMOD:21,172-UNIMOD:21,155-UNIMOD:21,209-UNIMOD:21	0.17	37.0	13	5	3
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	643-UNIMOD:21,85-UNIMOD:21,460-UNIMOD:21,86-UNIMOD:21,637-UNIMOD:21,455-UNIMOD:21,91-UNIMOD:21,65-UNIMOD:21,69-UNIMOD:21	0.13	37.0	16	6	2
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	197-UNIMOD:21,183-UNIMOD:21	0.06	37.0	4	1	0
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	157-UNIMOD:21	0.09	36.0	2	2	2
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	74-UNIMOD:21	0.08	36.0	8	3	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	356-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	227-UNIMOD:21,638-UNIMOD:21,394-UNIMOD:21,401-UNIMOD:21,675-UNIMOD:21,676-UNIMOD:21,680-UNIMOD:21,219-UNIMOD:35	0.10	36.0	12	4	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	144-UNIMOD:21,355-UNIMOD:21	0.10	36.0	3	2	1
PRT	sp|P48960|CD97_HUMAN	CD97 antigen OS=Homo sapiens OX=9606 GN=CD97 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	44-UNIMOD:4,57-UNIMOD:21,62-UNIMOD:4,68-UNIMOD:4,70-UNIMOD:21,61-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	31-UNIMOD:21,96-UNIMOD:21,103-UNIMOD:21	0.14	36.0	3	2	1
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	607-UNIMOD:21,402-UNIMOD:21,599-UNIMOD:21,296-UNIMOD:21,401-UNIMOD:21,406-UNIMOD:21	0.09	36.0	9	4	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1129-UNIMOD:4,1131-UNIMOD:21,1139-UNIMOD:21,2221-UNIMOD:4,2223-UNIMOD:21,2231-UNIMOD:21,1801-UNIMOD:21,1923-UNIMOD:21	0.02	35.0	7	4	2
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	210-UNIMOD:21,211-UNIMOD:21	0.07	35.0	8	2	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	62-UNIMOD:21	0.05	35.0	2	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	235-UNIMOD:35,148-UNIMOD:21	0.17	35.0	7	3	1
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	1-UNIMOD:1,12-UNIMOD:21,1-UNIMOD:35,104-UNIMOD:21	0.15	35.0	7	3	2
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21,1-UNIMOD:35,450-UNIMOD:21	0.04	35.0	15	2	1
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	363-UNIMOD:21,367-UNIMOD:21,368-UNIMOD:21	0.04	34.0	5	1	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	36-UNIMOD:21,53-UNIMOD:21,39-UNIMOD:21	0.43	34.0	5	3	2
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	2410-UNIMOD:21	0.00	34.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	88-UNIMOD:21	0.06	34.0	2	1	0
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	583-UNIMOD:21,587-UNIMOD:21	0.03	34.0	3	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	79-UNIMOD:21,64-UNIMOD:21	0.40	34.0	4	2	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	280-UNIMOD:21,278-UNIMOD:35,507-UNIMOD:21,514-UNIMOD:35	0.03	34.0	7	2	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	122-UNIMOD:21	0.04	34.0	8	3	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	612-UNIMOD:21,616-UNIMOD:21	0.03	34.0	5	1	0
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	51-UNIMOD:21	0.05	34.0	4	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	692-UNIMOD:21,696-UNIMOD:21,691-UNIMOD:21	0.03	34.0	8	1	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	62-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,442-UNIMOD:21,67-UNIMOD:21	0.10	34.0	9	2	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	472-UNIMOD:21,428-UNIMOD:21,425-UNIMOD:35,427-UNIMOD:21	0.09	34.0	4	2	0
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35	0.05	34.0	4	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	3-UNIMOD:4,11-UNIMOD:21,7-UNIMOD:21	0.09	33.0	4	1	0
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	623-UNIMOD:21,1027-UNIMOD:4,1028-UNIMOD:21,1034-UNIMOD:21,1023-UNIMOD:21,612-UNIMOD:21,608-UNIMOD:21	0.03	33.0	9	4	1
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	283-UNIMOD:21,286-UNIMOD:21,1395-UNIMOD:21,1399-UNIMOD:4,1407-UNIMOD:4,285-UNIMOD:21,640-UNIMOD:21,1391-UNIMOD:21,732-UNIMOD:21	0.06	33.0	16	5	2
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	14-UNIMOD:21,211-UNIMOD:21	0.10	33.0	5	2	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	38-UNIMOD:21	0.15	33.0	10	2	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	2319-UNIMOD:21,2327-UNIMOD:21,1946-UNIMOD:21,1453-UNIMOD:385,1453-UNIMOD:4,1459-UNIMOD:21,1533-UNIMOD:21	0.03	33.0	8	5	3
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,13-UNIMOD:21,10-UNIMOD:35,27-UNIMOD:21	0.03	33.0	7	3	1
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35	0.07	33.0	3	1	0
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	495-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	199-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	9-UNIMOD:21,51-UNIMOD:21	0.06	32.0	2	2	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	443-UNIMOD:21,434-UNIMOD:35,456-UNIMOD:21,437-UNIMOD:21,131-UNIMOD:28,136-UNIMOD:21,141-UNIMOD:21,120-UNIMOD:21	0.18	32.0	14	5	3
PRT	sp|Q9NZT2|OGFR_HUMAN	Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	403-UNIMOD:21,378-UNIMOD:21,674-UNIMOD:21,484-UNIMOD:21	0.14	32.0	6	4	2
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	139-UNIMOD:21,142-UNIMOD:21,141-UNIMOD:21	0.10	32.0	5	2	1
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	426-UNIMOD:21,432-UNIMOD:21,117-UNIMOD:21	0.05	32.0	2	2	2
PRT	sp|P32004|L1CAM_HUMAN	Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1248-UNIMOD:21	0.02	32.0	3	1	0
PRT	sp|Q13409-2|DC1I2_HUMAN	Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	67-UNIMOD:35,73-UNIMOD:21,81-UNIMOD:21,80-UNIMOD:35,83-UNIMOD:21	0.04	32.0	3	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	445-UNIMOD:21,450-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	332-UNIMOD:21,335-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	287-UNIMOD:21,295-UNIMOD:21,548-UNIMOD:21,595-UNIMOD:21,439-UNIMOD:21	0.09	32.0	8	5	4
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	2-UNIMOD:1,8-UNIMOD:21,80-UNIMOD:21,82-UNIMOD:21,302-UNIMOD:21	0.09	32.0	7	3	0
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,14-UNIMOD:21,6-UNIMOD:21,1-UNIMOD:1,1-UNIMOD:35	0.09	32.0	6	2	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	765-UNIMOD:21,761-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,13-UNIMOD:21,14-UNIMOD:21	0.04	31.0	5	2	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	31.0	null	2272-UNIMOD:21,2335-UNIMOD:21,1318-UNIMOD:21,1329-UNIMOD:21,424-UNIMOD:21,2343-UNIMOD:21,440-UNIMOD:21,1043-UNIMOD:21,872-UNIMOD:4,876-UNIMOD:21,2365-UNIMOD:21,534-UNIMOD:21,536-UNIMOD:21,2102-UNIMOD:21,2104-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,1003-UNIMOD:21,2694-UNIMOD:21	0.08	31.0	19	14	10
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	426-UNIMOD:21	0.04	31.0	3	1	0
PRT	sp|Q92879|CELF1_HUMAN	CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	177-UNIMOD:4,179-UNIMOD:21,168-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	145-UNIMOD:21,139-UNIMOD:21,136-UNIMOD:21,303-UNIMOD:21	0.14	31.0	15	4	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	120-UNIMOD:21,134-UNIMOD:4,187-UNIMOD:21,174-UNIMOD:21,180-UNIMOD:21	0.38	31.0	5	2	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	394-UNIMOD:21,367-UNIMOD:4,376-UNIMOD:21,379-UNIMOD:4,380-UNIMOD:4,415-UNIMOD:21,393-UNIMOD:21	0.12	31.0	5	3	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	79-UNIMOD:21,64-UNIMOD:21,53-UNIMOD:21,76-UNIMOD:21	0.46	31.0	16	7	2
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	3	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	237-UNIMOD:4,24-UNIMOD:21,25-UNIMOD:4	0.17	31.0	3	2	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	259-UNIMOD:21,198-UNIMOD:21,193-UNIMOD:35,341-UNIMOD:21,199-UNIMOD:21,201-UNIMOD:21	0.24	31.0	6	4	2
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,15-UNIMOD:21	0.07	31.0	3	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	104-UNIMOD:21,107-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	214-UNIMOD:21,204-UNIMOD:21,138-UNIMOD:35	0.18	30.0	10	4	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	65-UNIMOD:21	0.13	30.0	4	3	2
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	9-UNIMOD:21,7-UNIMOD:21	0.17	30.0	6	2	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	142-UNIMOD:21	0.10	30.0	2	1	0
PRT	sp|P55327|TPD52_HUMAN	Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	171-UNIMOD:21,173-UNIMOD:21	0.06	30.0	2	1	0
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	575-UNIMOD:21,210-UNIMOD:21,216-UNIMOD:4	0.06	30.0	5	3	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	37-UNIMOD:21,139-UNIMOD:21,149-UNIMOD:21,32-UNIMOD:21	0.09	30.0	5	2	1
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:21	0.18	30.0	3	2	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	621-UNIMOD:21,626-UNIMOD:21	0.03	30.0	5	1	0
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	65-UNIMOD:21,68-UNIMOD:21	0.02	30.0	4	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	16-UNIMOD:21	0.05	30.0	3	2	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	985-UNIMOD:4,989-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9C0E8|LNP_HUMAN	Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	182-UNIMOD:21,194-UNIMOD:21,179-UNIMOD:21,177-UNIMOD:21	0.06	30.0	6	1	0
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	172-UNIMOD:21,168-UNIMOD:21,164-UNIMOD:35,166-UNIMOD:21	0.03	30.0	11	1	0
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	242-UNIMOD:21,249-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	130-UNIMOD:21,158-UNIMOD:21	0.15	30.0	2	2	2
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	272-UNIMOD:21,274-UNIMOD:4,277-UNIMOD:4,305-UNIMOD:21,249-UNIMOD:4,250-UNIMOD:21,251-UNIMOD:4	0.13	30.0	4	3	2
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	990-UNIMOD:21,991-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	190-UNIMOD:21,193-UNIMOD:21	0.05	30.0	9	2	0
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	779-UNIMOD:21,778-UNIMOD:21,1251-UNIMOD:21,1267-UNIMOD:21,1270-UNIMOD:21	0.02	30.0	4	2	1
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	66-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	36-UNIMOD:21,45-UNIMOD:21,73-UNIMOD:21	0.13	30.0	2	2	2
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	2-UNIMOD:1,3-UNIMOD:21,156-UNIMOD:21,160-UNIMOD:21,139-UNIMOD:4,8-UNIMOD:21	0.32	30.0	10	4	2
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35,34-UNIMOD:21,551-UNIMOD:21	0.07	30.0	13	3	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,16-UNIMOD:21,6-UNIMOD:21,8-UNIMOD:21	0.08	30.0	4	1	0
PRT	sp|P62310|LSM3_HUMAN	U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,10-UNIMOD:21	0.22	30.0	1	1	1
PRT	sp|P50542|PEX5_HUMAN	Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	317-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,14-UNIMOD:21	0.16	30.0	2	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21	0.04	29.0	3	1	0
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	346-UNIMOD:21,338-UNIMOD:21	0.03	29.0	6	2	0
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	181-UNIMOD:21,171-UNIMOD:4	0.05	29.0	3	2	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	234-UNIMOD:21,241-UNIMOD:4,243-UNIMOD:21,240-UNIMOD:21,245-UNIMOD:21	0.06	29.0	3	1	0
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	221-UNIMOD:21,268-UNIMOD:21,315-UNIMOD:21,333-UNIMOD:4	0.14	29.0	5	3	2
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	234-UNIMOD:21,237-UNIMOD:21	0.17	29.0	10	3	1
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	56-UNIMOD:21	0.06	29.0	3	1	0
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	438-UNIMOD:21,114-UNIMOD:21,123-UNIMOD:4	0.07	29.0	4	2	1
PRT	sp|Q15629|TRAM1_HUMAN	Translocating chain-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=TRAM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	365-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1267-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	81-UNIMOD:21,284-UNIMOD:21,283-UNIMOD:35	0.07	29.0	6	4	3
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	108-UNIMOD:4,118-UNIMOD:21	0.04	29.0	3	2	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	27-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.06	29.0	5	3	2
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	791-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	37-UNIMOD:21,41-UNIMOD:21,202-UNIMOD:21,49-UNIMOD:4,55-UNIMOD:21,152-UNIMOD:4	0.13	29.0	13	5	3
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	33-UNIMOD:21,36-UNIMOD:35	0.05	29.0	2	1	0
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	103-UNIMOD:21,106-UNIMOD:4,71-UNIMOD:21,39-UNIMOD:21	0.09	29.0	4	3	2
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	400-UNIMOD:21,575-UNIMOD:21	0.06	29.0	3	2	1
PRT	sp|Q96QU8|XPO6_HUMAN	Exportin-6 OS=Homo sapiens OX=9606 GN=XPO6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	204-UNIMOD:21,208-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	143-UNIMOD:21,147-UNIMOD:21,267-UNIMOD:21,276-UNIMOD:21	0.15	29.0	3	2	1
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	246-UNIMOD:21,251-UNIMOD:21,237-UNIMOD:21,242-UNIMOD:4,278-UNIMOD:21	0.11	29.0	5	3	2
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	8-UNIMOD:4,12-UNIMOD:21,17-UNIMOD:4	0.03	29.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	3716-UNIMOD:21,4564-UNIMOD:21,5763-UNIMOD:21,4100-UNIMOD:21,41-UNIMOD:21,511-UNIMOD:21,3426-UNIMOD:21,177-UNIMOD:21	0.02	29.0	11	9	7
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	231-UNIMOD:21,233-UNIMOD:35	0.06	29.0	3	2	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	22-UNIMOD:21,21-UNIMOD:21,7-UNIMOD:28	0.02	29.0	4	1	0
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	453-UNIMOD:21,454-UNIMOD:21,462-UNIMOD:21,863-UNIMOD:21,608-UNIMOD:21,68-UNIMOD:4,75-UNIMOD:4,416-UNIMOD:21	0.10	29.0	9	6	4
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	504-UNIMOD:4,509-UNIMOD:21,157-UNIMOD:21,170-UNIMOD:21	0.08	28.0	4	2	1
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	6-UNIMOD:21,368-UNIMOD:21,337-UNIMOD:21	0.15	28.0	6	4	3
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	567-UNIMOD:21,306-UNIMOD:21,109-UNIMOD:21,113-UNIMOD:21,183-UNIMOD:21,187-UNIMOD:21,119-UNIMOD:21,123-UNIMOD:21,110-UNIMOD:21	0.11	28.0	10	5	2
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	40-UNIMOD:21,165-UNIMOD:21,41-UNIMOD:21,94-UNIMOD:21,33-UNIMOD:35	0.24	28.0	11	5	3
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	320-UNIMOD:21,303-UNIMOD:21,162-UNIMOD:21,164-UNIMOD:4,168-UNIMOD:21	0.16	28.0	7	5	4
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	62-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	28.0	null	51-UNIMOD:21,53-UNIMOD:21,135-UNIMOD:21,136-UNIMOD:21,138-UNIMOD:4,203-UNIMOD:21,127-UNIMOD:21	0.12	28.0	6	3	1
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	31-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1094-UNIMOD:21,1288-UNIMOD:21,1291-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	519-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	158-UNIMOD:21,145-UNIMOD:28	0.11	28.0	3	2	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	273-UNIMOD:21,277-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|Q9Y6I3|EPN1_HUMAN	Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	454-UNIMOD:21,460-UNIMOD:21	0.04	28.0	4	2	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	408-UNIMOD:21,370-UNIMOD:21,493-UNIMOD:35	0.09	28.0	8	5	3
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	317-UNIMOD:21,505-UNIMOD:21	0.13	28.0	10	8	7
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	25-UNIMOD:21,38-UNIMOD:21,16-UNIMOD:21	0.26	28.0	21	5	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	241-UNIMOD:4,243-UNIMOD:21	0.05	28.0	3	1	0
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	192-UNIMOD:21	0.05	28.0	2	1	0
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	152-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	113-UNIMOD:4,115-UNIMOD:21	0.13	28.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	34-UNIMOD:21,39-UNIMOD:21,37-UNIMOD:21	0.11	28.0	5	2	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	28.0	3	1	0
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	27.0	null	30-UNIMOD:21,169-UNIMOD:21,28-UNIMOD:21	0.14	27.0	3	2	1
PRT	sp|Q86TS9|RM52_HUMAN	39S ribosomal protein L52, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	118-UNIMOD:21	0.10	27.0	4	1	0
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	499-UNIMOD:21,504-UNIMOD:21,138-UNIMOD:21,141-UNIMOD:21	0.08	27.0	4	4	4
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	427-UNIMOD:4,431-UNIMOD:21,308-UNIMOD:21,310-UNIMOD:21	0.07	27.0	6	3	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	856-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	275-UNIMOD:21,268-UNIMOD:35	0.04	27.0	3	2	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1942-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	224-UNIMOD:21,217-UNIMOD:21	0.06	27.0	3	1	0
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	269-UNIMOD:21,272-UNIMOD:21,266-UNIMOD:21	0.04	27.0	2	2	2
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	494-UNIMOD:21,442-UNIMOD:4,444-UNIMOD:21,534-UNIMOD:21,537-UNIMOD:21	0.09	27.0	4	3	2
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	172-UNIMOD:21,55-UNIMOD:21	0.15	27.0	2	2	2
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	861-UNIMOD:21,859-UNIMOD:21,160-UNIMOD:21	0.05	27.0	6	3	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	319-UNIMOD:21,322-UNIMOD:21,18-UNIMOD:21,237-UNIMOD:21,309-UNIMOD:21	0.16	27.0	11	5	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	212-UNIMOD:21,192-UNIMOD:21,86-UNIMOD:21,94-UNIMOD:21,205-UNIMOD:21,87-UNIMOD:21	0.08	27.0	8	5	2
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	229-UNIMOD:21	0.02	27.0	4	2	0
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	2169-UNIMOD:4,2172-UNIMOD:21,2176-UNIMOD:21,2157-UNIMOD:21,2161-UNIMOD:21,1616-UNIMOD:21,1619-UNIMOD:4	0.02	27.0	3	3	3
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	9-UNIMOD:21	0.15	27.0	1	1	1
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	298-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null	680-UNIMOD:4,688-UNIMOD:21,692-UNIMOD:4,886-UNIMOD:21,954-UNIMOD:21,737-UNIMOD:21,744-UNIMOD:4,547-UNIMOD:21,898-UNIMOD:21	0.07	27.0	11	7	3
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	189-UNIMOD:21,194-UNIMOD:4,190-UNIMOD:21,179-UNIMOD:35	0.07	27.0	3	1	0
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	286-UNIMOD:21,259-UNIMOD:21,334-UNIMOD:21	0.09	27.0	5	4	3
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	85-UNIMOD:21	0.05	26.0	4	2	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	173-UNIMOD:4,183-UNIMOD:21	0.21	26.0	3	3	3
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1141-UNIMOD:21,1144-UNIMOD:4,1151-UNIMOD:4,1153-UNIMOD:4,1237-UNIMOD:21,643-UNIMOD:4,658-UNIMOD:21	0.03	26.0	4	3	2
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	455-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	163-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O15439|MRP4_HUMAN	Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	646-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	663-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	35-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	120-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	237-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	239-UNIMOD:21,241-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	186-UNIMOD:35,193-UNIMOD:21,190-UNIMOD:21	0.03	26.0	3	1	0
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	97-UNIMOD:21,100-UNIMOD:4	0.08	26.0	2	1	0
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	330-UNIMOD:21,328-UNIMOD:35	0.05	26.0	3	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	615-UNIMOD:21,903-UNIMOD:21,249-UNIMOD:21,608-UNIMOD:21	0.05	26.0	4	3	2
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	219-UNIMOD:21	0.05	26.0	4	2	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	222-UNIMOD:21,228-UNIMOD:21,722-UNIMOD:21,498-UNIMOD:21,217-UNIMOD:21	0.08	26.0	8	4	2
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,11-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	90-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	259-UNIMOD:21,267-UNIMOD:21,270-UNIMOD:21,179-UNIMOD:21,306-UNIMOD:21,308-UNIMOD:21,274-UNIMOD:21,344-UNIMOD:21,183-UNIMOD:21,281-UNIMOD:21	0.17	25.0	14	6	4
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	93-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	221-UNIMOD:21,290-UNIMOD:21,297-UNIMOD:4,303-UNIMOD:21,291-UNIMOD:21,110-UNIMOD:21,350-UNIMOD:21	0.12	25.0	6	4	2
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	60-UNIMOD:21,64-UNIMOD:21,63-UNIMOD:21	0.08	25.0	2	1	0
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	118-UNIMOD:4,124-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	460-UNIMOD:21,463-UNIMOD:21,464-UNIMOD:21	0.03	25.0	7	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	777-UNIMOD:21,1012-UNIMOD:4,1014-UNIMOD:21,102-UNIMOD:21	0.06	25.0	5	4	3
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1445-UNIMOD:21,496-UNIMOD:4,498-UNIMOD:4,504-UNIMOD:21,1448-UNIMOD:21	0.02	25.0	3	2	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	107-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	444-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	106-UNIMOD:21,108-UNIMOD:4,303-UNIMOD:21,83-UNIMOD:21,85-UNIMOD:21	0.10	25.0	4	3	2
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	226-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	294-UNIMOD:21,301-UNIMOD:21,304-UNIMOD:21,296-UNIMOD:21	0.06	25.0	7	2	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	143-UNIMOD:21,146-UNIMOD:21,311-UNIMOD:21,308-UNIMOD:21,148-UNIMOD:21	0.07	25.0	10	3	1
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1000-UNIMOD:21,1006-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	115-UNIMOD:21,119-UNIMOD:21	0.08	25.0	3	2	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	186-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	160-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	115-UNIMOD:21,131-UNIMOD:4,99-UNIMOD:4,104-UNIMOD:4	0.09	25.0	2	2	2
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	112-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	647-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	129-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	315-UNIMOD:21,322-UNIMOD:21,321-UNIMOD:21,631-UNIMOD:21	0.04	25.0	4	2	1
PRT	sp|O95197|RTN3_HUMAN	Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	246-UNIMOD:21,227-UNIMOD:21	0.03	25.0	3	2	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1721-UNIMOD:21,1727-UNIMOD:21	0.01	25.0	4	1	0
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	551-UNIMOD:21,223-UNIMOD:21,235-UNIMOD:4,873-UNIMOD:21	0.03	25.0	3	3	3
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	145-UNIMOD:21	0.14	25.0	6	3	1
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	133-UNIMOD:21,137-UNIMOD:21,128-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	251-UNIMOD:21,55-UNIMOD:21,320-UNIMOD:21,325-UNIMOD:21,326-UNIMOD:21,327-UNIMOD:35	0.19	25.0	12	5	3
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	10-UNIMOD:21	0.09	25.0	1	1	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	488-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21	0.05	25.0	2	2	2
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	169-UNIMOD:21	0.11	25.0	2	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	62-UNIMOD:21,87-UNIMOD:21	0.07	25.0	5	2	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	999-UNIMOD:21,579-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	33-UNIMOD:21,38-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q9Y4F1|FARP1_HUMAN	FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	510-UNIMOD:21,514-UNIMOD:21,522-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	426-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	840-UNIMOD:21,842-UNIMOD:4,853-UNIMOD:21,841-UNIMOD:35,844-UNIMOD:21	0.01	25.0	3	1	0
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	412-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	309-UNIMOD:4,320-UNIMOD:21,323-UNIMOD:21,232-UNIMOD:21,234-UNIMOD:4	0.03	25.0	5	2	1
PRT	sp|A1KXE4|F168B_HUMAN	Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	0.10	25.0	1	1	1
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,12-UNIMOD:21	0.14	25.0	1	1	1
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,21-UNIMOD:21	0.18	25.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	475-UNIMOD:21,480-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	57-UNIMOD:21,65-UNIMOD:4,159-UNIMOD:21,161-UNIMOD:4	0.09	24.0	3	2	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	335-UNIMOD:21,339-UNIMOD:21,341-UNIMOD:21	0.02	24.0	3	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	20-UNIMOD:21,23-UNIMOD:21,19-UNIMOD:21	0.03	24.0	3	2	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	238-UNIMOD:21	0.05	24.0	3	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	56-UNIMOD:21	0.07	24.0	2	2	2
PRT	sp|P07711|CATL1_HUMAN	Cathepsin L1 OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	322-UNIMOD:4,326-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1463-UNIMOD:21,209-UNIMOD:21,1112-UNIMOD:21,614-UNIMOD:21,619-UNIMOD:21,678-UNIMOD:4,681-UNIMOD:4,687-UNIMOD:21,1064-UNIMOD:21,1065-UNIMOD:4,1057-UNIMOD:21,1059-UNIMOD:21,334-UNIMOD:21,338-UNIMOD:21	0.07	24.0	9	7	6
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	104-UNIMOD:21,232-UNIMOD:4,234-UNIMOD:21,107-UNIMOD:21	0.10	24.0	6	3	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	862-UNIMOD:21,865-UNIMOD:21,673-UNIMOD:21,675-UNIMOD:4,1319-UNIMOD:21	0.03	24.0	4	3	2
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	212-UNIMOD:21	0.07	24.0	2	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	863-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	2083-UNIMOD:21,122-UNIMOD:21,129-UNIMOD:21,2081-UNIMOD:21,2054-UNIMOD:21,107-UNIMOD:4,115-UNIMOD:21	0.03	24.0	6	4	3
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	172-UNIMOD:21,174-UNIMOD:21	0.10	24.0	2	1	0
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	830-UNIMOD:4,837-UNIMOD:4,838-UNIMOD:21,842-UNIMOD:4,848-UNIMOD:4	0.01	24.0	3	1	0
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	184-UNIMOD:21,189-UNIMOD:21	0.06	24.0	4	1	0
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	430-UNIMOD:21,437-UNIMOD:21,433-UNIMOD:21,434-UNIMOD:21,436-UNIMOD:21	0.01	24.0	5	1	0
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	47-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	286-UNIMOD:21,287-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|O60831|PRAF2_HUMAN	PRA1 family protein 2 OS=Homo sapiens OX=9606 GN=PRAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	19-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q9BVS4|RIOK2_HUMAN	Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	543-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	210-UNIMOD:21,215-UNIMOD:4	0.01	24.0	2	1	0
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	285-UNIMOD:21,287-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	87-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	55-UNIMOD:21,60-UNIMOD:4,67-UNIMOD:4,438-UNIMOD:21	0.06	24.0	2	2	2
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	787-UNIMOD:21,498-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	308-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1004-UNIMOD:21,1010-UNIMOD:21,21-UNIMOD:21,25-UNIMOD:21,129-UNIMOD:21	0.03	24.0	3	3	3
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1207-UNIMOD:21,1211-UNIMOD:21,1215-UNIMOD:21,1203-UNIMOD:21,1208-UNIMOD:21,1205-UNIMOD:21	0.02	24.0	6	1	0
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,4-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	2155-UNIMOD:21,2073-UNIMOD:21	0.01	24.0	4	2	1
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,11-UNIMOD:21,14-UNIMOD:21	0.01	24.0	3	1	0
PRT	sp|Q93015-2|NAA80_HUMAN	Isoform 2 of N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	1-UNIMOD:1,7-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,8-UNIMOD:21,15-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q6VMQ6|MCAF1_HUMAN	Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	673-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	23.0	null	435-UNIMOD:21,534-UNIMOD:21	0.05	23.0	3	2	1
PRT	sp|Q86W56|PARG_HUMAN	Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	137-UNIMOD:21,302-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	163-UNIMOD:4,161-UNIMOD:21,167-UNIMOD:21	0.05	23.0	6	3	0
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	973-UNIMOD:21,1117-UNIMOD:21,964-UNIMOD:21	0.04	23.0	4	2	0
PRT	sp|O95685|PPR3D_HUMAN	Protein phosphatase 1 regulatory subunit 3D OS=Homo sapiens OX=9606 GN=PPP1R3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	41-UNIMOD:4,46-UNIMOD:21,54-UNIMOD:21,60-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	173-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	101-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q9BUL5|PHF23_HUMAN	PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	124-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	382-UNIMOD:35,387-UNIMOD:21,395-UNIMOD:21,333-UNIMOD:21,344-UNIMOD:21,370-UNIMOD:21,357-UNIMOD:21	0.13	23.0	7	3	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	184-UNIMOD:21,692-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	460-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	972-UNIMOD:4,974-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	78-UNIMOD:21	0.17	23.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	137-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	133-UNIMOD:21,137-UNIMOD:21,107-UNIMOD:21,114-UNIMOD:21	0.21	23.0	4	3	2
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	389-UNIMOD:21,391-UNIMOD:21,65-UNIMOD:21	0.08	23.0	3	2	1
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	473-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	516-UNIMOD:21,513-UNIMOD:21,512-UNIMOD:21	0.04	23.0	5	2	0
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	108-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1469-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	41-UNIMOD:21,46-UNIMOD:21	0.19	23.0	3	1	0
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	441-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	87-UNIMOD:21,94-UNIMOD:21,93-UNIMOD:21	0.06	23.0	6	3	1
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	276-UNIMOD:21,361-UNIMOD:21,257-UNIMOD:21,275-UNIMOD:21	0.07	23.0	4	3	2
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	90-UNIMOD:21,130-UNIMOD:21	0.09	23.0	3	2	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	34-UNIMOD:21,53-UNIMOD:21	0.09	23.0	4	3	2
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	9-UNIMOD:21,26-UNIMOD:21,15-UNIMOD:21	0.06	23.0	4	2	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	385-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	221-UNIMOD:21,220-UNIMOD:21,242-UNIMOD:21	0.18	23.0	10	3	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	432-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	666-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	111-UNIMOD:21,594-UNIMOD:21	0.03	23.0	6	2	0
PRT	sp|Q96DB5|RMD1_HUMAN	Regulator of microtubule dynamics protein 1 OS=Homo sapiens OX=9606 GN=RMDN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	308-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	176-UNIMOD:21,184-UNIMOD:21,83-UNIMOD:21,82-UNIMOD:21,80-UNIMOD:28,202-UNIMOD:21	0.34	23.0	9	5	4
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	352-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	51-UNIMOD:21	0.08	23.0	3	1	0
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	524-UNIMOD:21,526-UNIMOD:4,528-UNIMOD:21,523-UNIMOD:21,533-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q9BVK6|TMED9_HUMAN	Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	80-UNIMOD:21,72-UNIMOD:28	0.11	23.0	2	1	0
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	172-UNIMOD:21,176-UNIMOD:21,232-UNIMOD:21,224-UNIMOD:21,222-UNIMOD:28	0.12	22.0	5	3	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	441-UNIMOD:4,445-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	207-UNIMOD:21,211-UNIMOD:21,142-UNIMOD:21,223-UNIMOD:21,227-UNIMOD:21,328-UNIMOD:21	0.05	22.0	4	4	4
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	257-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	460-UNIMOD:21,834-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	124-UNIMOD:21,482-UNIMOD:21	0.06	22.0	2	2	2
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	248-UNIMOD:21,253-UNIMOD:21,243-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	633-UNIMOD:21,66-UNIMOD:21,38-UNIMOD:21,45-UNIMOD:21	0.11	22.0	5	5	5
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	87-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|Q9Y320|TMX2_HUMAN	Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	282-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	234-UNIMOD:4,835-UNIMOD:21,233-UNIMOD:21	0.03	22.0	3	2	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	734-UNIMOD:21,738-UNIMOD:21	0.02	22.0	6	1	0
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	171-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	203-UNIMOD:4,210-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	559-UNIMOD:21	0.02	22.0	3	1	0
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	321-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	57-UNIMOD:21,127-UNIMOD:21,129-UNIMOD:4	0.17	22.0	4	2	1
PRT	sp|P04920|B3A2_HUMAN	Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	22.0	null	113-UNIMOD:21,144-UNIMOD:21,150-UNIMOD:21,173-UNIMOD:21	0.06	22.0	3	3	3
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	198-UNIMOD:21,191-UNIMOD:21,53-UNIMOD:21	0.07	22.0	3	3	3
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	509-UNIMOD:21,513-UNIMOD:4,1028-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	22.0	4	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	384-UNIMOD:21,662-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	163-UNIMOD:21,66-UNIMOD:21,64-UNIMOD:21,633-UNIMOD:21	0.16	22.0	9	6	3
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	198-UNIMOD:21,1231-UNIMOD:21,197-UNIMOD:35	0.02	22.0	7	3	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	508-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	322-UNIMOD:21,315-UNIMOD:21	0.02	22.0	3	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	106-UNIMOD:21,169-UNIMOD:21,552-UNIMOD:21,551-UNIMOD:21	0.04	22.0	6	3	0
PRT	sp|Q9BSY4|CHCH5_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CHCHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	89-UNIMOD:4,98-UNIMOD:21	0.24	22.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	65-UNIMOD:21,71-UNIMOD:4	0.04	22.0	2	1	0
PRT	sp|Q15155|NOMO1_HUMAN	Nodal modulator 1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	825-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	115-UNIMOD:21,245-UNIMOD:21	0.10	22.0	3	3	3
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	60-UNIMOD:21,42-UNIMOD:21,52-UNIMOD:21	0.13	22.0	4	2	0
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	278-UNIMOD:21,281-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	256-UNIMOD:4,258-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|Q53H80|AKIR2_HUMAN	Akirin-2 OS=Homo sapiens OX=9606 GN=AKIRIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	18-UNIMOD:21,21-UNIMOD:21	0.08	22.0	3	1	0
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	57-UNIMOD:21,58-UNIMOD:21,65-UNIMOD:21,28-UNIMOD:21	0.21	22.0	4	2	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	412-UNIMOD:4,468-UNIMOD:21	0.09	22.0	6	5	4
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	926-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	48-UNIMOD:21,56-UNIMOD:21,334-UNIMOD:21	0.15	22.0	8	4	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	745-UNIMOD:21,747-UNIMOD:4,756-UNIMOD:21	0.02	22.0	3	1	0
PRT	sp|Q8NDV7|TNR6A_HUMAN	Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1044-UNIMOD:21,1047-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	90-UNIMOD:21,204-UNIMOD:21,206-UNIMOD:4	0.14	22.0	2	2	2
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	370-UNIMOD:21	0.06	22.0	2	1	0
PRT	sp|P09496-2|CLCA_HUMAN	Isoform Non-brain of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	175-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	248-UNIMOD:21	0.10	22.0	3	1	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	722-UNIMOD:21,713-UNIMOD:21,725-UNIMOD:21	0.04	22.0	6	2	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	223-UNIMOD:21,102-UNIMOD:21	0.26	22.0	3	2	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2022-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1299-UNIMOD:21,1302-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1,9-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	272-UNIMOD:4,273-UNIMOD:21,407-UNIMOD:21,275-UNIMOD:21,378-UNIMOD:21	0.04	21.0	5	3	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	616-UNIMOD:21,585-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	9-UNIMOD:21,39-UNIMOD:21,36-UNIMOD:21	0.12	21.0	7	3	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1974-UNIMOD:21,2105-UNIMOD:21,776-UNIMOD:35,779-UNIMOD:21,792-UNIMOD:21,2196-UNIMOD:21	0.03	21.0	6	6	6
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	157-UNIMOD:21,159-UNIMOD:4	0.03	21.0	2	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	819-UNIMOD:21,823-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	296-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q15738|NSDHL_HUMAN	Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=NSDHL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	104-UNIMOD:4,106-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	244-UNIMOD:21,240-UNIMOD:21	0.03	21.0	3	1	0
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	178-UNIMOD:21,181-UNIMOD:21,2719-UNIMOD:21	0.00	21.0	6	2	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	263-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	186-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	82-UNIMOD:21,50-UNIMOD:21	0.21	21.0	2	2	2
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	293-UNIMOD:21	0.05	21.0	3	2	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	40-UNIMOD:21,195-UNIMOD:21	0.19	21.0	2	2	2
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	301-UNIMOD:21,296-UNIMOD:35	0.01	21.0	4	1	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1264-UNIMOD:21,1268-UNIMOD:21,399-UNIMOD:21	0.03	21.0	4	2	1
PRT	sp|Q6UW78|UQCC3_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	92-UNIMOD:21,81-UNIMOD:35	0.17	21.0	3	1	0
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	422-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	87-UNIMOD:4,96-UNIMOD:21,91-UNIMOD:21,105-UNIMOD:21	0.10	21.0	3	2	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	110-UNIMOD:21	0.11	21.0	1	1	1
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1006-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	420-UNIMOD:21,428-UNIMOD:21,416-UNIMOD:21,436-UNIMOD:21,439-UNIMOD:4	0.04	21.0	4	2	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	23-UNIMOD:21,19-UNIMOD:21	0.06	21.0	3	1	0
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	17-UNIMOD:21	0.21	21.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	22-UNIMOD:21,335-UNIMOD:4	0.09	21.0	2	2	2
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	63-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	270-UNIMOD:21	0.06	21.0	2	1	0
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	2044-UNIMOD:21,2045-UNIMOD:21,2042-UNIMOD:21,2047-UNIMOD:21,2041-UNIMOD:21	0.01	21.0	6	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	87-UNIMOD:21,89-UNIMOD:21,101-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	258-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	9-UNIMOD:21	0.18	21.0	2	2	2
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	154-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	147-UNIMOD:4,151-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	30-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9NX14|NDUBB_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	53-UNIMOD:21	0.16	21.0	2	1	0
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	250-UNIMOD:4,256-UNIMOD:21,13-UNIMOD:21	0.07	21.0	2	2	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	44-UNIMOD:21,47-UNIMOD:4,177-UNIMOD:21,221-UNIMOD:21	0.22	21.0	4	3	2
PRT	sp|Q96G28|CFA36_HUMAN	Cilia- and flagella-associated protein 36 OS=Homo sapiens OX=9606 GN=CFAP36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	83-UNIMOD:4,85-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1890-UNIMOD:21,1894-UNIMOD:21,1761-UNIMOD:21,1144-UNIMOD:21,2805-UNIMOD:21,2639-UNIMOD:21,2813-UNIMOD:35	0.03	21.0	7	5	3
PRT	sp|Q9UHX3|AGRE2_HUMAN	Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	85-UNIMOD:4,94-UNIMOD:4,96-UNIMOD:4,97-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9UNW1|MINP1_HUMAN	Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	44-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	966-UNIMOD:21,505-UNIMOD:21,793-UNIMOD:21	0.04	21.0	3	3	3
PRT	sp|Q96Q45|TM237_HUMAN	Transmembrane protein 237 OS=Homo sapiens OX=9606 GN=TMEM237 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	47-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	314-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	345-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	669-UNIMOD:4,670-UNIMOD:21,681-UNIMOD:21,262-UNIMOD:21,680-UNIMOD:21	0.03	21.0	4	2	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	2202-UNIMOD:4,2204-UNIMOD:21,827-UNIMOD:21,831-UNIMOD:21,207-UNIMOD:21,212-UNIMOD:4	0.02	21.0	5	3	2
PRT	sp|Q7Z5J4|RAI1_HUMAN	Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	683-UNIMOD:21,696-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	325-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,9-UNIMOD:21	0.19	21.0	1	1	1
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,12-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4,8-UNIMOD:21	0.15	21.0	9	1	0
PRT	sp|P78344|IF4G2_HUMAN	Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1,3-UNIMOD:21,32-UNIMOD:21,42-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	376-UNIMOD:21,381-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	36-UNIMOD:385,36-UNIMOD:4,38-UNIMOD:21,83-UNIMOD:21	0.15	21.0	4	2	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	346-UNIMOD:28,353-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q15599|NHRF2_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	43-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	566-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	955-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	144-UNIMOD:21,149-UNIMOD:21,150-UNIMOD:21	0.14	20.0	4	1	0
PRT	sp|Q2M2I8|AAK1_HUMAN	AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	624-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	265-UNIMOD:21,281-UNIMOD:21	0.07	20.0	4	2	0
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	412-UNIMOD:4,417-UNIMOD:21,420-UNIMOD:21,90-UNIMOD:21,91-UNIMOD:4,432-UNIMOD:21	0.08	20.0	4	4	4
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	161-UNIMOD:4,157-UNIMOD:21	0.21	20.0	4	3	2
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	52-UNIMOD:21	0.04	20.0	2	1	0
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	989-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	154-UNIMOD:21,152-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	160-UNIMOD:21	0.07	20.0	4	2	0
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2047-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	384-UNIMOD:21,382-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q9H2J7|S6A15_HUMAN	Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	701-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	149-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q96BD0|SO4A1_HUMAN	Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	37-UNIMOD:21,40-UNIMOD:21,34-UNIMOD:21	0.02	20.0	4	2	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	481-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	11-UNIMOD:21,16-UNIMOD:21,12-UNIMOD:21,465-UNIMOD:21	0.05	20.0	3	2	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	779-UNIMOD:4,780-UNIMOD:21,538-UNIMOD:21	0.12	20.0	4	4	4
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	208-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	213-UNIMOD:21,216-UNIMOD:21,217-UNIMOD:21	0.02	20.0	3	1	0
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	9-UNIMOD:21,2-UNIMOD:1,6-UNIMOD:21	0.16	20.0	2	2	2
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	95-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|Q9Y6Y0|NS1BP_HUMAN	Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	274-UNIMOD:4,277-UNIMOD:21,284-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	517-UNIMOD:21,526-UNIMOD:21,774-UNIMOD:21	0.04	20.0	3	2	1
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	333-UNIMOD:21,137-UNIMOD:4,139-UNIMOD:21,321-UNIMOD:21,332-UNIMOD:21,153-UNIMOD:21,154-UNIMOD:4	0.13	20.0	5	4	3
PRT	sp|O14773|TPP1_HUMAN	Tripeptidyl-peptidase 1 OS=Homo sapiens OX=9606 GN=TPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	73-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	297-UNIMOD:21,300-UNIMOD:21	0.02	20.0	3	1	0
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	11-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	350-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	34-UNIMOD:21,30-UNIMOD:21,38-UNIMOD:35	0.03	20.0	3	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	135-UNIMOD:21	0.10	20.0	1	1	1
PRT	sp|P51148|RAB5C_HUMAN	Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	124-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	540-UNIMOD:4,542-UNIMOD:21,551-UNIMOD:21,539-UNIMOD:21,553-UNIMOD:21,541-UNIMOD:21,561-UNIMOD:21,565-UNIMOD:21,458-UNIMOD:21	0.07	20.0	5	3	2
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	222-UNIMOD:21,225-UNIMOD:21,219-UNIMOD:35,433-UNIMOD:21,451-UNIMOD:21,449-UNIMOD:21	0.10	20.0	6	3	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.13	20.0	1	1	1
PRT	sp|Q00587|BORG5_HUMAN	Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	106-UNIMOD:21,113-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	85-UNIMOD:21,90-UNIMOD:21	0.11	20.0	2	1	0
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	215-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	253-UNIMOD:21,91-UNIMOD:21,96-UNIMOD:21	0.06	20.0	4	2	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,10-UNIMOD:21,9-UNIMOD:21	0.14	20.0	3	1	0
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	321-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	199-UNIMOD:21	0.06	19.0	2	2	2
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	91-UNIMOD:21,170-UNIMOD:21,175-UNIMOD:21,71-UNIMOD:21,76-UNIMOD:21	0.11	19.0	3	3	3
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	209-UNIMOD:21,203-UNIMOD:21,252-UNIMOD:21,253-UNIMOD:4	0.05	19.0	3	2	1
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	138-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	69-UNIMOD:21	0.09	19.0	2	1	0
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	795-UNIMOD:21	0.01	19.0	2	1	0
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2000-UNIMOD:21,1757-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	226-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.18	19.0	2	2	2
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	715-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1414-UNIMOD:21,395-UNIMOD:4,397-UNIMOD:21,398-UNIMOD:4,400-UNIMOD:4,410-UNIMOD:4	0.03	19.0	2	2	2
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2728-UNIMOD:21,1294-UNIMOD:21,1677-UNIMOD:4,1683-UNIMOD:21,1679-UNIMOD:21	0.01	19.0	4	3	2
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	454-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|Q9Y6I9|TX264_HUMAN	Testis-expressed protein 264 OS=Homo sapiens OX=9606 GN=TEX264 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	244-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1505-UNIMOD:21	0.00	19.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	76-UNIMOD:21,80-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|Q96HC4|PDLI5_HUMAN	PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	111-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	70-UNIMOD:21,79-UNIMOD:21	0.10	19.0	2	1	0
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	245-UNIMOD:21,247-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	313-UNIMOD:21,320-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	193-UNIMOD:21,220-UNIMOD:21	0.06	19.0	2	2	2
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	721-UNIMOD:21,725-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	110-UNIMOD:21,112-UNIMOD:4	0.09	19.0	1	1	1
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	200-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	253-UNIMOD:21,688-UNIMOD:21	0.04	19.0	2	2	2
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	313-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q9NVA1|UQCC1_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens OX=9606 GN=UQCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	294-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|O95359|TACC2_HUMAN	Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	19.0	null	2317-UNIMOD:21,2321-UNIMOD:21,2237-UNIMOD:21,2256-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.18	19.0	2	1	0
PRT	sp|Q86X55|CARM1_HUMAN	Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	463-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q96T76|MMS19_HUMAN	MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1027-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	127-UNIMOD:21,128-UNIMOD:21	0.09	19.0	2	1	0
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	89-UNIMOD:21	0.14	19.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	35-UNIMOD:21,128-UNIMOD:21	0.12	19.0	3	3	3
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	128-UNIMOD:21,140-UNIMOD:21	0.04	19.0	2	2	2
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	47-UNIMOD:21,221-UNIMOD:21	0.15	19.0	3	2	1
PRT	sp|Q7Z434-4|MAVS_HUMAN	Isoform 4 of Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	11-UNIMOD:21,24-UNIMOD:21,16-UNIMOD:21	0.07	19.0	4	1	0
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2150-UNIMOD:4,2155-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	456-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	122-UNIMOD:21,135-UNIMOD:21,120-UNIMOD:21,134-UNIMOD:21	0.04	19.0	3	2	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	411-UNIMOD:21,412-UNIMOD:21,391-UNIMOD:21,394-UNIMOD:21	0.07	19.0	3	2	1
PRT	sp|Q9UBV2|SE1L1_HUMAN	Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	96-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	890-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2054-UNIMOD:21,2058-UNIMOD:21,2057-UNIMOD:21,939-UNIMOD:21,948-UNIMOD:21	0.02	19.0	3	2	1
PRT	sp|O76080|ZFAN5_HUMAN	AN1-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=ZFAND5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null	2-UNIMOD:1,8-UNIMOD:21,14-UNIMOD:4,18-UNIMOD:4,44-UNIMOD:21,56-UNIMOD:21	0.25	19.0	2	2	2
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	294-UNIMOD:21,301-UNIMOD:21,278-UNIMOD:21	0.12	19.0	2	2	2
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	302-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q6P996|PDXD1_HUMAN	Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	691-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	277-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	53-UNIMOD:4,154-UNIMOD:21	0.13	18.0	2	2	2
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q8WVM8|SCFD1_HUMAN	Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	320-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q96CS3|FAF2_HUMAN	FAS-associated factor 2 OS=Homo sapiens OX=9606 GN=FAF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	349-UNIMOD:4,355-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	87-UNIMOD:21,70-UNIMOD:21	0.11	18.0	4	2	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	583-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|O00115|DNS2A_HUMAN	Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	70-UNIMOD:21	0.04	18.0	4	1	0
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	50-UNIMOD:21,96-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|O14910|LIN7A_HUMAN	Protein lin-7 homolog A OS=Homo sapiens OX=9606 GN=LIN7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	130-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P40763|STAT3_HUMAN	Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	687-UNIMOD:4,701-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1915-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	211-UNIMOD:4,216-UNIMOD:21	0.04	18.0	3	2	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	474-UNIMOD:21,479-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	55-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q5R3I4|TTC38_HUMAN	Tetratricopeptide repeat protein 38 OS=Homo sapiens OX=9606 GN=TTC38 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	452-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	453-UNIMOD:4,466-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	195-UNIMOD:21,457-UNIMOD:4,459-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	327-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	490-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	106-UNIMOD:21,108-UNIMOD:4	0.02	18.0	2	2	2
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	174-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P05997|CO5A2_HUMAN	Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1284-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	121-UNIMOD:4,128-UNIMOD:4,129-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	18.0	4	2	0
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	719-UNIMOD:21,635-UNIMOD:21,641-UNIMOD:21	0.02	18.0	3	2	1
PRT	sp|P18850|ATF6A_HUMAN	Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	94-UNIMOD:21,103-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	149-UNIMOD:21,153-UNIMOD:21,143-UNIMOD:21	0.07	18.0	2	1	0
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	38-UNIMOD:21,17-UNIMOD:4,26-UNIMOD:21,17-UNIMOD:385,25-UNIMOD:21	0.15	18.0	4	2	0
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	103-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	27-UNIMOD:21	0.07	18.0	2	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	2	1	0
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	69-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	60-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	81-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	123-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q6XQN6|PNCB_HUMAN	Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	533-UNIMOD:4,537-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	186-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	92-UNIMOD:4,96-UNIMOD:4,102-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|O60499|STX10_HUMAN	Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	108-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	567-UNIMOD:21,578-UNIMOD:21,587-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	300-UNIMOD:21	0.06	18.0	2	2	2
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	432-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	425-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q8WTV0-2|SCRB1_HUMAN	Isoform 1 of Scavenger receptor class B member 1 OS=Homo sapiens OX=9606 GN=SCARB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	496-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	525-UNIMOD:21,527-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P42226|STAT6_HUMAN	Signal transducer and activator of transcription 6 OS=Homo sapiens OX=9606 GN=STAT6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	593-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	104-UNIMOD:21,108-UNIMOD:35	0.16	18.0	3	1	0
PRT	sp|Q14012|KCC1A_HUMAN	Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	354-UNIMOD:4,355-UNIMOD:4,363-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q86TI2|DPP9_HUMAN	Dipeptidyl peptidase 9 OS=Homo sapiens OX=9606 GN=DPP9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	473-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	18.0	null	657-UNIMOD:21,327-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q03164|KMT2A_HUMAN	Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	3028-UNIMOD:21,3036-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2029-UNIMOD:21,2032-UNIMOD:21,1261-UNIMOD:21	0.01	18.0	2	2	2
PRT	sp|Q96GQ5|RUS1_HUMAN	RUS1 family protein C16orf58 OS=Homo sapiens OX=9606 GN=C16orf58 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,9-UNIMOD:21,12-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q9Y6E0-2|STK24_HUMAN	Isoform A of Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,4-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q15011|HERP1_HUMAN	Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein OS=Homo sapiens OX=9606 GN=HERPUD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	1-UNIMOD:1,16-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	224-UNIMOD:21,232-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	394-UNIMOD:21,398-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	153-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	187-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	201-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	232-UNIMOD:21,388-UNIMOD:21	0.11	17.0	2	2	2
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	147-UNIMOD:21	0.13	17.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	61-UNIMOD:21,66-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	460-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	170-UNIMOD:4,178-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	181-UNIMOD:21,186-UNIMOD:21,167-UNIMOD:28	0.04	17.0	2	1	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	85-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	212-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	221-UNIMOD:21,226-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P15559|NQO1_HUMAN	NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	82-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	216-UNIMOD:21	0.03	17.0	2	1	0
PRT	sp|P08174|DAF_HUMAN	Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	98-UNIMOD:4,106-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q13637|RAB32_HUMAN	Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	154-UNIMOD:21,162-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	522-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9UPQ9|TNR6B_HUMAN	Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	385-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	212-UNIMOD:21,219-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	227-UNIMOD:21,226-UNIMOD:21	0.05	17.0	2	1	0
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	649-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	280-UNIMOD:21,46-UNIMOD:21	0.09	17.0	2	2	2
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	203-UNIMOD:4,207-UNIMOD:21,74-UNIMOD:21	0.12	17.0	2	2	2
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	119-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	249-UNIMOD:21,244-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	260-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q15029|U5S1_HUMAN	116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	866-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	433-UNIMOD:21,439-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	527-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	219-UNIMOD:21,229-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	64-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	353-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q9H4X1|RGCC_HUMAN	Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	97-UNIMOD:21,107-UNIMOD:21,99-UNIMOD:21	0.15	17.0	2	1	0
PRT	sp|Q01201|RELB_HUMAN	Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	573-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	211-UNIMOD:21,216-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	127-UNIMOD:21	0.15	17.0	1	1	1
PRT	sp|P56945|BCAR1_HUMAN	Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	18-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	487-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	387-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	563-UNIMOD:21,568-UNIMOD:21,576-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	229-UNIMOD:4,234-UNIMOD:21,243-UNIMOD:21,237-UNIMOD:21	0.13	17.0	2	1	0
PRT	sp|O00429-2|DNM1L_HUMAN	Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	575-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	39-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	151-UNIMOD:21	0.13	17.0	1	1	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:4,9-UNIMOD:21	0.09	17.0	1	1	1
PRT	sp|Q9UM00|TMCO1_HUMAN	Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null	224-UNIMOD:28,235-UNIMOD:21	0.06	17.0	2	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	731-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	108-UNIMOD:21,116-UNIMOD:21	0.07	17.0	2	1	0
PRT	sp|Q5HYI8|RABL3_HUMAN	Rab-like protein 3 OS=Homo sapiens OX=9606 GN=RABL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	73-UNIMOD:21,75-UNIMOD:21,70-UNIMOD:21	0.09	17.0	2	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	46-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1047-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:35,264-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q9NZB2|F120A_HUMAN	Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	991-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	809-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	89-UNIMOD:21,92-UNIMOD:4	0.04	16.0	2	1	0
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|O43678|NDUA2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Homo sapiens OX=9606 GN=NDUFA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	96-UNIMOD:21	0.11	16.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	13-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q7L8L6|FAKD5_HUMAN	FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	95-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	73-UNIMOD:4,76-UNIMOD:21	0.12	16.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	426-UNIMOD:4,434-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q7Z4S6|KI21A_HUMAN	Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1275-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	687-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	97-UNIMOD:21	0.01	16.0	2	1	0
PRT	sp|Q15771|RAB30_HUMAN	Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	184-UNIMOD:21	0.09	16.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	119-UNIMOD:21	0.09	16.0	2	1	0
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	175-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q8NEZ2|VP37A_HUMAN	Vacuolar protein sorting-associated protein 37A OS=Homo sapiens OX=9606 GN=VPS37A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	14-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	246-UNIMOD:21,249-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	317-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|O75496|GEMI_HUMAN	Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	64-UNIMOD:21	0.12	16.0	1	1	1
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	50-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	327-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	55-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	77-UNIMOD:21	0.08	16.0	2	1	0
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	576-UNIMOD:4,584-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	490-UNIMOD:4,493-UNIMOD:21,715-UNIMOD:4,718-UNIMOD:21	0.03	16.0	2	2	2
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	203-UNIMOD:21,347-UNIMOD:21	0.08	16.0	2	2	2
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	200-UNIMOD:21	0.11	16.0	2	2	2
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	2	2	2
PRT	sp|Q7L1W4|LRC8D_HUMAN	Volume-regulated anion channel subunit LRRC8D OS=Homo sapiens OX=9606 GN=LRRC8D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	246-UNIMOD:21,251-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	359-UNIMOD:4,361-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|O95067|CCNB2_HUMAN	G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	392-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	316-UNIMOD:4	0.03	16.0	2	1	0
PRT	sp|P49116|NR2C2_HUMAN	Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	219-UNIMOD:21,224-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	780-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1670-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	399-UNIMOD:21,401-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9BQP7|MGME1_HUMAN	Mitochondrial genome maintenance exonuclease 1 OS=Homo sapiens OX=9606 GN=MGME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	71-UNIMOD:21,79-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	97-UNIMOD:21,100-UNIMOD:21	0.08	16.0	4	1	0
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	115-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P17813|EGLN_HUMAN	Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	516-UNIMOD:4,523-UNIMOD:21,521-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|Q14914|PTGR1_HUMAN	Prostaglandin reductase 1 OS=Homo sapiens OX=9606 GN=PTGR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	88-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	448-UNIMOD:4,458-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P84095|RHOG_HUMAN	Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	44-UNIMOD:21,138-UNIMOD:21	0.20	16.0	2	2	2
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	617-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9BVG9|PTSS2_HUMAN	Phosphatidylserine synthase 2 OS=Homo sapiens OX=9606 GN=PTDSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	485-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,12-UNIMOD:21	0.01	16.0	3	2	1
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,24-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|Q9H078|CLPB_HUMAN	Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	663-UNIMOD:21,668-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	88-UNIMOD:21,99-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|Q9NXH9|TRM1_HUMAN	tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	614-UNIMOD:4,620-UNIMOD:4,621-UNIMOD:4,628-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9H4Z3|CAPAM_HUMAN	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	135-UNIMOD:21,143-UNIMOD:21,150-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	305-UNIMOD:21,314-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|O75683|SURF6_HUMAN	Surfeit locus protein 6 OS=Homo sapiens OX=9606 GN=SURF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	229-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	69-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	43-UNIMOD:21	0.09	15.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1037-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	512-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q99575|POP1_HUMAN	Ribonucleases P/MRP protein subunit POP1 OS=Homo sapiens OX=9606 GN=POP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	730-UNIMOD:21	0.02	15.0	2	1	0
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1207-UNIMOD:21,1215-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	50-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	303-UNIMOD:21	0.03	15.0	2	1	0
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1290-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P48047|ATPO_HUMAN	ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	47-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	754-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q99576-3|T22D3_HUMAN	Isoform 2 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	42-UNIMOD:21	0.10	15.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	92-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	150-UNIMOD:21,66-UNIMOD:21	0.11	15.0	2	2	2
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	306-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	48-UNIMOD:21,54-UNIMOD:21	0.03	15.0	2	1	0
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	70-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9UHY1|NRBP_HUMAN	Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	525-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.09	15.0	1	1	1
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	294-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q8N357|S35F6_HUMAN	Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	365-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	116-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	348-UNIMOD:21,349-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	109-UNIMOD:21,112-UNIMOD:4	0.03	15.0	2	1	0
PRT	sp|Q5VT52|RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	581-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O75369-8|FLNB_HUMAN	Isoform 8 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1474-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	160-UNIMOD:21	0.02	15.0	2	1	0
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.05	15.0	1	1	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|Q66K74|MAP1S_HUMAN	Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	759-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	334-UNIMOD:4,337-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	442-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	433-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	307-UNIMOD:21,309-UNIMOD:4	0.02	15.0	2	1	0
PRT	sp|Q9ULH7|MRTFB_HUMAN	Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	921-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9BQ52|RNZ2_HUMAN	Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	736-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	675-UNIMOD:21,686-UNIMOD:4,689-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	188-UNIMOD:21,194-UNIMOD:21	0.04	15.0	2	1	0
PRT	sp|P42702|LIFR_HUMAN	Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1059-UNIMOD:21,1061-UNIMOD:4	0.02	15.0	1	1	1
PRT	sp|Q8WU79|SMAP2_HUMAN	Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	221-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|O75794|CD123_HUMAN	Cell division cycle protein 123 homolog OS=Homo sapiens OX=9606 GN=CDC123 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	289-UNIMOD:4,299-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	235-UNIMOD:21,238-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	629-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,3-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|Q16537|2A5E_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,7-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	15.0	null	62-UNIMOD:4,65-UNIMOD:21,60-UNIMOD:35	0.11	15.0	2	1	0
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	471-UNIMOD:4,481-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	331-UNIMOD:21,334-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	1-UNIMOD:1,3-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	242-UNIMOD:21,256-UNIMOD:21,238-UNIMOD:35	0.09	15.0	2	1	0
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	247-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|O14929|HAT1_HUMAN	Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	361-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1055-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	376-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	567-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	77-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1722-UNIMOD:21	0.00	14.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	607-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	232-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	69-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	235-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	15-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P62873|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	204-UNIMOD:4,207-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	110-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q96CP2|FWCH2_HUMAN	FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	17-UNIMOD:21	0.14	14.0	1	1	1
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	14-UNIMOD:4,16-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	177-UNIMOD:21,330-UNIMOD:21,333-UNIMOD:21	0.03	14.0	3	2	1
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	458-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	978-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	594-UNIMOD:21,597-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	144-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q9H6T3|RPAP3_HUMAN	RNA polymerase II-associated protein 3 OS=Homo sapiens OX=9606 GN=RPAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	491-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	619-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.16	14.0	1	1	1
PRT	sp|Q9Y2T3|GUAD_HUMAN	Guanine deaminase OS=Homo sapiens OX=9606 GN=GDA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	451-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P42566|EPS15_HUMAN	Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	814-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9Y519|T184B_HUMAN	Transmembrane protein 184B OS=Homo sapiens OX=9606 GN=TMEM184B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	403-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q8NFH5|NUP35_HUMAN	Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	93-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q16595|FRDA_HUMAN	Frataxin, mitochondrial OS=Homo sapiens OX=9606 GN=FXN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	158-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	2222-UNIMOD:21,2226-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q86YP4|P66A_HUMAN	Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	100-UNIMOD:21,113-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	76-UNIMOD:21	0.08	14.0	1	1	1
PRT	sp|Q765P7|MTSS2_HUMAN	Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	615-UNIMOD:4,624-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	386-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	152-UNIMOD:21,165-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	43-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q9Y5Q8|TF3C5_HUMAN	General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	200-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	39-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q92585|MAML1_HUMAN	Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	314-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q92503|S14L1_HUMAN	SEC14-like protein 1 OS=Homo sapiens OX=9606 GN=SEC14L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	586-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	363-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	8-UNIMOD:21,25-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:21	0.26	14.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	237-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9P2B4|CT2NL_HUMAN	CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	557-UNIMOD:21,563-UNIMOD:21,568-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|O60762|DPM1_HUMAN	Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,9-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1310-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	291-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	107-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|O95900|TRUB2_HUMAN	Mitochondrial mRNA pseudouridine synthase TRUB2 OS=Homo sapiens OX=9606 GN=TRUB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	299-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	62-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.08	13.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	256-UNIMOD:4,258-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	46-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	295-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	76-UNIMOD:21	0.12	13.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1034-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	147-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	359-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	706-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P49407|ARRB1_HUMAN	Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	410-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q9NR19|ACSA_HUMAN	Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	30-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9NWT8|AKIP_HUMAN	Aurora kinase A-interacting protein OS=Homo sapiens OX=9606 GN=AURKAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	191-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	182-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O43572|AKA10_HUMAN	A-kinase anchor protein 10, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	189-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	668-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9H3U1|UN45A_HUMAN	Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	8-UNIMOD:21,15-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	362-UNIMOD:35,370-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	114-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	24-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	461-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	732-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	784-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	365-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q8IXQ3|CI040_HUMAN	Uncharacterized protein C9orf40 OS=Homo sapiens OX=9606 GN=C9orf40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	67-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	477-UNIMOD:21,483-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O75223|GGCT_HUMAN	Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	136-UNIMOD:21	0.10	13.0	1	1	1
PRT	sp|Q16666|IF16_HUMAN	Gamma-interferon-inducible protein 16 OS=Homo sapiens OX=9606 GN=IFI16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	153-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	462-UNIMOD:21,464-UNIMOD:21,473-UNIMOD:21	0.05	13.0	2	1	0
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.07	13.0	1	1	1
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	1
PRT	sp|Q8NB90|AFG2H_HUMAN	ATPase family protein 2 homolog OS=Homo sapiens OX=9606 GN=SPATA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	398-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	900-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9HDC5|JPH1_HUMAN	Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	413-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	23-UNIMOD:21,30-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	62-UNIMOD:21,69-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q9BTX1|NDC1_HUMAN	Nucleoporin NDC1 OS=Homo sapiens OX=9606 GN=NDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	406-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	302-UNIMOD:35	0.05	13.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	13.0	1	1	1
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	274-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|P51610|HCFC1_HUMAN	Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1205-UNIMOD:21,1216-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O75808|CAN15_HUMAN	Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	332-UNIMOD:21,338-UNIMOD:21,346-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|A6NKF1|SAC31_HUMAN	SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	402-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	363-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	996-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	106-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	737-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q92854-2|SEM4D_HUMAN	Isoform 2 of Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	677-UNIMOD:4,678-UNIMOD:21,682-UNIMOD:21	0.02	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	61.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3353.6	39.74368	3	2508.0724	2508.0760	M	R	2	32
PSM	AAAVAAAGAGEPQSPDELLPK	2	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3926.2	53.97838	3	2083.9817	2083.9822	M	G	2	23
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	3	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3142.6	34.33245	3	2994.259271	2994.261530	K	A	106	138
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	4	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3274.4	37.69118	4	3265.400494	3265.402471	K	-	708	738
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	5	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3361.6	39.9458	3	2508.0724	2508.0760	M	R	2	32
PSM	DYEIESQNPLASPTNTLLGSAK	6	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3943.2	54.2649	3	2427.119771	2427.120667	K	E	618	640
PSM	VPPAPVPCPPPSPGPSAVPSSPK	7	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3223.5	36.41622	3	2379.077471	2378.078288	K	S	366	389
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	8	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3054.6	32.0535	4	3093.274894	3093.277137	R	-	738	768
PSM	AAAVAAAGAGEPQSPDELLPK	9	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	53.76417	3	2083.9817	2083.9822	M	G	2	23
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	10	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3150.4	34.52867	3	2994.259271	2994.261530	K	A	106	138
PSM	IADPEHDHTGFLTEYVATR	11	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3367.2	40.08582	4	2330.961694	2330.961009	R	W	190	209
PSM	DNLTLWTSDTQGDEAEAGEGGEN	12	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.3689.3	48.26988	3	2407.989371	2407.988786	R	-	223	246
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	13	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3506.3	43.592	4	2835.274894	2835.274618	R	T	350	376
PSM	GGNFGGRSSGPYGGGGQYFAK	14	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3114.4	33.59605	3	2099.883371	2099.885068	K	P	278	299
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	15	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	2-UNIMOD:4,16-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.2956.5	29.48923	4	3088.148894	3088.156036	R	A	10	40
PSM	SSSPAPADIAQTVQEDLR	16	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3866.2	52.61863	3	1963.890371	1963.888816	K	T	230	248
PSM	DTQSPSTCSEGLLGWSQK	17	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3645.2	47.13385	3	2059.850471	2059.855802	K	D	709	727
PSM	VPADTEVVCAPPTAYIDFAR	18	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3884.2	53.07227	3	2271.026771	2271.028287	K	Q	71	91
PSM	IADPEHDHTGFLTEYVATR	19	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3378.2	40.35325	4	2330.961694	2330.961009	R	W	190	209
PSM	AIVDALPPPCESACTVPTDVDK	20	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3465.4	42.5266	3	2434.079471	2434.079730	R	W	261	283
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	21	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3449.3	42.11593	4	2988.159294	2988.155727	K	E	144	170
PSM	LVQDVANNTNEEAGDGTTTATVLAR	22	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3183.6	35.38217	3	2639.205371	2639.207584	K	S	97	122
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	23	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3134.6	34.12508	3	2994.259271	2994.261530	K	A	106	138
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	24	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2630.4	21.12252	4	3024.351694	3024.356099	K	S	145	174
PSM	TPEELDDSDFETEDFDVR	25	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3749.3	49.70002	3	2237.853371	2237.852550	R	S	634	652
PSM	DDDIAALVVDNGSGMCK	26	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4266.2	58.91847	3	1900.7624	1900.7579	M	A	2	19
PSM	TPEELDDSDFETEDFDVR	27	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3757.2	49.90805	3	2237.853371	2237.852550	R	S	634	652
PSM	PAETPVATSPTATDSTSGDSSR	28	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2631.3	21.15355	3	2293.897571	2293.898862	K	S	152	174
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	29	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3222.3	36.3856	4	3185.426094	3185.436140	K	-	708	738
PSM	IRYESLTDPSKLDSGK	30	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3070.4	32.45623	3	1887.897071	1887.897924	K	E	54	70
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	31	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3234.5	36.65915	4	3291.348894	3291.357615	R	S	1160	1192
PSM	VTNGAFTGEISPGMIK	32	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3564.3	45.07113	3	1700.781371	1700.784474	K	D	107	123
PSM	DATNVGDEGGFAPNILENK	33	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3545.2	44.59358	3	1959.916571	1959.917400	K	E	203	222
PSM	IADPEHDHTGFLTEYVATR	34	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3262.6	37.38702	3	2250.990971	2250.994678	R	W	190	209
PSM	DNLTLWTSENQGDEGDAGEGEN	35	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3620.5	46.53085	3	2349.944171	2349.946922	R	-	225	247
PSM	GEPAAAAAPEAGASPVEK	36	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2732.4	23.70763	3	1701.759371	1701.761096	K	E	88	106
PSM	NASTFEDVTQVSSAYQK	37	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3329.3	39.11078	3	1953.834071	1953.835718	K	T	320	337
PSM	LYGSAGPPPTGEEDTAEKDEL	38	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3241.2	36.82777	3	2254.947071	2254.951870	K	-	634	655
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	39	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3876.2	52.88518	3	2540.085971	2540.089049	K	S	180	204
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	40	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3455.6	42.27837	3	2988.158471	2988.155727	K	E	144	170
PSM	AAAVAAAGAGEPQSPDELLPK	41	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3904.4	53.5553	3	2083.9817	2083.9822	M	G	2	23
PSM	AAAVAAAGAGEPQSPDELLPK	42	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3936.2	54.17902	3	2083.9817	2083.9822	M	G	2	23
PSM	KAEAGAGSATEFQFR	43	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3051.2	31.96158	3	1648.722071	1648.724651	K	G	150	165
PSM	RADLNQGIGEPQSPSRR	44	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2684.5	22.48085	3	1959.928271	1959.927602	R	V	62	79
PSM	SSGSPYGGGYGSGGGSGGYGSR	45	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2816.5	25.88455	3	1989.744971	1989.749028	R	R	355	377
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	46	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4171.2	57.93188	4	2747.138494	2747.134344	K	D	208	233
PSM	TPSSDVLVFDYTK	47	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3719.6	49.03153	2	1550.691047	1550.690557	K	H	144	157
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	48	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4136.2	57.42013	4	3537.374494	3537.370051	R	V	44	74
PSM	FSGWYDADLSPAGHEEAK	49	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3443.3	41.96212	3	2058.837071	2058.836052	R	R	22	40
PSM	IADPEHDHTGFLTEYVATR	50	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3376.5	40.31348	3	2330.961971	2330.961009	R	W	190	209
PSM	ADLLLSTQPGREEGSPLELER	51	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3556.4	44.87217	3	2389.151771	2389.152635	K	L	593	614
PSM	IACKSPPPESVDTPTSTK	52	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2653.2	21.70572	3	2073.870371	2073.873106	K	Q	1127	1145
PSM	GALQNIIPASTGAAK	53	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3342.4	39.4531	2	1490.746447	1490.749409	R	A	201	216
PSM	LDGLVETPTGYIESLPR	54	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4168.2	57.85685	3	1938.937871	1938.933975	R	V	56	73
PSM	DNLTLWTSDMQGDGEEQNK	55	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3609.4	46.24473	3	2179.929671	2179.932792	R	E	226	245
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	56	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3547.4	44.65048	4	3385.520494	3385.515651	K	A	399	429
PSM	DDDIAALVVDNGSGMCK	57	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3985.2	54.94383	3	1916.7518	1916.7528	M	A	2	19
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	58	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3345.6	39.5378	3	2508.0724	2508.0760	M	R	2	32
PSM	MDSAGQDINLNSPNK	59	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3348.6	39.6158	2	1724.7038	1724.7072	-	G	1	16
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	60	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3713.2	48.87468	4	2749.2320	2749.2301	-	Y	1	25
PSM	GHTDTEGRPPSPPPTSTPEK	61	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2560.2	19.46125	4	2246.923294	2246.924624	R	C	353	373
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	62	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3090.4	32.97452	4	2717.307694	2717.307830	R	R	31	56
PSM	GKEDEGEEAASPMLQIQR	63	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3091.3	32.9971	3	2066.896571	2066.898001	K	D	2400	2418
PSM	GEPAAAAAPEAGASPVEK	64	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2740.4	23.91222	3	1701.759371	1701.761096	K	E	88	106
PSM	EFQDAGEQVVSSPADVAEK	65	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3182.3	35.34677	3	2084.888771	2084.893961	K	A	77	96
PSM	DGLNQTTIPVSPPSTTKPSR	66	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3138.5	34.22632	3	2175.051971	2175.057278	K	A	573	593
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	67	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3202.5	35.87328	4	2853.384494	2853.390968	K	K	62	95
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	68	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2621.5	20.92335	4	3024.351694	3024.356099	K	S	145	174
PSM	GALQNIIPASTGAAK	69	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3334.4	39.24462	2	1490.746447	1490.749409	R	A	201	216
PSM	DMESPTKLDVTLAK	70	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3301.2	38.38213	3	1626.754871	1626.757591	K	D	277	291
PSM	CIPALDSLTPANEDQK	71	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3383.2	40.48278	3	1850.811071	1850.812146	R	I	447	463
PSM	WLDDLLASPPPSGGGAR	72	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4350.2	59.78875	3	1867.793771	1867.790696	R	R	684	701
PSM	KYEQGFITDPVVLSPK	73	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3502.2	43.48437	3	1899.938771	1899.938332	K	D	109	125
PSM	NSDVLQSPLDSAARDEL	74	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3679.2	48.0254	3	1908.844871	1908.846617	K	-	606	623
PSM	LDNVPHTPSSYIETLPK	75	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3492.2	43.22317	3	1989.941771	1989.944874	R	A	45	62
PSM	AAPEASSPPASPLQHLLPGK	76	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3632.3	46.81387	3	2126.976971	2126.980288	K	A	686	706
PSM	KYEQGFITDPVVLSPKDR	77	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3333.2	39.212	4	2171.065294	2171.066387	K	V	109	127
PSM	IADPEHDHTGFLTEYVATR	78	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3258.2	37.26843	4	2250.996094	2250.994678	R	W	190	209
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	79	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3277.5	37.77107	5	3562.497118	3562.491898	K	V	60	92
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	80	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3947.2	54.36632	4	3836.409694	3836.405155	K	A	469	503
PSM	EEEIAALVIDNGSGMCK	81	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5160.2	66.45095	3	1956.8210	1956.8205	M	A	2	19
PSM	PCSEETPAISPSK	82	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2697.6	22.81278	2	1481.6077	1481.6104	M	R	2	15
PSM	DMESPTKLDVTLAK	83	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3122.2	33.7984	3	1642.751471	1642.752506	K	D	277	291
PSM	RADLNQGIGEPQSPSR	84	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2758.2	24.37238	3	1803.825671	1803.826490	R	R	62	78
PSM	IRYESLTDPSKLDSGK	85	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3069.2	32.42463	4	1887.899694	1887.897924	K	E	54	70
PSM	SGKYDLDFKSPDDPSR	86	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3025.2	31.28298	4	1905.816094	1905.814588	R	Y	254	270
PSM	DSENLASPSEYPENGER	87	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3011.3	30.91963	3	1972.764671	1972.768760	R	F	617	634
PSM	SAESPTSPVTSETGSTFKK	88	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3071.5	32.48455	3	2099.868071	2099.870128	K	F	280	299
PSM	VPPAPVPCPPPSPGPSAVPSSPK	89	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3233.3	36.6283	4	2378.075294	2378.078288	K	S	366	389
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	90	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3062.6	32.26203	4	3093.274894	3093.277137	R	-	738	768
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	91	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2595.2	20.25423	5	3104.323618	3104.322430	K	S	145	174
PSM	LGGSPTSLGTWGSWIGPDHDK	92	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3874.2	52.82347	3	2246.999171	2246.999763	K	F	439	460
PSM	NQLTSNPENTVFDAK	93	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3333.3	39.21533	3	1756.767371	1756.766910	K	R	82	97
PSM	NQYDNDVTVWSPQGR	94	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3330.3	39.13766	3	1857.767171	1857.768307	R	I	4	19
PSM	NQYDNDVTVWSPQGR	95	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3322.4	38.93187	3	1857.767171	1857.768307	R	I	4	19
PSM	WLDDLLASPPPSGGGAR	96	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4370.2	59.99252	3	1867.793771	1867.790696	R	R	684	701
PSM	WLDDLLASPPPSGGGAR	97	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4427.2	60.60921	3	1867.793771	1867.790696	R	R	684	701
PSM	DNLTLWTSDQQDDDGGEGNN	98	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3625.2	46.64275	3	2192.872871	2192.873028	R	-	228	248
PSM	FNEEHIPDSPFVVPVASPSGDAR	99	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3718.4	49.00522	3	2626.118471	2626.114215	K	R	2311	2334
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	100	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3763.2	50.06412	4	3756.438094	3756.438824	K	A	469	503
PSM	VPPAPVPCPPPSPGPSAVPSSPK	101	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3215.6	36.21643	3	2379.077471	2378.078288	K	S	366	389
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	102	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3347.2	39.57617	4	2508.0731	2508.0760	M	R	2	32
PSM	AESSESFTMASSPAQR	103	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3276.3	37.73868	3	1806.7105	1806.7126	M	R	2	18
PSM	MEAAGSPAATETGK	104	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.2874.5	27.38358	2	1441.5771	1441.5791	-	Y	1	15
PSM	HARPPDPPASAPPDSSSNSASQDTK	105	sp|Q15642|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2554.3	19.34785	4	2596.115294	2596.119103	R	E	486	511
PSM	NGNGGPGPYVGQAGTATLPR	106	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3131.5	34.04322	3	1962.891371	1962.894904	K	N	185	205
PSM	PENVAPRSGATAGAAGGR	107	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2512.2	18.53675	3	1717.7852	1717.7892	M	G	2	20
PSM	MDATANDVPSPYEVR	108	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3172.2	35.09138	3	1743.715571	1743.717517	K	G	434	449
PSM	ADLNQGIGEPQSPSRR	109	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2766.4	24.58698	3	1803.826271	1803.826490	R	V	63	79
PSM	SAESPTSPVTSETGSTFK	110	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3063.2	32.27427	3	1891.806071	1891.808834	K	K	280	298
PSM	EQPPTEPGPQSASEVEK	111	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2780.4	24.9485	3	1888.805771	1888.809169	R	I	393	410
PSM	NIGRDTPTSAGPNSFNK	112	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2848.2	26.69797	3	1934.787371	1934.792487	K	G	134	151
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	113	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3194.5	35.66413	4	2853.384494	2853.390968	K	K	62	95
PSM	IQQALTSPLPMTPILEGSHR	114	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3751.2	49.75195	4	2348.104094	2348.100086	R	A	421	441
PSM	EAAGGNDSSGATSPINPAVALE	115	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3587.4	45.67327	3	2106.907871	2106.910674	K	-	1236	1258
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	116	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:35,15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3881.2	52.99502	4	2968.325294	2968.325196	R	S	59	86
PSM	DASDDLDDLNFFNQK	117	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4021.2	55.5406	3	1755.759671	1755.758774	K	K	65	80
PSM	CIPALDSLTPANEDQK	118	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3375.2	40.27905	3	1850.811071	1850.812146	R	I	447	463
PSM	WLDDLLASPPPSGGGAR	119	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4410.2	60.40332	3	1867.793771	1867.790696	R	R	684	701
PSM	AEELSPAALSPSLEPIR	120	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3792.3	50.79705	3	1938.873971	1938.874092	R	C	441	458
PSM	GSLESPATDVFGSTEEGEK	121	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3517.4	43.88265	3	2018.835071	2018.835777	K	R	331	350
PSM	ILATPPQEDAPSVDIANIR	122	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3779.3	50.46933	3	2178.992771	2178.996332	K	M	284	303
PSM	DNLTLWTSDQQDDDGGEGNN	123	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3651.3	47.29198	3	2192.872271	2192.873028	R	-	228	248
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	124	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3349.2	39.62857	5	2833.349118	2833.352672	K	S	362	389
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	125	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	44.8755	4	3385.520494	3385.515651	K	A	399	429
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	126	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3280.4	37.84343	5	3562.497118	3562.491898	K	V	60	92
PSM	VPPAPVPCPPPSPGPSAVPSSPK	127	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3241.4	36.83443	3	2379.077471	2378.078288	K	S	366	389
PSM	ATGANATPLDFPSK	128	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3417.2	41.36612	2	1510.6682	1510.6700	M	K	2	16
PSM	MDSAGQDINLNSPNK	129	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3040.2	31.67478	3	1740.7040	1740.7021	-	G	1	16
PSM	TEWETAAPAVAETPDIK	130	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3764.3	50.09002	3	1949.8669	1949.8654	M	L	2	19
PSM	KYEMFAQTLQQSR	131	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3228.2	36.50782	3	1708.760471	1708.764407	R	G	754	767
PSM	TPAAAAAMNLASPR	132	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3114.5	33.59938	2	1420.651647	1420.653400	R	T	2261	2275
PSM	PCSEETPAISPSK	133	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2689.5	22.60382	2	1481.6077	1481.6104	M	R	2	15
PSM	VPSPLEGSEGDGDTD	134	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3105.5	33.3682	2	1553.574647	1553.577043	K	-	413	428
PSM	NIGRDTPTSAGPNSFNK	135	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2856.4	26.91225	3	1934.787371	1934.792487	K	G	134	151
PSM	AMHQAQTMEGCSSPMVVK	136	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2872.4	27.3283	3	2070.833771	2070.839640	K	F	167	185
PSM	NGSLDSPGKQDTEEDEEEDEK	137	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2616.4	20.79525	3	2429.915471	2429.923149	K	D	134	155
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	138	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3061.2	32.2227	5	3093.276118	3093.277137	R	-	738	768
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	139	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.2929.5	28.79203	4	3492.327694	3492.326786	K	A	111	145
PSM	FNEEHIPDSPFVVPVASPSGDAR	140	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3722.2	49.10932	4	2626.117294	2626.114215	K	R	2311	2334
PSM	DNLTLWTSDQQDDDGGEGNN	141	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3691.2	48.32857	3	2192.876471	2192.873028	R	-	228	248
PSM	AEAGAGSATEFQFR	142	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3261.6	37.36122	2	1520.624647	1520.629688	K	G	151	165
PSM	DISSDAFTALDPLGDK	143	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4279.2	59.10677	3	1743.762971	1743.760428	K	E	631	647
PSM	VSHVSTGGGASLELLEGK	144	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3319.2	38.84667	3	1819.868771	1819.871709	K	V	389	407
PSM	VLLPEYGGTKVVLDDK	145	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3451.2	42.16376	3	1824.930971	1824.927433	K	D	71	87
PSM	AAPEASSPPASPLQHLLPGK	146	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3461.4	42.4221	3	2047.015271	2047.013957	K	A	686	706
PSM	DNLTLWTSDQQDEEAGEGN	147	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3651.2	47.28865	3	2120.874071	2120.877051	R	-	228	247
PSM	DNLTLWTSDMQGDGEEQNK	148	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3601.5	46.04083	3	2179.929671	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	149	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3634.2	46.8588	3	2192.872871	2192.873028	R	-	228	248
PSM	LYGSAGPPPTGEEDTAEKDEL	150	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3249.3	37.03822	3	2254.947071	2254.951870	K	-	634	655
PSM	EVSSLEGSPPPCLGQEEAVCTK	151	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3302.6	38.42142	3	2453.043371	2453.049158	K	I	1388	1410
PSM	DNLTLWTSDSAGEECDAAEGAEN	152	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3726.4	49.16908	3	2453.977571	2453.976507	R	-	223	246
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	153	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3441.6	41.92012	3	2573.995871	2573.998594	R	G	239	267
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	154	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3350.2	39.65398	5	2833.349118	2833.352672	K	S	362	389
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	155	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3266.5	37.48847	4	3265.400494	3265.402471	K	-	708	738
PSM	DDDIAALVVDNGSGMCK	156	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4280.2	59.13175	2	1900.7592	1900.7579	M	A	2	19
PSM	EEEIAALVIDNGSGMCK	157	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5131.2	66.2502	3	1956.8210	1956.8205	M	A	2	19
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	158	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3686.5	48.20357	3	2749.2325	2749.2301	-	Y	1	25
PSM	MEAAGSPAATETGK	159	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.2866.5	27.17572	2	1441.5771	1441.5791	-	Y	1	15
PSM	SDEFSLADALPEHSPAK	160	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3807.2	51.17413	3	1934.8295	1934.8294	M	T	2	19
PSM	MDATANDVPSPYEVR	161	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3168.2	34.98773	3	1743.715571	1743.717517	K	G	434	449
PSM	HTGPNSPDTANDGFVR	162	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2778.4	24.89697	3	1763.722571	1763.726442	K	L	99	115
PSM	TPSPKEEDEEPESPPEK	163	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2606.2	20.5397	3	2003.821871	2003.824878	K	K	202	219
PSM	TFDQLTPEESK	164	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2942.4	29.12005	2	1373.572247	1373.575193	K	E	60	71
PSM	GVQVETISPGDGR	165	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2913.5	28.37658	2	1393.6191	1393.6233	M	T	2	15
PSM	GVQVETISPGDGR	166	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2921.5	28.58483	2	1393.6191	1393.6233	M	T	2	15
PSM	AQAAAPASVPAQAPK	167	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2705.3	23.00832	3	1456.708271	1456.707544	K	R	135	150
PSM	KLEDVKNSPTFK	168	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2697.3	22.80278	3	1484.727371	1484.727611	K	S	164	176
PSM	SGSSSPDSEITELK	169	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3120.6	33.75988	2	1515.632047	1515.634164	R	F	571	585
PSM	KQPPVSPGTALVGSQK	170	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2864.3	27.11645	3	1672.852571	1672.854937	R	E	31	47
PSM	KPAAAAAPGTAEKLSPK	171	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2593.2	20.2057	4	1686.873294	1686.870587	K	A	23	40
PSM	MDATANDVPSPYEVR	172	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3164.3	34.88697	3	1743.715571	1743.717517	K	G	434	449
PSM	EVNVSPCPTQPCQLSK	173	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2956.2	29.47923	3	1922.825771	1922.826750	K	G	36	52
PSM	SHSPSSPDPDTPSPVGDSR	174	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2678.4	22.32658	3	2080.776371	2080.777625	R	A	616	635
PSM	DLHQPSLSPASPHSQGFER	175	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3106.2	33.38342	4	2248.932894	2248.930378	K	G	58	77
PSM	APVQPQQSPAAAPGGTDEKPSGK	176	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2575.3	19.83927	3	2297.065271	2297.068906	K	E	9	32
PSM	HTPNTSDNEGSDTEVCGPNSPSK	177	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.2561.2	19.4863	3	2508.960971	2508.970056	K	R	970	993
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	178	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2594.2	20.23002	5	3104.323618	3104.322430	K	S	145	174
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	179	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3258.3	37.27177	4	2619.210494	2619.213536	R	D	175	200
PSM	IMNTFSVVPSPK	180	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3483.6	43.00145	2	1398.660447	1398.661840	R	V	163	175
PSM	ILATPPQEDAPSVDIANIR	181	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3788.3	50.68703	3	2178.992771	2178.996332	K	M	284	303
PSM	GYISPYFINTSK	182	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3659.5	47.50795	2	1468.662647	1468.663948	R	G	222	234
PSM	GYISPYFINTSK	183	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3667.4	47.70883	2	1468.662647	1468.663948	R	G	222	234
PSM	ILTPLVSLDTPGK	184	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4494.2	61.37905	2	1512.725247	1512.724180	K	A	240	253
PSM	ILTFDQLALDSPK	185	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3901.3	53.48527	2	1539.756047	1539.758577	K	G	120	133
PSM	GYISPYFINTSK	186	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3807.3	51.1808	2	1548.627447	1548.630279	R	G	222	234
PSM	SACGNCYLGDAFR	187	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3454.5	42.24988	2	1569.572247	1569.574164	K	C	272	285
PSM	EVAATEEDVTRLPSPTSPFSSLSQDQAATSK	188	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3762.2	50.038	4	3408.501294	3408.501123	K	A	975	1006
PSM	KIFVGGLSPDTPEEK	189	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	39.93247	3	1775.777771	1775.778400	K	I	183	198
PSM	VLLPEYGGTKVVLDDK	190	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3459.2	42.36458	3	1824.930971	1824.927433	K	D	71	87
PSM	VVVAENFDEIVNNENK	191	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3463.2	42.46765	3	1831.891871	1831.895208	K	D	380	396
PSM	WLDDLLASPPPSGGGAR	192	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4325.2	59.57067	3	1867.793771	1867.790696	R	R	684	701
PSM	WLDDLLASPPPSGGGAR	193	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4390.2	60.18797	3	1867.793771	1867.790696	R	R	684	701
PSM	HSGGFLSSPADFSQENK	194	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3302.3	38.41142	3	1886.780171	1886.783623	R	A	772	789
PSM	DATNVGDEGGFAPNILENK	195	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3537.2	44.39277	3	1959.916571	1959.917400	K	E	203	222
PSM	FSGWYDADLSPAGHEEAK	196	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3435.2	41.75398	3	2058.837071	2058.836052	R	R	22	40
PSM	LGLQEGSNNSSPVDFVNNK	197	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3426.2	41.54787	3	2097.930971	2097.936829	K	R	56	75
PSM	AAPEASSPPASPLQHLLPGK	198	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3623.2	46.5943	3	2126.976971	2126.980288	K	A	686	706
PSM	GSGGLFSPSTAHVPDGALGQR	199	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3597.3	45.9301	3	2169.918371	2169.924564	R	D	1023	1044
PSM	VPADTEVVCAPPTAYIDFAR	200	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3875.2	52.85933	3	2271.026771	2271.028287	K	Q	71	91
PSM	LVGQGASAVLLDLPNSGGEAQAK	201	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3879.2	52.96247	3	2354.089571	2354.092023	R	K	30	53
PSM	DNLTLWTSDSAGEECDAAEGAEN	202	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3735.5	49.39088	3	2453.977571	2453.976507	R	-	223	246
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	203	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3449.4	42.11927	3	2573.995871	2573.998594	R	G	239	267
PSM	ASGVAVSDGVIK	204	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	39.8584	2	1223.5754	1223.5794	M	V	2	14
PSM	MEGPLSVFGDR	205	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4928.2	64.8945	2	1328.5455	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	206	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4868.2	64.48542	2	1328.5471	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	207	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4898.2	64.69015	2	1328.5461	1328.5467	-	S	1	12
PSM	SSIGTGYDLSASTFSPDGR	208	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.3821.2	51.53133	3	2038.8506	2038.8516	M	V	2	21
PSM	ADDVDQQQTTNTVEEPLDLIR	209	sp|P62310|LSM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4534.2	61.77488	3	2521.1260	2521.1216	M	L	2	23
PSM	DAEAHPWLSDYDDLTSATYDK	210	sp|P50542|PEX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3790.3	50.73853	3	2493.008471	2492.005696	R	G	302	323
PSM	AGAGSAAVSGAGTPVAGPTGR	211	sp|O95295|SNAPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.2966.4	29.74707	3	1832.8370	1832.8413	M	D	2	23
PSM	SCINLPTVLPGSPSK	212	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3953.2	54.4447	3	1690.8001	1690.7996	M	T	2	17
PSM	VPPAPVPCPPPSPGPSAVPSSPK	213	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3223.3	36.40622	4	2378.075294	2378.078288	K	S	366	389
PSM	EALQDVEDENQ	214	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2898.4	27.98303	2	1288.540447	1288.541905	K	-	245	256
PSM	QQAGAQGPGSADLEDGEMGK	215	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2950.5	29.33217	3	2024.815871	2024.814665	R	R	1064	1084
PSM	TFDQLTPDESK	216	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2930.3	28.8114	2	1359.557047	1359.559543	K	E	71	82
PSM	SSGPYGGGGQYFAK	217	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3094.5	33.08202	2	1454.583247	1454.586761	R	P	285	299
PSM	GEATVSFDDPPSAK	218	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3030.4	31.4201	2	1499.615447	1499.618120	K	A	335	349
PSM	AIEINPDSAQPYK	219	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3140.2	34.26733	2	1524.681847	1524.686140	R	W	174	187
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	220	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21,21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3230.4	36.56592	4	3071.292894	3071.294441	R	V	221	251
PSM	VAAETQSPSLFGSTK	221	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3135.3	34.14073	2	1601.730047	1601.733819	K	L	215	230
PSM	TPKTPKGPSSVEDIK	222	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2706.5	23.04077	3	1662.822971	1662.822968	K	A	234	249
PSM	GEPAAAAAPEAGASPVEK	223	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2724.5	23.50653	3	1701.759371	1701.761096	K	E	88	106
PSM	GQAAVQQLQAEGLSPR	224	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3152.3	34.57557	3	1731.829571	1731.830513	R	F	43	59
PSM	ADLNQGIGEPQSPSRR	225	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2774.4	24.79362	3	1803.826271	1803.826490	R	V	63	79
PSM	DGARPDVTESESGSPEYR	226	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2759.4	24.40483	3	2030.816171	2030.821859	K	Q	425	443
PSM	KGTENGVNGTLTSNVADSPR	227	sp|Q15629|TRAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2804.6	25.57572	3	2095.945571	2095.953542	K	N	348	368
PSM	SAESPTSPVTSETGSTFKK	228	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3079.5	32.69117	3	2099.868071	2099.870128	K	F	280	299
PSM	NQKPSQVNGAPGSPTEPAGQK	229	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2538.2	19.0024	3	2170.995671	2171.000826	K	Q	1255	1276
PSM	ALRTDYNASVSVPDSSGPER	230	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3027.5	31.34533	3	2199.975671	2199.979756	K	I	67	87
PSM	YRDVAECGPQQELDLNSPR	231	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3173.3	35.12053	3	2326.001471	2326.004926	K	N	102	121
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	232	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3083.5	32.79555	4	3173.240494	3173.243468	R	-	738	768
PSM	LVQDVANNTNEEAGDGTTTATVLAR	233	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3175.6	35.18268	3	2639.205371	2639.207584	K	S	97	122
PSM	EVYELLDSPGK	234	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3362.5	39.96817	2	1328.588447	1328.590115	K	V	20	31
PSM	EVYELLDSPGK	235	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3370.2	40.15843	2	1328.588447	1328.590115	K	V	20	31
PSM	DSGFTIVSPLDI	236	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5572.2	69.56862	2	1342.606647	1342.605765	K	-	784	796
PSM	DSGFTIVSPLDI	237	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5545.2	69.3638	2	1342.606647	1342.605765	K	-	784	796
PSM	LDIDSPPITAR	238	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3343.3	39.47578	2	1356.568647	1356.572764	R	N	33	44
PSM	LDIDSPPITAR	239	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3351.3	39.68307	2	1356.568647	1356.572764	R	N	33	44
PSM	DVNSSSPVMLAFK	240	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3653.4	47.34663	2	1473.653647	1473.657483	K	S	28	41
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	241	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3601.6	46.04417	4	2963.272894	2963.274343	R	T	88	114
PSM	GNPTVEVDLFTSK	242	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3574.3	45.3336	2	1485.672047	1485.675241	R	G	16	29
PSM	TKEVYELLDSPGK	243	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3283.2	37.91277	3	1557.728771	1557.732756	K	V	18	31
PSM	ALSSDSILSPAPDAR	244	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3245.4	36.93797	2	1578.725847	1578.729068	R	A	392	407
PSM	HSVTAATPPPSPTSGESGDLLSNLLQSPSSAK	245	sp|Q96QU8|XPO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4084.2	56.48827	4	3292.493694	3292.490164	K	L	198	230
PSM	DVAEAKPELSLLGDGDH	246	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3384.3	40.51218	3	1764.852071	1764.853008	R	-	232	249
PSM	KYEMFAQTLQQSR	247	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3306.3	38.51023	3	1788.728171	1788.730738	R	G	754	767
PSM	RIDFIPVSPAPSPTR	248	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3620.2	46.52085	3	1811.834771	1811.837252	K	G	136	151
PSM	SESVPPVTDWAWYK	249	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4263.2	58.87105	3	1823.722271	1823.720885	K	I	244	258
PSM	SESVPPVTDWAWYK	250	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4249.2	58.66645	3	1823.722271	1823.720885	K	I	244	258
PSM	CIPALDSLTPANEDQK	251	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3391.3	40.69577	3	1850.811071	1850.812146	R	I	447	463
PSM	FDRGYISPYFINTSK	252	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3565.2	45.09378	3	1886.855771	1886.860416	K	G	219	234
PSM	PEIVDTCSLASPASVCR	253	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3339.2	39.36817	3	1940.8349	1940.8368	M	T	2	19
PSM	SSSPAPADIAQTVQEDLR	254	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3596.2	45.90083	3	2043.851471	2043.855147	K	T	230	248
PSM	GPKVDIDTPDINIEGSEGK	255	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3271.3	37.6126	3	2062.941671	2062.945997	K	F	3709	3728
PSM	DRYMSPMEAQEFGILDK	256	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3733.2	49.32832	3	2108.895671	2108.894829	R	V	227	244
PSM	QQPPEPEWIGDGESTSPSDK	257	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3321.4	38.90497	3	2262.928571	2262.931803	K	V	7	27
PSM	VPADTEVVCAPPTAYIDFAR	258	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3893.3	53.28243	3	2271.026771	2271.028287	K	Q	71	91
PSM	DNLTLWTSDTQGDEAEAGEGGEN	259	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3698.2	48.49115	3	2407.989371	2407.988786	R	-	223	246
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	260	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3351.2	39.67973	5	2833.349118	2833.352672	K	S	362	389
PSM	DDDIAALVVDNGSGMCK	261	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3996.2	55.1487	3	1916.7518	1916.7528	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	262	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3970.2	54.72958	3	1916.7518	1916.7528	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	263	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4020.3	55.51538	2	1820.7929	1820.7915	M	A	2	19
PSM	SPAVATSTAAPPPPSSPLPSK	264	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2938.5	29.01878	3	2038.993871	2038.997638	K	S	439	460
PSM	MEGPLSVFGDR	265	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4844.2	64.28073	2	1328.5471	1328.5467	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	266	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3823.3	51.58345	3	2831.1962	2829.1962	-	Y	1	25
PSM	AAAVAAAGAGEPQSPDELLPK	267	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3896.3	53.3574	3	2083.9817	2083.9822	M	G	2	23
PSM	ADTSQEICSPRLPISASHSSK	268	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3105.2	33.3582	4	2430.028894	2430.028771	K	T	1020	1041
PSM	STGCDFAVSPK	269	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2903.5	28.11675	2	1247.486447	1247.489355	K	L	501	512
PSM	TPAAAAAMNLASPR	270	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3106.5	33.39342	2	1420.651647	1420.653400	R	T	2261	2275
PSM	SESPKEPEQLRK	271	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2547.3	19.19093	3	1506.705371	1506.707938	K	L	4	16
PSM	HGGPGPGGPEPELSPITEGSEAR	272	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3141.5	34.30323	3	2307.011771	2307.016870	R	A	554	577
PSM	TPKTPKGPSSVEDIK	273	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2698.4	22.83163	3	1662.822971	1662.822968	K	A	234	249
PSM	IDEMPEAAVKSTANK	274	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2868.2	27.21762	3	1682.752271	1682.758653	R	Y	30	45
PSM	LIAPVAEEEATVPNNK	275	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3103.3	33.31023	3	1693.887371	1693.888666	K	I	8	24
PSM	GEPAAAAAPEAGASPVEK	276	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2748.2	24.11337	3	1701.759371	1701.761096	K	E	88	106
PSM	MDATANDVPSPYEVR	277	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3064.2	32.2996	3	1759.710971	1759.712432	K	G	434	449
PSM	HAEPLTDTGSETPTAR	278	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2660.3	21.86762	3	1761.753371	1761.757074	K	R	51	67
PSM	TDSVIIADQTPTPTR	279	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3087.2	32.88982	3	1773.759071	1773.758727	R	F	42	57
PSM	SADGSAPAGEGEGVTLQR	280	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2902.2	28.08042	3	1780.759571	1780.762887	K	N	31	49
PSM	IRYESLTDPSKLDSGK	281	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3062.3	32.25203	3	1887.897071	1887.897924	K	E	54	70
PSM	SERPPTILMTEEPSSPK	282	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3167.4	34.96848	3	1977.905171	1977.911860	K	G	1080	1097
PSM	ATAQDNPKSATEQSGTGIR	283	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2586.3	20.04188	3	2010.897071	2010.900778	K	S	511	530
PSM	IACKSPPPESVDTPTSTK	284	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2662.5	21.91605	3	2073.870371	2073.873106	K	Q	1127	1145
PSM	IACKSPPPESVDTPTSTK	285	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2645.2	21.501	3	2073.870371	2073.873106	K	Q	1127	1145
PSM	QEEEAAQQGPVVVSPASDYK	286	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3047.4	31.86402	3	2210.970971	2210.973274	R	D	145	165
PSM	TAAKGEAAAERPGEAAVASSPSK	287	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2541.3	19.07785	4	2235.052494	2235.053256	K	A	8	31
PSM	TVGTPIASVPGSTNTGTVPGSEK	288	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3130.4	34.01387	3	2236.058471	2236.062423	R	D	270	293
PSM	GSLAEAVGSPPPAATPTPTPPTR	289	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3212.5	36.1347	3	2331.047471	2331.054910	R	K	446	469
PSM	NGSLDSPGKQDTEEDEEEDEKDK	290	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2609.5	20.61362	3	2673.038171	2673.045055	K	G	134	157
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	291	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3060.2	32.19665	5	3093.276118	3093.277137	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	292	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3092.5	33.0297	4	3173.240494	3173.243468	R	-	738	768
PSM	KIFVGGLSPDTPEEK	293	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3353.3	39.73368	3	1775.777771	1775.778400	K	I	183	198
PSM	EGLELLKTAIGK	294	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3430.4	41.6385	2	1350.714647	1350.715984	K	A	222	234
PSM	EAAGGNDSSGATSPINPAVALE	295	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3587.3	45.66993	3	2106.907871	2106.910674	K	-	1236	1258
PSM	SLVSVTKEGLELPEDEEEK	296	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3669.4	47.76137	3	2210.024471	2210.024307	K	K	405	424
PSM	ILTPLVSLDTPGK	297	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4517.2	61.6016	2	1512.725247	1512.724180	K	A	240	253
PSM	SLTNDWEDHLAVK	298	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3474.2	42.75471	3	1606.703471	1606.702853	K	H	315	328
PSM	RASGQAFELILSPR	299	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3532.2	44.26648	3	1623.811871	1623.813407	K	S	14	28
PSM	VGIDTPDIDIHGPEGK	300	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3268.2	37.53115	3	1741.788971	1741.792396	K	L	4560	4576
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	301	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4060.2	56.05325	4	3681.645294	3681.639334	K	K	213	250
PSM	ASSTSPVEISEWLDQK	302	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3893.2	53.27243	3	1855.825571	1855.824091	K	L	188	204
PSM	NQYDNDVTVWSPQGR	303	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3338.2	39.34225	3	1857.767171	1857.768307	R	I	4	19
PSM	KTDPSSLGATSASFNFGK	304	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3262.3	37.37702	3	1893.849371	1893.850974	K	K	258	276
PSM	LDNVPHTPSSYIETLPK	305	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3484.3	43.01777	3	1989.941771	1989.944874	R	A	45	62
PSM	GSLESPATDVFGSTEEGEK	306	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3509.3	43.67062	3	2018.835071	2018.835777	K	R	331	350
PSM	DALGDSLQVPVSPSSTTSSR	307	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3441.2	41.90678	3	2082.944171	2082.947059	R	C	141	161
PSM	DNLTLWTSDMQGDGEEQNK	308	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3365.3	40.03955	3	2195.926871	2195.927707	R	E	226	245
PSM	IADPEHDHTGFLTEYVATR	309	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3254.5	37.1745	3	2250.990971	2250.994678	R	W	190	209
PSM	SGEEDFESLASQFSDCSSAK	310	sp|Q13526|PIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3918.3	53.8653	3	2259.849671	2259.851504	K	A	98	118
PSM	DSGSDEDFLMEDDDDSDYGSSK	311	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3464.5	42.50382	3	2427.867071	2427.865619	K	K	129	151
PSM	NALFPEVFSPTPDENSDQNSR	312	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3994.2	55.0982	3	2443.035371	2443.032914	R	S	567	588
PSM	GGPGSAVSPYPTFNPSSDVAALHK	313	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3643.6	47.09563	3	2515.080371	2515.082187	K	A	30	54
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	314	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4076.2	56.34612	3	2540.091671	2540.089049	K	S	180	204
PSM	QSKPVTTPEEIAQVATISANGDK	315	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3348.5	39.61246	3	2543.150771	2543.155746	K	E	158	181
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	316	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4596.2	62.326	3	2620.060271	2620.055380	K	S	180	204
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	317	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3348.2	39.60247	5	2833.349118	2833.352672	K	S	362	389
PSM	EEEIAALVIDNGSGMCK	318	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4644.2	62.76277	3	1972.8158	1972.8154	M	A	2	19
PSM	MEGPLSVFGDR	319	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4069.2	56.24278	2	1344.5405	1344.5416	-	S	1	12
PSM	TEWETAAPAVAETPDIK	320	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3772.2	50.29757	3	1949.8669	1949.8654	M	L	2	19
PSM	AGAGSAAVSGAGTPVAGPTGR	321	sp|O95295|SNAPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.2974.3	29.953	3	1832.8370	1832.8413	M	D	2	23
PSM	CNTPTYCDLGK	322	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3154.6	34.63665	2	1449.5245	1449.5300	M	A	2	13
PSM	YNEQHVPGSPFTAR	323	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3000.2	30.62905	3	1681.723571	1681.724985	K	V	1938	1952
PSM	KKPRPPPALGPEETSASAGLPK	324	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	27.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2869.3	27.24692	4	2307.1928941913206	2307.1987970448195	K	K	14	36
PSM	GASLKSPLPSQ	325	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2917.2	28.47065	2	1163.556447	1163.558755	K	-	113	124
PSM	STGCDFAVSPK	326	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2895.4	27.90543	2	1247.486447	1247.489355	K	L	501	512
PSM	DSAQNSVIIVDK	327	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2932.2	28.85907	2	1287.662447	1287.667045	K	N	194	206
PSM	NSLDCEIVSAK	328	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3019.4	31.13272	2	1314.549847	1314.552684	K	S	423	434
PSM	NNASTDYDLSDK	329	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2725.4	23.52918	2	1341.565047	1341.568454	K	S	301	313
PSM	SAESPTSPVTSETGSTFKK	330	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2901.4	28.06137	3	2019.899171	2019.903797	K	F	280	299
PSM	NAEAVLQSPGLSGK	331	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3046.4	31.83787	2	1449.683847	1449.686475	R	V	849	863
PSM	AMSTTSISSPQPGK	332	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2718.6	23.3544	2	1470.638447	1470.642561	R	L	267	281
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	333	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3188.4	35.50412	4	3054.245694	3054.246274	K	N	1928	1956
PSM	VPSPLEGSEGDGDTD	334	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3097.5	33.16033	2	1553.574647	1553.577043	K	-	413	428
PSM	GRTVIIEQSWGSPK	335	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3146.2	34.42213	3	1636.792571	1636.797422	K	V	59	73
PSM	GEPAAAAAPEAGASPVEK	336	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2756.3	24.32398	3	1701.759371	1701.761096	K	E	88	106
PSM	DVQDSLTVSNEAQTAK	337	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2974.2	29.94967	3	1784.778671	1784.782954	K	E	211	227
PSM	ADLNQGIGEPQSPSRR	338	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2774.2	24.78695	4	1803.824094	1803.826490	R	V	63	79
PSM	SRLTPVSPESSSTEEK	339	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2698.5	22.8383	3	1892.781371	1892.780585	R	S	266	282
PSM	NGNGGPGPYVGQAGTATLPR	340	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3123.6	33.83727	3	1962.891371	1962.894904	K	N	185	205
PSM	VTAEADSSSPTGILATSESK	341	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3176.3	35.19705	3	2029.904471	2029.909277	K	S	486	506
PSM	VTAEADSSSPTGILATSESK	342	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3168.3	34.99107	3	2029.904471	2029.909277	K	S	486	506
PSM	AIGSASEGAQSSLQEVYHK	343	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3180.4	35.29925	3	2040.908771	2040.915365	R	S	169	188
PSM	NGSLDSPGKQDTEEDEEEDEK	344	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2654.4	21.7308	3	2429.918171	2429.923149	K	D	134	155
PSM	PAEKPAETPVATSPTATDSTSGDSSR	345	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2639.5	21.34992	3	2719.121771	2719.126296	K	S	148	174
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	346	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2918.4	28.5031	5	3112.507118	3112.507789	R	S	847	876
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	347	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	30-UNIMOD:21	ms_run[1]:scan=1.1.3067.6	32.3883	5	3704.515618	3704.512278	K	-	158	196
PSM	SADTLWGIQK	348	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3472.2	42.70265	2	1197.543447	1197.543105	K	E	319	329
PSM	SADTLWDIQK	349	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3535.2	44.3425	2	1255.544247	1255.548584	K	D	320	330
PSM	SADTLWDIQK	350	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3543.2	44.54372	2	1255.544247	1255.548584	K	D	320	330
PSM	SQIFSTASDNQPTVTIK	351	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3311.2	38.63727	3	1915.889771	1915.892839	K	V	448	465
PSM	DAGQISGLNVLR	352	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3573.3	45.3047	2	1321.635647	1321.639131	K	V	207	219
PSM	DAGQISGLNVLR	353	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3565.3	45.09712	2	1321.635647	1321.639131	K	V	207	219
PSM	IMNTFSVVPSPK	354	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3491.4	43.20378	2	1398.660447	1398.661840	R	V	163	175
PSM	TVIIEQSWGSPK	355	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3347.4	39.58283	2	1423.671447	1423.674847	R	V	61	73
PSM	NLEQILNGGESPK	356	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3568.4	45.17813	2	1477.676647	1477.681389	K	Q	219	232
PSM	IFVGGLSPDTPEEK	357	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3512.4	43.7587	2	1647.682047	1647.683437	K	I	184	198
PSM	CVWSPLASPSTSILK	358	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4387.2	60.14152	3	1804.786571	1804.787191	R	R	2169	2184
PSM	AQSPGAVEEILDRENK	359	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3372.2	40.21	3	1834.846871	1834.846223	R	R	7	23
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	360	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4039.3	55.84378	4	3681.645294	3681.639334	K	K	213	250
PSM	WLDDLLASPPPSGGGAR	361	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4299.2	59.3664	3	1867.793771	1867.790696	R	R	684	701
PSM	NSDVLQSPLDSAARDEL	362	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3671.5	47.81623	2	1908.843647	1908.846617	K	-	606	623
PSM	LDGLVETPTGYIESLPR	363	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4151.2	57.6457	3	1938.937871	1938.933975	R	V	56	73
PSM	FDRGYISPYFINTSK	364	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3675.2	47.90922	3	1966.826471	1966.826747	K	G	219	234
PSM	LDNVPHTPSSYIETLPK	365	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3500.4	43.43848	3	1989.941771	1989.944874	R	A	45	62
PSM	LYGPSSVSFADDFVRSSK	366	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3778.3	50.44702	3	2120.884871	2120.885719	R	Q	134	152
PSM	AAPEASSPPASPLQHLLPGK	367	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3607.3	46.19	3	2126.976971	2126.980288	K	A	686	706
PSM	DGYADIVDVLNSPLEGPDQK	368	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4438.3	60.71264	3	2224.002971	2223.993675	K	S	287	307
PSM	GFFICDQPYEPVSPYSCK	369	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3830.5	51.76439	3	2272.918271	2272.921045	R	E	676	694
PSM	IADPEHDHTGFLTEYVATR	370	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3359.5	39.8905	3	2330.961971	2330.961009	R	W	190	209
PSM	IADPEHDHTGFLTEYVATR	371	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3370.4	40.17177	2	2330.959447	2330.961009	R	W	190	209
PSM	VKSATLSSTESTASEMQEEMK	372	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3260.6	37.334	3	2353.006271	2353.006624	K	G	638	659
PSM	RGFFICDQPYEPVSPYSCK	373	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:4,14-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3594.5	45.8623	3	2429.019071	2429.022156	R	E	675	694
PSM	QSKPVTTPEEIAQVATISANGDK	374	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3316.5	38.77803	3	2463.183671	2463.189415	K	E	158	181
PSM	VMTIPYQPMPASSPVICAGGQDR	375	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3668.3	47.73157	4	2554.144894	2554.141953	R	C	178	201
PSM	EEEIAALVIDNGSGMCK	376	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4621.2	62.55985	3	1972.8158	1972.8154	M	A	2	19
PSM	ASGVAVSDGVIK	377	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3177.2	35.21817	2	1143.6091	1143.6130	M	V	2	14
PSM	MEGPLSVFGDR	378	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4059.3	56.02785	2	1344.5405	1344.5416	-	S	1	12
PSM	DAPTSPASVASSSSTPSSK	379	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2742.5	23.96738	3	1844.8142	1842.7882	K	T	282	301
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	380	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3448.3	42.09087	4	2765.2244	2765.2250	-	Y	1	25
PSM	AAAVAAAGAGEPQSPDELLPK	381	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3887.2	53.13972	3	2083.9817	2083.9822	M	G	2	23
PSM	SDEFSLADALPEHSPAK	382	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3799.3	50.97007	3	1934.8295	1934.8294	M	T	2	19
PSM	SCINLPTVLPGSPSK	383	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3942.2	54.23942	3	1690.8001	1690.7996	M	T	2	17
PSM	APGTPHSHTKPYVR	384	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2386.2	17.36283	4	1626.767694	1626.766791	K	S	155	169
PSM	GASLKSPLPSQ	385	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2909.5	28.27237	2	1163.556447	1163.558755	K	-	113	124
PSM	VPPAPVPCPPPSPGPSAVPSSPK	386	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3215.2	36.2031	4	2378.075294	2378.078288	K	S	366	389
PSM	DPNSPLYSVK	387	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3035.3	31.54752	2	1198.524847	1198.527120	R	S	82	92
PSM	HGEVCPAGWKPGSDTIKPDVQK	388	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.2941.5	29.09705	4	2485.146494	2485.146110	K	S	169	191
PSM	IACRSPQPDPVGTPTIFKPQSK	389	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3231.4	36.58335	4	2583.189294	2583.195777	K	R	2219	2241
PSM	NGSLDSPGKQDTEEDEEEDEKDK	390	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2571.2	19.73842	4	2673.043294	2673.045055	K	G	134	157
PSM	SAESPTSPVTSETGSTFKK	391	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2893.5	27.85762	3	2019.899171	2019.903797	K	F	280	299
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	392	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3082.4	32.76658	4	2717.307694	2717.307830	R	R	31	56
PSM	GIETPQCDQSTGQCVCVEGVEGPR	393	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,7-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3237.5	36.7336	4	2742.104094	2742.108481	R	C	1138	1162
PSM	NAEAVLQSPGLSGK	394	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3054.5	32.05017	2	1449.683847	1449.686475	R	V	849	863
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	395	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	20-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3165.4	34.9172	4	2991.324494	2991.328110	R	V	221	251
PSM	GEATVSFDDPPSAK	396	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3022.4	31.21155	2	1499.615447	1499.618120	K	A	335	349
PSM	SSSPVQVEEEPVR	397	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2858.6	26.97078	2	1521.667847	1521.671219	R	L	116	129
PSM	ELQAAGKSPEDLER	398	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2805.5	25.59842	3	1621.732571	1621.734881	K	L	448	462
PSM	KPAAAAAPGTAEKLSPK	399	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2617.2	20.81078	3	1766.835071	1766.836918	K	A	23	40
PSM	RLYPAVDEQETPLPR	400	sp|Q96S59|RANB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3120.3	33.74988	3	1862.889971	1862.892779	K	S	153	168
PSM	DNEESEQPPVPGTPTLR	401	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3104.4	33.33943	3	1944.845471	1944.846617	K	N	634	651
PSM	NGVIQHTGAAAEEFNDDTD	402	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3071.4	32.48122	3	2082.814571	2082.816773	R	-	646	665
PSM	AKPSPAPPSTTTAPDASGPQK	403	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2617.3	20.82078	3	2084.973671	2084.977965	K	R	32	53
PSM	PAEKPAETPVATSPTATDSTSGDSSR	404	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2630.5	21.12585	3	2719.121771	2719.126296	K	S	148	174
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	405	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	21-UNIMOD:21	ms_run[1]:scan=1.1.2904.2	28.13257	5	2769.241618	2769.239553	K	V	100	125
PSM	ELAQRQEEEAAQQGPVVVSPASDYK	406	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3083.3	32.78888	4	2808.295694	2808.296734	K	D	140	165
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	407	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3126.6	33.91595	3	2994.259271	2994.261530	K	A	106	138
PSM	VPPAPVPCPPPSPGPSAVPSSPK	408	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3257.3	37.24603	4	2378.075294	2378.078288	K	S	366	389
PSM	KYEQGFITDPVVLSPK	409	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3494.3	43.27873	3	1899.938771	1899.938332	K	D	109	125
PSM	DLFSLDSEDPSPASPPLR	410	sp|Q9BTK6|PAGR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4040.2	55.86847	3	2021.901671	2021.898318	R	S	224	242
PSM	DATNVGDEGGFAPNILENK	411	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3670.3	47.7837	3	2039.880071	2039.883731	K	E	203	222
PSM	ESVPEFPLSPPK	412	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3595.3	45.87827	2	1405.650247	1405.653049	K	K	30	42
PSM	TSSLAPVVGTTTTTPSPSAIK	413	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3405.2	41.06027	3	2175.007571	2175.011313	K	A	226	247
PSM	GYISPYFINTSK	414	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3815.3	51.39417	2	1548.627447	1548.630279	R	G	222	234
PSM	MLAESDESGDEESVSQTDKTELQNTLR	415	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3281.4	37.86863	4	3107.312494	3107.312580	K	T	186	213
PSM	IFVGGLSPDTPEEK	416	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3335.5	39.27398	2	1567.712847	1567.717106	K	I	184	198
PSM	VSASPLLYTLIEK	417	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4294.2	59.27868	3	1592.751971	1592.750395	K	T	496	509
PSM	RASGQAFELILSPR	418	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3524.2	44.0583	3	1623.811871	1623.813407	K	S	14	28
PSM	RASGQAFELILSPR	419	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3540.2	44.46828	3	1623.811871	1623.813407	K	S	14	28
PSM	DMESPTKLDVTLAK	420	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3293.2	38.17445	3	1626.754871	1626.757591	K	D	277	291
PSM	QSKPVTTPEEIAQVATISANGDK	421	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3407.6	41.1193	3	2463.186971	2463.189415	K	E	158	181
PSM	GVLFGVPGAFTPGCSK	422	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3932.2	54.09445	3	1672.766771	1672.768430	K	T	87	103
PSM	YEQGFITDPVVLSPK	423	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3734.2	49.36526	3	1771.842371	1771.843369	K	D	110	125
PSM	DMASPNWSILPEEER	424	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3918.2	53.8553	3	1852.770371	1852.770281	R	N	327	342
PSM	DMASPNWSILPEEER	425	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3743.4	49.58102	3	1868.765171	1868.765196	R	N	327	342
PSM	HSGGFLSSPADFSQENK	426	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3294.4	38.20723	3	1886.780171	1886.783623	R	A	772	789
PSM	FDRGYISPYFINTSK	427	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3557.2	44.89034	3	1886.855771	1886.860416	K	G	219	234
PSM	LSGSNPYTTVTPQIINSK	428	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3332.3	39.18937	3	1998.962771	1998.966338	K	W	605	623
PSM	TQDPAKAPNTPDILEIEFKK	429	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3442.3	41.93628	4	2334.148094	2334.150844	K	G	210	230
PSM	QSKPVTTPEEIAQVATISANGDK	430	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3308.5	38.56903	3	2463.183671	2463.189415	K	E	158	181
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	431	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3386.6	40.57488	4	3199.396094	3199.394275	K	N	213	241
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	432	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3383.3	40.48612	4	3199.396094	3199.394275	K	N	213	241
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	433	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3275.3	37.71317	5	3562.497118	3562.491898	K	V	60	92
PSM	VPPAPVPCPPPSPGPSAVPSSPK	434	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3249.5	37.04488	3	2379.077471	2378.078288	K	S	366	389
PSM	NAVITVPAYFNDSQR	435	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3695.2	48.4143	3	1773.810071	1773.808715	K	Q	188	203
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	436	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3695.5	48.4243	3	2749.2325	2749.2301	-	Y	1	25
PSM	ASGADSKGDDLSTAILK	437	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,2-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3562.3	45.0191	3	1849.7719	1849.7742	M	Q	2	19
PSM	AASEAAVVSSPSLK	438	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3227.2	36.4838	2	1437.6663	1437.6747	M	T	2	16
PSM	SISQSSTDSYSSAASYTDSSDDEVSPREK	439	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3016.5	31.05742	4	3165.272894	3165.278302	R	Q	66	95
PSM	SPAVATSTAAPPPPSSPLPSK	440	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2933.2	28.88468	4	2038.995694	2038.997638	K	S	439	460
PSM	GPPASSPAPAPKFSPVTPK	441	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3161.2	34.8051	4	2071.881694	2071.882228	R	F	254	273
PSM	GHTDTEGRPPSPPPTSTPEK	442	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2550.2	19.24753	4	2246.923294	2246.924624	R	C	353	373
PSM	LALGDDSPALK	443	sp|P17174|AATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3136.3	34.16739	2	1178.555847	1178.558421	R	E	87	98
PSM	SASWGSADQLK	444	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3084.2	32.81183	2	1228.508247	1228.512533	R	E	221	232
PSM	HTGPNSPDTANDGFVR	445	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2851.5	26.78588	3	1843.690571	1843.692773	K	L	99	115
PSM	LDIDSPPITAR	446	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3221.2	36.35833	2	1276.601447	1276.606433	R	N	33	44
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	447	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3147.2	34.4475	4	2621.141694	2621.141158	K	I	50	74
PSM	HSPNLSFEPNFCQDNPRSPTSSK	448	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3201.4	35.84375	4	2725.161694	2725.159194	K	E	107	130
PSM	NGSLDSPGKQDTEEDEEEDEKDK	449	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2611.5	20.66808	4	2753.009294	2753.011386	K	G	134	157
PSM	NGEVVHTPETSV	450	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2874.4	27.38025	2	1427.531647	1427.537107	K	-	454	466
PSM	TPQAPASANLVGPR	451	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2941.2	29.08705	3	1457.699171	1457.702793	R	S	2329	2343
PSM	AEKQEDSESSEEESDSEEAAASPAQVK	452	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2666.3	22.0229	4	2946.172894	2946.177526	K	T	756	783
PSM	QSPASPPPLGGGAPVR	453	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3013.2	30.96867	3	1566.755171	1566.755557	R	T	1444	1460
PSM	HSGPNSADSANDGFVR	454	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2718.3	23.3444	3	1709.675171	1709.679492	K	L	99	115
PSM	KVPQVSTPTLVEVSR	455	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3160.2	34.7797	3	1718.895371	1718.896802	K	N	438	453
PSM	LKGEATVSFDDPPSAK	456	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2978.4	30.06067	3	1740.795071	1740.797147	K	A	333	349
PSM	TSSVSNPQDSVGSPCSR	457	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2671.3	22.14257	3	1843.740071	1843.740772	K	V	94	111
PSM	EQPPTEPGPQSASEVEK	458	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2772.2	24.73823	3	1888.805771	1888.809169	R	I	393	410
PSM	NHSDSSTSESEVSSVSPLK	459	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2807.3	25.64378	3	2055.861671	2055.863389	K	N	211	230
PSM	VKLESPTVSTLTPSSPGK	460	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3166.5	34.94584	3	2066.893871	2066.897937	R	L	290	308
PSM	GPPASSPAPAPKFSPVTPK	461	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3162.4	34.83835	3	2071.879871	2071.882228	R	F	254	273
PSM	EYIPGQPPLSQSSDSSPTR	462	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3184.5	35.40396	3	2124.932471	2124.936495	K	N	871	890
PSM	TVEVAEGEAVRTPQSVTAK	463	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2980.4	30.11307	3	2130.953471	2130.959947	R	Q	132	151
PSM	TPSPKEEDEEPESPPEKK	464	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2522.2	18.69348	3	2131.915571	2131.919841	K	T	202	220
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	465	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2629.2	21.0913	5	3024.355618	3024.356099	K	S	145	174
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	466	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3046.5	31.8412	4	3093.274894	3093.277137	R	-	738	768
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	467	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2592.5	20.19015	5	3104.323618	3104.322430	K	S	145	174
PSM	IADPEHDHTGFLTEYVATR	468	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3388.3	40.61668	4	2330.961694	2330.961009	R	W	190	209
PSM	GQLTNIVSPTAATTPR	469	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3270.2	37.5837	3	1785.804671	1785.806346	K	I	993	1009
PSM	RIDFTPVSPAPSPTR	470	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3248.3	37.0123	3	1799.796071	1799.800867	K	G	108	123
PSM	VYWDNGAQIISPHDK	471	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	38.40808	3	1821.805871	1821.808715	K	G	176	191
PSM	AEEYEFLTPVEEAPK	472	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3589.2	45.71917	3	1830.793871	1830.796479	R	G	153	168
PSM	SASYKYSEEANNLIEECEQAER	473	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3559.3	44.9433	4	2699.105294	2699.105821	K	L	115	137
PSM	DNALLSAIEESR	474	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4036.2	55.7703	2	1396.623047	1396.623540	K	K	107	119
PSM	NLSSPFIFHEK	475	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3446.4	42.04328	2	1397.635647	1397.638068	R	T	644	655
PSM	IMNTFSVVPSPK	476	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3466.4	42.55293	2	1398.660447	1398.661840	R	V	163	175
PSM	IMNTFSVVPSPK	477	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3475.4	42.78718	2	1398.660447	1398.661840	R	V	163	175
PSM	DVEDFLSPLLGK	478	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.5581.2	69.64222	2	1411.664647	1411.663614	K	T	123	135
PSM	EFSPFGTITSAK	479	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3870.5	52.72737	2	1443.571647	1443.572430	K	V	313	325
PSM	IMNTFSVVPSPK	480	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3610.2	46.26463	2	1478.625247	1478.628171	R	V	163	175
PSM	DSPESPFEVIIDK	481	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3913.3	53.77417	2	1554.685847	1554.685472	K	A	242	255
PSM	GNPTVEVDLFTSK	482	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3738.4	49.46907	2	1565.641047	1565.641572	R	G	16	29
PSM	TQVLSPDSLFTAK	483	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3967.2	54.69165	2	1565.676047	1565.677958	K	F	1717	1730
PSM	SACGNCYLGDAFR	484	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3446.6	42.04995	2	1569.572247	1569.574164	K	C	272	285
PSM	DMSPLSETEMALGK	485	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3869.5	52.70228	2	1587.655047	1587.656162	K	D	505	519
PSM	DWALSSAAAVMEER	486	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3956.2	54.5221	3	1614.672371	1614.674924	K	K	547	561
PSM	GVLFGVPGAFTPGCSK	487	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3919.2	53.88093	3	1672.766771	1672.768430	K	T	87	103
PSM	DDGLFSGDPNWFPK	488	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4566.2	62.0809	2	1673.679447	1673.676304	R	K	140	154
PSM	SESVPPVTDWAWYK	489	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4006.3	55.32742	3	1743.755471	1743.754554	K	I	244	258
PSM	NQLTSNPENTVFDAK	490	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3325.3	39.00692	3	1756.767371	1756.766910	K	R	82	97
PSM	VSSGYVPPPVATPFSSK	491	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3324.3	38.98055	3	1798.851371	1798.854268	R	S	168	185
PSM	TWTTPEVTSPPPSPR	492	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3293.3	38.17778	3	1811.748371	1811.753248	R	T	125	140
PSM	SYELPDGQVITIGNER	493	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3869.2	52.69228	3	1869.849671	1869.850974	K	F	241	257
PSM	SLSTSGESLYHVLGLDK	494	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4126.2	57.1953	3	1884.887171	1884.887025	R	N	8	25
PSM	DSGPLPTPPGVSLLGEPPK	495	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4017.2	55.45798	3	1936.957271	1936.954711	K	D	482	501
PSM	AEELSPAALSPSLEPIR	496	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3784.2	50.57675	3	1938.873971	1938.874092	R	C	441	458
PSM	YFEADPPGQVAASPDPTT	497	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3328.3	39.08493	3	1941.800771	1941.803355	R	-	157	175
PSM	NVSSFPDDATSPLQENR	498	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3238.4	36.75583	3	1955.823071	1955.826216	R	N	52	69
PSM	DFAARSPSASITDEDSNV	499	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3265.3	37.45602	3	1960.805471	1960.805146	K	-	994	1012
PSM	SSSPAPADIAQTVQEDLR	500	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3857.2	52.39938	3	1963.890371	1963.888816	K	T	230	248
PSM	GLSLVDKENTPPALSGTR	501	sp|P31350|RIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3298.3	38.30838	3	2013.912071	2013.917353	K	V	24	42
PSM	QASPLISPLLNDQACPR	502	sp|Q9Y4F1|FARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3738.3	49.4624	3	2038.895171	2038.894844	K	T	508	525
PSM	ILATPPQEDAPSVDIANIR	503	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3649.2	47.23742	3	2099.025971	2099.030001	K	M	284	303
PSM	AAPEASSPPASPLQHLLPGK	504	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3615.4	46.40155	3	2126.976971	2126.980288	K	A	686	706
PSM	AAPEASSPPASPLQHLLPGK	505	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3641.2	47.0314	3	2126.976971	2126.980288	K	A	686	706
PSM	DNLTLWTSDMQGDGEEQNK	506	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3619.2	46.49622	3	2179.929671	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	507	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3643.3	47.08563	3	2192.872271	2192.873028	R	-	228	248
PSM	EINAREESLVEELSPASEK	508	sp|Q9BXK5|B2L13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3332.5	39.19603	3	2209.011671	2209.015139	K	K	413	432
PSM	SSVSRVPCNVEGISPELEK	509	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3304.5	38.46715	3	2245.963271	2245.969131	K	V	290	309
PSM	GFFICDQPYEPVSPYSCK	510	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3839.4	51.9718	3	2272.918271	2272.921045	R	E	676	694
PSM	ESMCSTPAFPVSPETPYVK	511	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3690.2	48.29088	3	2285.901371	2285.902691	K	T	839	858
PSM	SGSSSPDSEITELKFPSINHD	512	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3694.5	48.39917	3	2326.001471	2326.000217	R	-	571	592
PSM	FVEWLQNAEEESESEGEEN	513	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4019.2	55.48948	3	2333.889971	2333.884913	K	-	401	420
PSM	DNLTLWTSENQGDEGDAGEGEN	514	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3646.3	47.17333	3	2349.944471	2349.946922	R	-	225	247
PSM	YGKDATNVGDEGGFAPNILENK	515	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3444.3	41.98845	3	2388.060371	2388.063486	K	E	200	222
PSM	SSSSESEDEDVIPATQCLTPGIR	516	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3474.5	42.76472	3	2557.087271	2557.089109	R	T	996	1019
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	517	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21,22-UNIMOD:35,23-UNIMOD:21	ms_run[1]:scan=1.1.4613.2	62.4709	4	2968.328494	2968.325196	R	S	59	86
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	518	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3693.6	48.3778	4	3465.484494	3465.481982	K	A	399	429
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	519	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3282.3	37.8901	5	3562.497118	3562.491898	K	V	60	92
PSM	DDDIAALVVDNGSGMCK	520	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4298.2	59.34153	2	1900.7592	1900.7579	M	A	2	19
PSM	SPAVATSTAAPPPPSSPLPSK	521	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2930.3	28.8114	3	2038.993871	2038.997638	K	S	439	460
PSM	MEGPLSVFGDR	522	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4821.2	64.08123	2	1328.5471	1328.5467	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	523	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3703.3	48.62738	3	2749.2325	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	524	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3874.3	52.83347	3	2829.1939	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	525	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3814.3	51.36178	3	2829.1972	2829.1964	-	Y	1	25
PSM	TEWETAAPAVAETPDIK	526	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3832.3	51.81605	3	2029.8302	2029.8318	M	L	2	19
PSM	SSIGTGYDLSASTFSPDGR	527	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	51.72808	3	2038.8506	2038.8516	M	V	2	21
PSM	SCEGQNPELLPKTPISPLK	528	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3438.5	41.83888	3	2267.028071	2267.031003	K	T	308	327
PSM	MEAAGSPAATETGK	529	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2563.4	19.53663	2	1457.5719	1457.5740	-	Y	1	15
PSM	MNPVYSPGSSGVPYANAK	530	sp|A1KXE4|F168B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3392.2	40.7183	3	1975.8380	1975.8382	-	G	1	19
PSM	CNTPTYCDLGK	531	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3146.4	34.4288	2	1449.5245	1449.5300	M	A	2	13
PSM	AAQGVGPGPGSAAPPGLEAAR	532	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3350.5	39.66398	3	1951.9094	1951.9148	M	Q	2	23
PSM	ADSGTAGGAALAAPAPGPGSGGPGPR	533	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3206.4	35.97387	3	2238.0034	2238.0061	M	V	2	28
PSM	AAHSEGNTTAGLDMR	534	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2516.2	18.58155	3	1625.650871	1625.650500	R	E	467	482
PSM	VLLPEYGGTK	535	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3217.2	36.2553	2	1155.554847	1155.557692	K	V	71	81
PSM	KISPFEHQTYCQR	536	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.2841.4	26.52257	3	1772.766371	1772.770556	K	T	55	68
PSM	WNSVSPASAGK	537	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2783.5	25.02955	2	1182.502647	1182.507054	K	R	304	315
PSM	AASPPASASDLIEQQQK	538	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3171.3	35.06868	3	1819.832171	1819.835324	R	R	333	350
PSM	DQVANSAFVER	539	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2867.5	27.20192	2	1234.590247	1234.594215	K	L	500	511
PSM	LDIDSPPITAR	540	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3231.3	36.58002	2	1276.601447	1276.606433	R	N	33	44
PSM	IACRSPQPDPVGTPTIFKPQSK	541	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3228.3	36.51782	4	2583.189294	2583.195777	K	R	2219	2241
PSM	AGGPTTPLSPTR	542	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2720.6	23.40627	2	1313.538447	1313.541799	R	L	15	27
PSM	DQVANSAFVER	543	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2934.3	28.91248	2	1314.556247	1314.560546	K	L	500	511
PSM	GINSSNVENQLQATQAAR	544	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3188.2	35.49745	3	1979.898071	1979.906197	K	K	84	102
PSM	TPKGPSSVEDIK	545	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2745.4	24.042	2	1336.623447	1336.627563	K	A	237	249
PSM	TPKGPSSVEDIK	546	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2737.5	23.83797	2	1336.623447	1336.627563	K	A	237	249
PSM	NGEVVHTPETSV	547	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2830.4	26.24475	2	1347.568247	1347.570776	K	-	454	466
PSM	LAIQGPEDSPSR	548	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2897.3	27.95388	2	1348.597847	1348.602411	R	Q	230	242
PSM	SLYASSPGGVYATR	549	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3121.5	33.78257	2	1507.668447	1507.670825	R	S	51	65
PSM	NHCGIASAASYPTV	550	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3218.6	36.2947	2	1526.619047	1526.622494	R	-	320	334
PSM	NVFSSSGTSFSGRK	551	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2968.2	29.79267	3	1539.672371	1539.671887	K	I	1453	1467
PSM	LTFDSSFSPNTGKK	552	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3170.2	35.03945	3	1607.722271	1607.723254	K	N	97	111
PSM	GRTVIIEQSWGSPK	553	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3154.2	34.62332	3	1636.792571	1636.797422	K	V	59	73
PSM	WLKSPTTPIDPEK	554	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3219.2	36.30623	3	1670.731571	1670.735807	K	Q	859	872
PSM	KPAAAAAPGTAEKLSPK	555	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2592.3	20.18348	3	1686.870971	1686.870587	K	A	23	40
PSM	FSEGVLQSPSQDQEK	556	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3039.2	31.6488	3	1757.751071	1757.750926	R	L	428	443
PSM	ERAMSTTSISSPQPGK	557	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2499.2	18.40642	3	1771.780571	1771.781180	K	L	265	281
PSM	TDSVIIADQTPTPTR	558	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3095.2	33.09778	3	1773.759071	1773.758727	R	F	42	57
PSM	SSDEENGPPSSPDLDR	559	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2762.6	24.48953	3	1780.674971	1780.678883	R	I	202	218
PSM	HVPDSGATATAYLCGVK	560	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3218.3	36.2847	3	1825.806371	1825.807001	K	G	110	127
PSM	DGQVINETSQHHDDLE	561	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2779.2	24.91605	3	1835.791271	1835.792199	R	-	451	467
PSM	VLDTSSLTQSAPASPTNK	562	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3053.4	32.02057	3	1895.884571	1895.887753	R	G	850	868
PSM	ADSGPTQPPLSLSPAPETK	563	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3225.3	36.4356	3	1971.910871	1971.919054	R	R	2071	2090
PSM	VKLESPTVSTLTPSSPGK	564	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3167.5	34.97182	3	1986.928571	1986.931606	R	L	290	308
PSM	AQQNNVEHKVETFSGVYK	565	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3047.2	31.85735	4	2236.952894	2236.955530	K	K	161	179
PSM	SQSPAASDCSSSSSSASLPSSGR	566	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2678.5	22.33325	3	2278.896071	2278.900914	R	S	171	194
PSM	NCQTVLAPCSPNPCENAAVCK	567	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3091.6	33.0071	3	2468.989571	2468.994638	K	E	829	850
PSM	ELEREESGAAESPALVTPDSEK	568	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2948.6	29.28323	3	2503.036271	2503.040441	K	S	173	195
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	569	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2837.3	26.41968	4	2968.351294	2968.358028	R	L	420	447
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	570	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2599.4	20.36412	4	3104.320094	3104.322430	K	S	145	174
PSM	AQQATPGGAAPTIFSR	571	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3239.2	36.77518	3	1651.767971	1651.771936	K	I	43	59
PSM	STFVLDEFK	572	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3766.2	50.14153	2	1164.510647	1164.510408	K	R	286	295
PSM	ALDDFVLGSAR	573	sp|O60831|PRAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3664.3	47.62797	2	1242.560847	1242.564569	R	L	11	22
PSM	SSLEAASFWGE	574	sp|Q9BVS4|RIOK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4183.2	58.05848	2	1262.487247	1262.485650	K	-	542	553
PSM	SILSPGGSCGPIK	575	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3272.4	37.64075	2	1351.617247	1351.620704	R	V	207	220
PSM	EAAGGNDSSGATSPINPAVALE	576	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	45.38278	3	2106.907871	2106.910674	K	-	1236	1258
PSM	QEQINTEPLEDTVLSPTK	577	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3511.4	43.72615	3	2120.987771	2120.987861	K	K	271	289
PSM	SQSSEGVSSLSSSPSNSLETQSQSLSR	578	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3267.3	37.50863	4	2835.244494	2835.240735	R	S	76	103
PSM	GFPTIYFSPANK	579	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3736.2	49.4169	3	1420.638371	1420.642819	R	K	449	461
PSM	TVIIEQSWGSPK	580	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3339.4	39.37483	2	1423.671447	1423.674847	R	V	61	73
PSM	DVSPDLSCADEISECYHK	581	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3340.3	39.39773	3	2203.840871	2203.843917	K	L	53	71
PSM	GALQNIIPASTGAAK	582	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3326.3	39.03312	2	1490.746447	1490.749409	R	A	201	216
PSM	YQIDPDACFSAK	583	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3314.2	38.71523	3	1493.589671	1493.589797	K	V	225	237
PSM	LGGSAVISLEGKPL	584	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3877.3	52.91093	2	1499.701047	1499.703779	K	-	153	167
PSM	GALQNIIPASTGAAK	585	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3477.5	42.84217	2	1570.712647	1570.715740	R	A	201	216
PSM	HSDLFSSSSPWDK	586	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3330.2	39.13433	3	1571.625971	1571.629354	K	G	779	792
PSM	DMSPLSETEMALGK	587	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3860.4	52.48563	2	1587.655047	1587.656162	K	D	505	519
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	588	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	27-UNIMOD:21	ms_run[1]:scan=1.1.4081.2	56.45082	4	3274.358894	3274.357556	R	N	282	311
PSM	DDGLFSGDPNWFPK	589	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4540.2	61.87828	2	1673.679447	1673.676304	R	K	140	154
PSM	APNTPDILEIEFKK	590	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3593.3	45.82597	3	1693.830971	1693.832805	K	G	216	230
PSM	SPSMAVPSPGWVASPK	591	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3671.2	47.80623	3	1756.731671	1756.729676	K	T	997	1013
PSM	ASLGSLEGEAEAEASSPK	592	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	41.2298	3	1811.781371	1811.782620	K	G	5748	5766
PSM	GADFLVTEVENGGSLGSK	593	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3750.2	49.7128	3	1858.834271	1858.834990	K	K	189	207
PSM	SATSSSPGSPLHSLETSL	594	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4256.2	58.751	3	1916.778971	1916.780585	K	-	1203	1221
PSM	NVSSFPDDATSPLQENR	595	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3246.3	36.96043	3	1955.823071	1955.826216	R	N	52	69
PSM	SAESPTSPVTSETGSTFK	596	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3278.2	37.78653	3	1971.772271	1971.775165	K	K	280	298
PSM	DLLLTSSYLSDSGSTGEHTK	597	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3571.4	45.25598	3	2189.970371	2189.972940	K	S	397	417
PSM	IADPEHDHTGFLTEYVATR	598	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3508.3	43.64445	4	2250.998494	2250.994678	R	W	190	209
PSM	ELSNSPLRENSFGSPLEFR	599	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3782.4	50.53828	3	2338.000571	2338.003208	K	N	1316	1335
PSM	DNLTLWTSENQGDEGDAGEGEN	600	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3629.3	46.74203	3	2349.944171	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	601	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3681.6	48.07732	3	2407.989371	2407.988786	R	-	223	246
PSM	NALFPEVFSPTPDENSDQNSR	602	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3982.2	54.88659	3	2443.035371	2443.032914	R	S	567	588
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	603	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3564.5	45.0778	4	3385.520494	3385.515651	K	A	399	429
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	604	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3276.5	37.74535	5	3562.497118	3562.491898	K	V	60	92
PSM	DDDIAALVVDNGSGMCK	605	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4255.2	58.7259	2	1900.7592	1900.7579	M	A	2	19
PSM	MEGPLSVFGDR	606	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4032.2	55.70897	2	1344.5405	1344.5416	-	S	1	12
PSM	MEGPLSVFGDR	607	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4038.2	55.81925	2	1344.5405	1344.5416	-	S	1	12
PSM	AESSESFTMASSPAQR	608	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3268.4	37.53782	3	1806.7105	1806.7126	M	R	2	18
PSM	MTEWETAAPAVAETPDIK	609	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4118.2	57.01932	3	2080.9072	2080.9059	-	L	1	19
PSM	NVSSFPDDATSPLQENR	610	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3265.2	37.45268	3	1957.818671	1955.826216	R	N	52	69
PSM	MEPSSLELPADTVQR	611	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3908.2	53.65434	3	1793.7896	1793.7902	-	I	1	16
PSM	TDGFAEAIHSPQVAGVPR	612	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3315.2	38.74182	3	1930.890971	1930.893842	R	F	2146	2164
PSM	MEDLVQDGVASPATPGTGK	613	sp|Q8IWJ2|GCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4090.3	56.59855	3	2073.8420	2073.8362	-	S	1	20
PSM	MQELTLSPGPAK	614	sp|Q93015-2|NAA80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3718.3	48.99855	2	1392.6343	1392.6355	-	L	1	13
PSM	SGPDVETPSAIQICR	615	sp|O00154-2|BACH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3486.2	43.06662	3	1750.7600	1750.7592	M	I	2	17
PSM	RHEHPPNPPVSPGK	616	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2494.2	18.3458	4	1627.761294	1627.762040	K	T	663	677
PSM	NVSIGIVGK	617	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3175.2	35.16935	2	965.491847	965.494698	K	D	209	218
PSM	TVEVAEGEAVRTPQSVTAK	618	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2981.2	30.13258	4	2130.958894	2130.959947	R	Q	132	151
PSM	SQGDEAGGHGEDRPEPLSPK	619	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2623.5	20.97493	4	2141.900494	2141.901506	R	E	361	381
PSM	GHLSRPEAQSLSPYTTSANR	620	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2903.3	28.11008	4	2251.0500941913206	2251.0382736521397	R	A	424	444
PSM	VLLPEYGGTK	621	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3226.2	36.45973	2	1155.554847	1155.557692	K	V	71	81
PSM	LENVSQLSLDKSPTEK	622	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3090.2	32.96785	3	1866.895871	1866.897590	K	S	126	142
PSM	VIGSGCNLDSAR	623	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2736.4	23.80915	2	1247.589247	1247.592835	R	F	158	170
PSM	ASPEPQRENASPAPGTTAEEAMSR	624	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2895.5	27.90877	4	2563.100094	2563.101011	R	G	963	987
PSM	SSPNPFVGSPPK	625	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3025.3	31.28632	2	1292.576447	1292.580219	K	G	393	405
PSM	SSPNPFVGSPPK	626	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3017.4	31.07998	2	1292.576447	1292.580219	K	G	393	405
PSM	ACRPPGSPGRAPPPTPAPSGCDPR	627	sp|O95685|PPR3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,7-UNIMOD:21,15-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2658.2	21.81518	4	2614.091694	2614.097143	R	L	40	64
PSM	EDQTEYLEER	628	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2866.2	27.16572	2	1310.559447	1310.562640	K	R	166	176
PSM	DQVANSAFVER	629	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2926.6	28.71835	2	1314.556247	1314.560546	K	L	500	511
PSM	NLSPGAVESDVR	630	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3195.4	35.6871	2	1322.582047	1322.586761	K	G	171	183
PSM	NGLAAELGPASPR	631	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3126.4	33.90928	2	1331.621047	1331.623480	R	R	91	104
PSM	TPSPKEEDEEPESPPEK	632	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2601.2	20.39948	3	2003.821871	2003.824878	K	K	202	219
PSM	LQAPDSATLLEK	633	sp|Q9BUL5|PHF23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3219.5	36.31623	2	1364.654047	1364.658863	R	M	119	131
PSM	SSPNPFVGSPPK	634	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3196.6	35.71988	2	1372.542847	1372.546550	K	G	393	405
PSM	SHSPSSPDPDTPSPVGDSR	635	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2686.4	22.52643	3	2080.776371	2080.777625	R	A	616	635
PSM	SMGTGDTPGLEVPSSPLRK	636	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3197.2	35.73285	3	2103.890171	2103.894904	R	A	381	400
PSM	EGLELPEDEEEK	637	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3086.3	32.86688	2	1415.627847	1415.630385	K	K	412	424
PSM	VQISPDSGGLPER	638	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3028.4	31.36813	2	1433.649847	1433.655175	K	S	178	191
PSM	NSNSPPSPSSMNQR	639	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2647.3	21.54237	3	1581.620471	1581.624285	R	R	454	468
PSM	SVTEQGAELSNEER	640	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2816.6	25.88788	2	1627.667247	1627.672675	K	N	28	42
PSM	IDEMPEAAVKSTANK	641	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2860.3	27.01283	3	1682.752271	1682.758653	R	Y	30	45
PSM	ENVNATENCISAVGK	642	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2956.6	29.49257	2	1684.707847	1684.712766	K	I	964	979
PSM	ALSRQEMQEVQSSR	643	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2745.3	24.03867	3	1727.763671	1727.766198	K	S	187	201
PSM	ALSRQEMQEVQSSR	644	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2523.2	18.71937	3	1743.761471	1743.761113	K	S	187	201
PSM	ALVSGKPAESSAVAATEK	645	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2874.2	27.37358	3	1794.876971	1794.876460	K	K	75	93
PSM	RADLNQGIGEPQSPSR	646	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2750.2	24.1651	3	1803.825671	1803.826490	R	R	62	78
PSM	RADLNQGIGEPQSPSR	647	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2754.2	24.2688	4	1803.822494	1803.826490	R	R	62	78
PSM	HIAEEADRKYEEVAR	648	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2747.2	24.08722	4	1814.889294	1814.891125	K	K	154	169
PSM	SSFASSSASDASKPSSPR	649	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2588.2	20.09123	3	1834.770371	1834.773452	R	G	122	140
PSM	GVQVETISPGDGRTFPK	650	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3145.2	34.39678	3	1866.8843	1866.8872	M	R	2	19
PSM	IGRIEDVTPIPSDSTR	651	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3118.2	33.69438	3	1914.848171	1914.848939	K	R	126	142
PSM	GNSRPGTPSAEGGSTSSTLR	652	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2602.4	20.43092	3	1997.877671	1997.880377	R	A	383	403
PSM	SHSPSSPDPDTPSPVGDSR	653	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2670.4	22.12	3	2080.776371	2080.777625	R	A	616	635
PSM	SAESPTSPVTSETGSTFKK	654	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3063.3	32.2776	3	2099.868071	2099.870128	K	F	280	299
PSM	GHTDTEGRPPSPPPTSTPEK	655	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2581.3	19.95302	4	2246.922894	2246.924624	R	C	353	373
PSM	DLHQPSLSPASPHSQGFER	656	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3114.3	33.59272	4	2248.932894	2248.930378	K	G	58	77
PSM	AGEEDEGEEDSDSDYEISAK	657	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2923.6	28.64043	3	2253.792671	2253.795823	R	A	463	483
PSM	ITRKPVTVSPTTPTSPTEGEAS	658	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2796.5	25.36857	3	2335.123571	2335.130837	R	-	502	524
PSM	SPEKLPQSSSSESSPPSPQPTK	659	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2656.5	21.78247	3	2361.065771	2361.073716	K	V	408	430
PSM	FNSESESGSEASSPDYFGPPAK	660	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3234.4	36.65582	3	2368.928471	2368.937282	R	N	96	118
PSM	NGSLDSPGKQDTEEDEEEDEK	661	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2646.6	21.52653	3	2429.918171	2429.923149	K	D	134	155
PSM	NSVERPAEPVAGAATPSLVEQQK	662	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3040.6	31.68812	3	2457.183671	2457.190084	R	M	1455	1478
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	663	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2968.4	29.79933	4	2612.317694	2612.322435	R	Q	24	52
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	664	sp|Q9NPQ8|RIC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3026.6	31.32243	3	2742.060971	2742.064016	R	E	424	448
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	665	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3209.5	36.05582	4	2807.201294	2807.201193	R	G	70	97
PSM	DLNVLTPTGF	666	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4389.2	60.17255	2	1155.522247	1155.521307	R	-	296	306
PSM	SADTLWGIQK	667	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3464.2	42.49382	2	1197.543447	1197.543105	K	E	319	329
PSM	VDIDTPDIDIHGPEGK	668	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3284.4	37.94578	3	1799.793671	1799.797876	K	L	4096	4112
PSM	ASYHFSPEELDENTSPLLGDAR	669	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3646.2	47.16333	4	2527.088894	2527.090429	K	F	262	284
PSM	VWSPLVTEEGK	670	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3468.3	42.60209	2	1323.608447	1323.611184	K	R	88	99
PSM	EQFLDGDGWTSR	671	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3487.3	43.09625	2	1489.586447	1489.587489	K	W	25	37
PSM	LGGSAVISLEGKPL	672	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3886.3	53.11717	2	1499.701047	1499.703779	K	-	153	167
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	673	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3670.5	47.79037	4	3013.340894	3013.339266	K	V	8	36
PSM	NIEIDSPYEISR	674	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3360.5	39.91618	2	1514.662647	1514.665405	K	A	380	392
PSM	DEILPTTPISEQK	675	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3257.5	37.2527	2	1549.723447	1549.727671	K	G	215	228
PSM	GNPTVEVDLFTSK	676	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3748.3	49.67412	2	1565.641047	1565.641572	R	G	16	29
PSM	GALQNIIPASTGAAK	677	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3485.6	43.0538	2	1570.712647	1570.715740	R	A	201	216
PSM	VTNGAFTGEISPGMIK	678	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3556.3	44.86883	3	1700.781371	1700.784474	K	D	107	123
PSM	SAQGTGFELGQLQSIR	679	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3725.2	49.13987	3	1770.825671	1770.830179	K	S	432	448
PSM	DVTNFTVGGFAPMSPR	680	sp|O00267|SPT5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3903.2	53.52628	3	1774.773671	1774.774972	R	I	653	669
PSM	VTNGAFTGEISPGMIK	681	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3676.2	47.93473	3	1780.750571	1780.750805	K	D	107	123
PSM	RIDFIPVSPAPSPTR	682	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3612.2	46.31653	3	1811.834771	1811.837252	K	G	136	151
PSM	GPPQSPVFEGVYNNSR	683	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	38.66347	3	1826.796371	1826.798879	K	M	107	123
PSM	QGAIVAVTGDGVNDSPALK	684	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3279.2	37.81163	3	1890.906371	1890.908823	R	K	708	727
PSM	KYEQGFITDPVVLSPK	685	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3486.4	43.07328	3	1899.938771	1899.938332	K	D	109	125
PSM	QIQTEAAQLLTSFSEKN	686	sp|Q96DB5|RMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	50.99582	3	1986.927071	1986.929953	K	-	298	315
PSM	NSDVLQSPLDSAARDEL	687	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3842.3	52.04873	3	1988.808671	1988.812948	K	-	606	623
PSM	LATQSNEITIPVTFESR	688	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3896.2	53.3474	3	2064.918671	2064.917019	K	A	172	189
PSM	ATESGAQSAPLPMEGVDISPK	689	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3496.3	43.33087	3	2163.972671	2163.975917	K	Q	8	29
PSM	SSVSRVPCNVEGISPELEK	690	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3251.4	37.09317	3	2165.999471	2166.002800	K	V	290	309
PSM	DNLTLWTSDQQDDDGGEGNN	691	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3659.4	47.50128	3	2192.872271	2192.873028	R	-	228	248
PSM	GSPLNAAPYGIESMSQDTEVR	692	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3617.2	46.44622	3	2300.997371	2300.998443	K	S	351	372
PSM	EIFDSRGNPTVEVDLFTSK	693	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4087.2	56.52467	3	2312.995571	2312.996726	R	G	10	29
PSM	DTPENNPDTPFDFTPENYK	694	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3697.2	48.46523	3	2319.921971	2319.920904	R	R	43	62
PSM	ISPLSSPCSSPLQGTPASSLVSK	695	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3824.2	51.60927	3	2459.103971	2459.105625	K	I	519	542
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	696	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4099.2	56.78192	3	2754.237371	2754.234331	R	Y	147	174
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	697	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3352.2	39.70517	5	2833.349118	2833.352672	K	S	362	389
PSM	QREEYQPATPGLGMFVEVKDPEDK	698	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3565.5	45.10378	4	2842.285694	2842.288477	K	V	72	96
PSM	SAESPTSPVTSETGSTFK	699	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3270.3	37.58703	3	1972.770671	1971.775165	K	K	280	298
PSM	VPPAPVPCPPPSPGPSAVPSSPK	700	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3265.6	37.46601	3	2379.075671	2378.078288	K	S	366	389
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	701	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3131.6	34.04655	4	2995.263294	2994.261530	K	A	106	138
PSM	AESSESFTMASSPAQR	702	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3015.3	31.02395	3	1822.7045	1822.7076	M	R	2	18
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	703	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3351.4	39.6864	4	2990.540494	2989.541321	K	G	202	228
PSM	CNTPTYCDLGK	704	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3162.6	34.84502	2	1449.5245	1449.5300	M	A	2	13
PSM	GAVDGGLSIPHSTK	705	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3076.2	32.60221	3	1497.627071	1497.626591	K	R	165	179
PSM	ACKVDSPTVNTTLR	706	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2796.2	25.35523	3	1640.751971	1640.759322	K	S	440	454
PSM	WDQTADQTPGATPK	707	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2738.4	23.86055	3	1674.630071	1674.632799	R	K	200	214
PSM	GGRGDVGSADIQDLEK	708	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3032.2	31.46585	3	1695.742571	1695.746509	K	W	250	266
PSM	QLSSGVSEIR	709	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2971.3	29.8744	2	1154.529847	1154.533268	R	H	80	90
PSM	QLSSGVSEIR	710	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2941.4	29.09372	2	1154.532047	1154.533268	R	H	80	90
PSM	LKGEATVSFDDPPSAK	711	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3045.2	31.80505	3	1820.761871	1820.763478	K	A	333	349
PSM	ADTSQEICSPRLPISASHSSK	712	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	33.15033	4	2430.028894	2430.028771	K	T	1020	1041
PSM	DNSTMGYMMAK	713	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3074.4	32.55698	2	1247.497247	1247.498465	R	K	486	497
PSM	QVVESAYEVIK	714	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3138.3	34.21965	2	1263.665247	1263.671068	K	L	233	244
PSM	LSASTASELSPK	715	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2830.2	26.23808	2	1269.581047	1269.585364	R	S	451	463
PSM	IDATSASVLASR	716	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3041.2	31.70075	2	1269.593047	1269.596597	K	F	120	132
PSM	ERSPALKSPLQSVVVR	717	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3184.4	35.40063	3	1924.948571	1924.953679	R	R	246	262
PSM	GGSGSGPTIEEVD	718	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3075.2	32.57635	2	1283.488247	1283.491857	K	-	629	642
PSM	SSPNPFVGSPPK	719	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3033.3	31.4949	2	1292.576447	1292.580219	K	G	393	405
PSM	GAGAGHPGAGGAQPPDSPAGVR	720	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2632.3	21.17817	3	1962.867371	1962.869752	R	T	71	93
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	721	sp|P13051|UNG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3139.2	34.24193	4	2621.141694	2621.141158	K	I	50	74
PSM	EQVANSAFVER	722	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2907.5	28.22057	2	1328.572047	1328.576196	K	V	365	376
PSM	AGDNIPEEQPVASTPTTVSDGENKK	723	sp|Q9Y320|TMX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2893.4	27.85428	4	2663.196094	2663.196351	K	D	270	295
PSM	TFDQLTPEESK	724	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2934.4	28.91582	2	1373.572247	1373.575193	K	E	60	71
PSM	GAVDGGLSIPHSTK	725	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2949.2	29.29587	3	1417.658771	1417.660260	K	R	165	179
PSM	SAHATAPVNIAGSR	726	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2764.4	24.53507	3	1430.665571	1430.666742	R	T	2343	2357
PSM	DNPGVVTCLDEAR	727	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3118.5	33.70438	2	1444.659847	1444.661643	K	H	227	240
PSM	GGEIQPVSVKVGDK	728	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2908.2	28.23635	3	1491.730571	1491.733425	K	V	57	71
PSM	SSDQPLTVPVSPK	729	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3151.5	34.55715	2	1513.641847	1513.646658	K	F	728	741
PSM	EFHLNESGDPSSK	730	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2860.2	27.0095	3	1525.604771	1525.608618	K	S	165	178
PSM	LDPFADGGKTPDPK	731	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3016.2	31.04742	3	1536.686171	1536.686140	R	M	133	147
PSM	SAMPFTASPASSTTAR	732	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3158.2	34.72687	3	1661.712371	1661.712038	R	V	123	139
PSM	DYTGCSTSESLSPVK	733	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2964.4	29.6948	3	1709.683271	1709.685548	R	Q	199	214
PSM	EQGPYETYEGSPVSK	734	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2924.6	28.66647	2	1749.710447	1749.713477	K	G	549	564
PSM	NIGRDTPTSAGPNSFNK	735	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2812.4	25.77728	3	1854.818771	1854.826156	K	G	134	151
PSM	SGKYDLDFKSPDDPSR	736	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3033.2	31.49157	3	1905.813371	1905.814588	R	Y	254	270
PSM	VKLESPTVSTLTPSSPGK	737	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3135.2	34.1374	3	1986.930071	1986.931606	R	L	290	308
PSM	DGGRSSPGGQDEGGFMAQGK	738	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2842.4	26.54815	3	2016.796871	2016.799683	R	T	298	318
PSM	FIHQQPQSSSPVYGSSAK	739	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2801.4	25.491	3	2026.908971	2026.914971	R	T	76	94
PSM	GPPASSPAPAPKFSPVTPK	740	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3178.2	35.24282	3	2071.879271	2071.882228	R	F	254	273
PSM	NQGGYGGSSSSSSYGSGRRF	741	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2809.6	25.70618	3	2076.825371	2076.828675	R	-	353	373
PSM	DSESSNDDTSFPSTPEGIK	742	sp|Q9NQC3|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3152.5	34.58223	3	2091.811271	2091.815770	K	D	437	456
PSM	AAQQAASSSGQGQQAQTPTGF	743	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2925.6	28.69253	3	2099.889071	2099.890941	K	-	305	326
PSM	KLSSWDQAETPGHTPSLR	744	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3085.2	32.83783	4	2168.928494	2168.929315	K	W	214	232
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	745	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3122.4	33.80507	4	2898.288094	2898.290225	K	L	281	308
PSM	SQSPAASDCSSSSSSASLPSSGR	746	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2670.5	22.12333	3	2278.896071	2278.900914	R	S	171	194
PSM	ELEREESGAAESPALVTPDSEK	747	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2943.6	29.15277	3	2423.070671	2423.074110	K	S	173	195
PSM	NCQTVLAPCSPNPCENAAVCK	748	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3083.6	32.79888	3	2468.989571	2468.994638	K	E	829	850
PSM	IVRGDQPAASGDSDDDEPPPLPR	749	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2978.6	30.06733	3	2483.091971	2483.096577	K	L	45	68
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	750	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.2997.3	30.55403	4	2692.285694	2692.288766	R	Q	24	52
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	751	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3043.4	31.75925	4	3351.398494	3351.401211	R	A	108	139
PSM	AVDSLVPIGR	752	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3409.3	41.15878	2	1105.551047	1105.553276	K	G	195	205
PSM	NSPEDLGLSLTGDSCK	753	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3438.3	41.83222	3	1771.731071	1771.733561	K	L	499	515
PSM	GPPQSPVFEGVYNNSR	754	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3320.2	38.87265	3	1826.796371	1826.798879	K	M	107	123
PSM	QVPDSAATATAYLCGVK	755	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3499.2	43.4058	3	1830.823271	1830.822317	R	A	107	124
PSM	HSGGFLSSPADFSQENK	756	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3310.2	38.61103	3	1886.780171	1886.783623	R	A	772	789
PSM	DGAVNGPSVVGDQTPIEPQTSIER	757	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3334.2	39.23795	4	2545.164894	2545.169742	K	L	377	401
PSM	DDGVFVQEVTQNSPAAR	758	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3360.4	39.91285	3	1911.837671	1911.836387	R	T	29	46
PSM	LDIDSPPITAR	759	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3304.3	38.46048	2	1276.601447	1276.606433	R	N	33	44
PSM	DAGTIAGLNVLR	760	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3725.3	49.14987	2	1278.634447	1278.633317	K	I	160	172
PSM	DITEEIMSGAR	761	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3549.3	44.69663	2	1300.534247	1300.537033	K	T	191	202
PSM	DGLLSPGAWNGEPSGEGSR	762	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3786.2	50.64172	3	1964.829371	1964.826550	K	S	504	523
PSM	VWSPLVTEEGK	763	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3476.2	42.80652	2	1323.608447	1323.611184	K	R	88	99
PSM	EFSPFGSITSAK	764	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3658.3	47.47197	2	1349.588847	1349.590449	K	V	313	325
PSM	ELISNASDALDK	765	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3379.2	40.3788	2	1354.600847	1354.601742	R	I	103	115
PSM	GLGLSPDLVVCR	766	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3675.3	47.91255	2	1364.650047	1364.652338	R	C	206	218
PSM	SFSTALYGESDL	767	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4114.2	56.94983	2	1368.548847	1368.548644	K	-	900	912
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	768	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3385.4	40.54232	4	2756.199294	2756.199676	K	E	296	321
PSM	FLQCAEQVQPPRSPATVEAQPLPAS	769	sp|Q9BSY4|CHCH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3442.4	41.93962	4	2800.320094	2800.325532	R	-	86	111
PSM	GLFSANDWQCK	770	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3682.4	48.09637	2	1404.552047	1404.553352	R	T	62	73
PSM	ESVPEFPLSPPK	771	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3603.3	46.08685	2	1405.650247	1405.653049	K	K	30	42
PSM	IMNTFSVVPSPK	772	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3298.5	38.31505	2	1414.654447	1414.656755	R	V	163	175
PSM	EFSPFGSITSAK	773	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3899.2	53.42417	2	1429.554247	1429.556780	K	V	313	325
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	774	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3534.3	44.32075	4	2908.396094	2908.396782	R	S	67	92
PSM	GYISPYFINTSK	775	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3675.5	47.91922	2	1468.662647	1468.663948	R	G	222	234
PSM	IMNTFSVVPSPK	776	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3618.2	46.47161	2	1478.625247	1478.628171	R	V	163	175
PSM	GASSPLITVFTDDK	777	sp|Q15155|NOMO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3799.5	50.98007	2	1529.698447	1529.701456	K	G	822	836
PSM	QVEEQSAAANEEVLFPFCR	778	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4026.2	55.61237	3	2302.996571	2302.992964	K	E	218	237
PSM	IADPEHDHTGFLTEYVATR	779	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3384.6	40.52218	3	2330.961971	2330.961009	R	W	190	209
PSM	ISMQDVDLSLGSPK	780	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3674.5	47.89325	2	1568.714447	1568.715726	K	L	500	514
PSM	LTFDTTFSPNTGKK	781	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	37.0865	3	1635.751871	1635.754554	K	S	108	122
PSM	NRPTSISWDGLDSGK	782	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3250.3	37.06378	3	1711.752371	1711.756680	K	L	48	63
PSM	SSGSEGSSPNWLQALK	783	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3753.2	49.79163	3	1726.758371	1726.756345	K	L	1708	1724
PSM	MGNTPDSASDNLGFR	784	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3391.2	40.69243	3	1740.617171	1740.621582	R	C	275	290
PSM	VGIDTPDIDIHGPEGK	785	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3260.3	37.324	3	1741.788971	1741.792396	K	L	4560	4576
PSM	CFSPGVIEVQEVQGK	786	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3517.2	43.87598	3	1755.787571	1755.790288	R	K	256	271
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	787	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,18-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4126.3	57.2053	4	3537.374494	3537.370051	R	V	44	74
PSM	RTLDFDPLLSPASPK	788	sp|Q53H80|AKIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3910.2	53.70545	3	1815.820871	1815.820934	K	R	9	24
PSM	DRSSFYVNGLTLGGQK	789	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3488.2	43.11882	3	1820.844071	1820.845829	K	C	55	71
PSM	YMSPMEAQEFGILDK	790	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3871.2	52.74615	3	1837.765271	1837.766775	R	V	229	244
PSM	NPDDITQEEYGEFYK	791	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3384.4	40.51552	3	1846.790171	1846.789740	R	S	292	307
PSM	NQYDNDVTVWSPQGR	792	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3314.3	38.71857	3	1857.767171	1857.768307	R	I	4	19
PSM	VVESPDFSKDEDYLGK	793	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3263.3	37.4032	3	1906.821671	1906.823756	K	V	923	939
PSM	PEIVDTCSLASPASVCR	794	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3347.3	39.5795	3	1940.8349	1940.8368	M	T	2	19
PSM	TIGGGDDSFNTFFSETGAGK	795	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3887.3	53.14972	3	2086.848071	2086.852096	K	H	41	61
PSM	QEQINTEPLEDTVLSPTK	796	sp|O15446|RPA34_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3519.5	43.93793	3	2120.987771	2120.987861	K	K	271	289
PSM	QFTPCQLLADHANSPNKK	797	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3299.2	38.3309	4	2227.946494	2227.948671	K	F	743	761
PSM	SDQQAQVHQLLTPASAISNK	798	sp|Q8NDV7|TNR6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3259.6	37.30813	3	2295.023771	2295.029757	R	E	1033	1053
PSM	SPWSNKYDPPLEDGAMPSAR	799	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3387.6	40.60093	3	2296.983371	2296.982399	R	L	73	93
PSM	EGEEAGPGDPLLEAVPKTGDEK	800	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3346.3	39.5539	3	2317.032971	2317.036268	K	D	353	375
PSM	LYGSAGPPPTGEEDTAEKDEL	801	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3380.6	40.41828	3	2334.918671	2334.918201	K	-	634	655
PSM	AAEEAFVNDIDESSPGTEWER	802	sp|P09496-2|CLCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3700.3	48.54977	3	2430.985871	2430.985295	R	V	163	184
PSM	AIVDALPPPCESACTVPTDVDK	803	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3481.4	42.9421	3	2434.079471	2434.079730	R	W	261	283
PSM	DNLTLWTADNAGEEGGEAPQEPQS	804	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3697.3	48.4719	3	2528.094071	2528.093920	R	-	225	249
PSM	DNLTLWTADNAGEEGGEAPQEPQS	805	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3917.3	53.83982	3	2608.058171	2608.060251	R	-	225	249
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	806	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3634.4	46.87214	3	2881.093571	2881.094982	K	T	701	725
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	807	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3359.4	39.88717	4	2989.538494	2989.541321	K	G	202	228
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	808	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3716.5	48.95007	4	3536.414494	3536.408665	R	-	207	238
PSM	VQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVK	809	sp|E9PAV3|NACAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3427.2	41.57236	4	3939.732094	3939.727022	K	D	2008	2043
PSM	CIPALDSLTPANEDQK	810	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4452.3	60.9143	2	1833.7890	1833.7851	R	I	447	463
PSM	VPPAPVPCPPPSPGPSAVPSSPK	811	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3207.6	36.00706	3	2379.077471	2378.078288	K	S	366	389
PSM	NGSLDSPGKQDTEEDEEEDEKDK	812	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2619.3	20.87217	4	2594.062494	2593.078724	K	G	134	157
PSM	ESVPEFPLSPPK	813	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3587.4	45.67327	2	1405.650247	1405.653049	K	K	30	42
PSM	MDSAGQDINLNSPNK	814	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3032.3	31.46918	3	1740.7040	1740.7021	-	G	1	16
PSM	MDSAGQDINLNSPNK	815	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3048.2	31.88335	3	1740.7040	1740.7021	-	G	1	16
PSM	MEPSSLELPADTVQR	816	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3797.2	50.91796	3	1793.7881	1793.7902	-	I	1	16
PSM	HTGPNSPDTANDGFVR	817	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2786.3	25.10078	3	1763.722571	1763.726442	K	L	99	115
PSM	GFDPTASPFCQ	818	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3546.2	44.61887	2	1305.470647	1305.473705	K	-	1293	1304
PSM	SDEFSLADALPEHSPAK	819	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3815.2	51.38417	3	1934.8295	1934.8294	M	T	2	19
PSM	MNLLPNIESPVTRQEK	820	sp|P17980|PRS6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4066.3	56.16737	3	1989.9614	1989.9590	-	M	1	17
PSM	SCTPSPDQISHR	821	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2639.2	21.33992	3	1463.588471	1463.586443	R	A	271	283
PSM	SKPIPIMPASPQK	822	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2982.2	30.15873	3	1472.742971	1472.746238	K	G	607	620
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	823	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2918.2	28.49643	6	3112.506741	3112.507789	R	S	847	876
PSM	SGLTVPTSPK	824	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2888.2	27.72107	2	1065.508447	1065.510742	R	G	87	97
PSM	GGEIQPVSVK	825	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2826.2	26.13493	2	1092.517647	1092.521641	K	V	57	67
PSM	PYQYPALTPEQKK	826	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2947.2	29.24365	3	1641.7766	1641.7799	M	E	2	15
PSM	DCGSVDGVIK	827	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.2889.2	27.74617	2	1128.450447	1128.452241	K	E	26	36
PSM	NVTELNEPLSNEER	828	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3088.2	32.91595	3	1722.747071	1722.746174	K	N	29	43
PSM	NSFREQLEEEEEAK	829	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3050.2	31.93555	3	1736.784071	1736.785323	K	H	1339	1353
PSM	LKGEATVSFDDPPSAK	830	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2970.6	29.85843	3	1740.795071	1740.797147	K	A	333	349
PSM	DNLTSATLPR	831	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3121.4	33.77923	2	1166.532047	1166.533268	K	N	302	312
PSM	LPSAQTPNGTDYVASGK	832	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2948.3	29.27323	3	1784.795471	1784.798210	R	S	1960	1977
PSM	VPPAPVPCPPPSPGPSAVPSSPK	833	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3211.3	36.10183	4	2378.075294	2378.078288	K	S	366	389
PSM	HQGVMVGMGQKDSYVGDEAQSK	834	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2933.3	28.88802	4	2430.036894	2430.034511	R	R	42	64
PSM	RELHGQNPVVTPCNK	835	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2575.2	19.82927	3	1827.840671	1827.845118	K	Q	147	162
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	836	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3105.3	33.36153	4	2494.090094	2494.089063	R	L	815	839
PSM	SQDATFSPGSEQAEKSPGPIVSR	837	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3082.2	32.75992	4	2534.075694	2534.072745	R	T	329	352
PSM	GNKSPSPPDGSPAATPEIR	838	sp|O00499|BIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2808.4	25.67278	3	1956.889571	1956.894236	K	V	293	312
PSM	EITALAPSTMK	839	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3208.3	36.0231	2	1320.541647	1320.543772	K	I	318	329
PSM	GVNTVFHCASPPPSSNNK	840	sp|Q15738|NSDHL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2893.3	27.85095	3	1991.854571	1991.856076	K	E	97	115
PSM	NGLAAELGPASPR	841	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3118.4	33.70105	2	1331.621047	1331.623480	R	R	91	104
PSM	TPKGPSSVEDIK	842	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2753.5	24.25265	2	1336.623447	1336.627563	K	A	237	249
PSM	LDQPVSAPPSPR	843	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2793.3	25.28188	2	1342.623047	1342.628231	K	D	235	247
PSM	ELASPVSPELR	844	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3189.2	35.52377	2	1356.570447	1356.572764	K	Q	175	186
PSM	ADGYEPPVQESV	845	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3179.3	35.27095	2	1369.540247	1369.543893	R	-	253	265
PSM	IIYGGSVTGATCK	846	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2951.5	29.35808	2	1405.627447	1405.631268	R	E	244	257
PSM	DSVFLSCSEDNR	847	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3059.3	32.174	2	1427.595647	1427.598708	K	I	180	192
PSM	HGFREGTTPKPK	848	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2327.2	16.86143	3	1433.679671	1433.681664	R	R	76	88
PSM	AIADTGANVVVTGGK	849	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2902.6	28.09375	2	1451.697447	1451.702125	K	V	282	297
PSM	KAEGAATEEEGTPKESEPQAAAEPAEAK	850	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2637.3	21.3032	4	2905.283294	2905.286622	K	E	25	53
PSM	DRVHHEPQLSDK	851	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2423.2	17.61485	3	1459.718171	1459.716790	K	V	26	38
PSM	DVSGPMPDSYSPR	852	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3049.2	31.9092	2	1486.576447	1486.579961	K	Y	291	304
PSM	NSGSFPSPSISPR	853	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3190.4	35.5566	2	1491.576447	1491.579641	R	-	1258	1271
PSM	NSGSFPSPSISPR	854	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3198.3	35.76243	2	1491.576447	1491.579641	R	-	1258	1271
PSM	TPSPKEEDEEPESPPEK	855	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2609.3	20.60695	4	2003.826494	2003.824878	K	K	202	219
PSM	AGDLLEDSPKRPK	856	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2703.5	22.96682	2	1504.727447	1504.728674	R	E	158	171
PSM	SESPKEPEQLRK	857	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2547.2	19.18093	3	1506.705371	1506.707938	K	L	4	16
PSM	NWMVGGEGGAGGRSP	858	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3206.5	35.9772	2	1510.598447	1510.602427	K	-	79	94
PSM	GDATVSYEDPPTAK	859	sp|Q01844|EWS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2814.2	25.82197	2	1529.624447	1529.628685	K	A	411	425
PSM	CPNLTHLNLSGNK	860	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3072.2	32.4997	3	1546.693271	1546.696328	K	I	87	100
PSM	PFSAPKPQTSPSPK	861	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2728.4	23.6069	3	1547.735471	1547.738510	K	R	299	313
PSM	NGRVEIIANDQGNR	862	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2690.3	22.62247	3	1554.782771	1554.786266	K	I	47	61
PSM	PCSEETPAISPSK	863	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	2-UNIMOD:4,6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2665.4	21.99723	2	1561.5737	1561.5767	M	R	2	15
PSM	NIIHGSDSVKSAEK	864	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2590.4	20.13543	3	1563.725771	1563.729402	R	E	100	114
PSM	TAADVVSPGANSVDSR	865	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2803.5	25.54603	2	1624.705447	1624.709395	K	V	1000	1016
PSM	DMESPTKLDVTLAK	866	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3114.2	33.58938	3	1642.751471	1642.752506	K	D	277	291
PSM	SAPASPTHPGLMSPR	867	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2939.3	29.03778	3	1664.675771	1664.678309	R	S	416	431
PSM	SAPASPTHPGLMSPR	868	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2947.3	29.24698	3	1664.675771	1664.678309	R	S	416	431
PSM	IDEMPEAAVKSTANK	869	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2857.2	26.93152	3	1762.720271	1762.724984	R	Y	30	45
PSM	TDSVIIADQTPTPTR	870	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3079.2	32.68117	3	1773.759071	1773.758727	R	F	42	57
PSM	LGAGGGSPEKSPSAQELK	871	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2701.4	22.90873	3	1791.840971	1791.840409	R	E	13	31
PSM	GCITIIGGGDTATCCAK	872	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,11-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3191.3	35.57925	3	1833.739271	1833.746057	R	W	366	383
PSM	PGPTPSGTNVGSSGRSPSK	873	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2519.3	18.65645	3	1848.8348	1848.8362	M	A	2	21
PSM	GVQVETISPGDGRTFPK	874	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3153.2	34.59763	3	1866.8843	1866.8872	M	R	2	19
PSM	SGKYDLDFKSPDDPSR	875	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3017.3	31.07665	3	1905.813371	1905.814588	R	Y	254	270
PSM	LSLEGDHSTPPSAYGSVK	876	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3067.3	32.3783	3	1923.859571	1923.861539	K	A	11	29
PSM	IRYESLTDPSKLDSGK	877	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3098.3	33.17983	3	1967.863271	1967.864255	K	E	54	70
PSM	HASSSPESPKPAPAPGSHR	878	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2260.2	16.4183	4	1975.893294	1975.890153	R	E	433	452
PSM	KPVTVSPTTPTSPTEGEAS	879	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2841.6	26.52923	3	2044.860971	2044.864315	R	-	505	524
PSM	VKLESPTVSTLTPSSPGK	880	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3158.4	34.73353	3	2066.893871	2066.897937	R	L	290	308
PSM	SLDSDESEDEEDDYQQK	881	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2792.5	25.2628	3	2110.728971	2110.737580	K	R	57	74
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	882	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3045.5	31.81505	4	2987.318494	2987.319929	R	-	684	712
PSM	YNLQEVVKSPKDPSQLNSK	883	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3109.2	33.45922	4	2253.105294	2253.104229	K	Q	262	281
PSM	EHYPVSSPSSPSPPAQPGGVSR	884	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2927.6	28.74428	3	2378.991071	2378.993372	K	N	2036	2058
PSM	EHYPVSSPSSPSPPAQPGGVSR	885	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2919.6	28.53592	3	2378.991071	2378.993372	K	N	2036	2058
PSM	NGSLDSPGKQDTEEDEEEDEK	886	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2608.3	20.59115	3	2429.915471	2429.923149	K	D	134	155
PSM	PAEKPAETPVATSPTATDSTSGDSSR	887	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2672.6	22.1784	3	2639.155571	2639.159965	K	S	148	174
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	888	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,9-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2620.5	20.89773	5	3503.277618	3503.284224	R	A	81	114
PSM	NLLSVAYK	889	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3475.2	42.78052	2	986.481447	986.483799	R	N	44	52
PSM	DVQTALALAK	890	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3438.2	41.82888	2	1108.551047	1108.552941	K	G	70	80
PSM	GRTVIIEQSWGSPK	891	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3289.2	38.06963	3	1716.761171	1716.763753	K	V	59	73
PSM	DLNVLTPTGF	892	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4369.2	59.95765	2	1155.522247	1155.521307	R	-	296	306
PSM	NQVALNPQNTVFDAK	893	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3243.3	36.88283	3	1737.805571	1737.808715	K	R	57	72
PSM	SADTLWDIQK	894	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3322.3	38.92853	2	1175.580047	1175.582253	K	D	320	330
PSM	VLPGVDALSNI	895	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4092.2	56.62918	2	1176.578047	1176.579156	K	-	407	418
PSM	NSVTPDMMEEMYKK	896	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3307.2	38.53293	3	1781.703671	1781.707546	K	A	229	243
PSM	DSPSVWAAVPGK	897	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3266.2	37.47847	2	1212.609447	1212.613888	K	T	27	39
PSM	RGFFICDQPYEPVSPYSCK	898	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0	14-UNIMOD:21,6-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3594.2	45.84897	4	2429.0212941913205	2429.0221557646596	R	E	675	694
PSM	QVPDSAATATAYLCGVK	899	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3491.2	43.19712	3	1830.823271	1830.822317	R	A	107	124
PSM	SRGPATVEDLPSAFEEK	900	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3385.3	40.53898	3	1911.859871	1911.861539	R	A	247	264
PSM	SADTLWGIQK	901	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	50.23217	2	1277.508247	1277.509436	K	E	319	329
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	902	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3266.3	37.4818	4	2619.210494	2619.213536	R	D	175	200
PSM	TAFQEALDAAGDK	903	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3324.5	38.98722	2	1335.626647	1335.630660	K	L	9	22
PSM	TAHNSEADLEESFNEHELEPSSPK	904	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	37.82165	4	2776.156494	2776.150129	K	S	134	158
PSM	SIPLECPLSSPK	905	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3311.4	38.64393	2	1406.647647	1406.651669	K	G	142	154
PSM	ISEEQQQLQQALAPAQASSNSSTPTR	906	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3399.3	40.90572	4	2849.316894	2849.319260	K	M	9	35
PSM	RPPEPTTPWQEDPEPEDENLYEK	907	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3295.4	38.23328	4	2875.220494	2875.222566	K	N	47	70
PSM	CLELFSELAEDK	908	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3829.3	51.73808	2	1452.680247	1452.680647	K	E	412	424
PSM	ASGQAFELILSPR	909	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3781.2	50.5018	2	1467.710247	1467.712296	R	S	15	28
PSM	ALAGCDFLTISPK	910	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3708.4	48.76415	2	1471.677647	1471.678218	K	L	246	259
PSM	DFTPVCTTELGR	911	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3352.4	39.71183	2	1474.614647	1474.616346	R	A	42	54
PSM	EIGINEDQFQEACTSPLAK	912	sp|Q96G28|CFA36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3492.4	43.22983	3	2228.966171	2228.966080	K	T	71	90
PSM	EGFSIPVSADGFK	913	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4001.2	55.25637	2	1512.593447	1512.593894	K	F	1887	1900
PSM	FSDCWNTEGSYDCVCSPGYEPVSGAK	914	sp|Q9UHX3|AGRE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3569.4	45.20412	4	3051.138894	3051.139841	K	T	82	108
PSM	DPVASSLSPYFGTK	915	sp|Q9UNW1|MINP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3677.3	47.97368	2	1547.688847	1547.690891	R	T	37	51
PSM	IADPEHDHTGFLTEYVATR	916	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3319.5	38.85667	3	2330.957771	2330.961009	R	W	190	209
PSM	GQASSPTPEPGVGAGDLPGPTSAPVPSGSQSGGR	917	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3292.3	38.15158	4	3138.422494	3138.425516	K	G	960	994
PSM	RASGQAFELILSPR	918	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3516.2	43.84945	3	1623.811871	1623.813407	K	S	14	28
PSM	VSMPDVELNLKSPK	919	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3410.3	41.18365	3	1635.790271	1635.794311	K	V	3415	3429
PSM	IFVGGLSPDTPEEK	920	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3520.5	43.96408	2	1647.682047	1647.683437	K	I	184	198
PSM	IFVGGLSPDTPEEK	921	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3504.4	43.54977	2	1647.682047	1647.683437	K	I	184	198
PSM	DDGLFSGDPNWFPK	922	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4593.2	62.28845	2	1673.679447	1673.676304	R	K	140	154
PSM	NTPASASLEGLAQTAGR	923	sp|Q96Q45|TM237_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3511.2	43.71948	3	1722.796571	1722.793793	K	R	43	60
PSM	SYELPDGQVITIGNER	924	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3656.2	47.41725	3	1789.882571	1789.884643	K	F	241	257
PSM	DDGLFSGDPNWFPKK	925	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3861.2	52.49673	3	1801.770071	1801.771267	R	S	140	155
PSM	DSLSPVLHPSDLILTR	926	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3872.2	52.77218	3	1841.928371	1841.928830	K	G	311	327
PSM	SWASPVYTEADGTFSR	927	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3653.2	47.33997	3	1852.764671	1852.766910	R	L	342	358
PSM	SATSSSPGSPLHSLETSL	928	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3906.2	53.60308	3	1916.777471	1916.780585	K	-	1203	1221
PSM	SSTPPGESYFGVSSLQLK	929	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3828.2	51.69921	3	1962.898271	1962.897590	K	G	1041	1059
PSM	NSDVLQSPLDSAARDEL	930	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3850.2	52.24758	3	1988.808671	1988.812948	K	-	606	623
PSM	CSPTVAFVEFPSSPQLK	931	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,2-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4097.2	56.73233	3	2052.867971	2052.866898	R	N	669	686
PSM	DNLTLWTSDQQDDDGGEGNN	932	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3755.2	49.84623	3	2192.873171	2192.873028	R	-	228	248
PSM	YHTSQSGDEMTSLSEYVSR	933	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3351.5	39.68973	3	2255.923571	2255.904208	R	M	457	476
PSM	QQPPEPEWIGDGESTSPSDK	934	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3337.3	39.31944	3	2262.9281	2262.9313	K	V	7	27
PSM	KGEQTSSGTLSAFASYFNSK	935	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4113.2	56.9249	3	2268.935771	2268.934126	R	V	670	690
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	936	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3376.4	40.31015	4	3062.400894	3062.401610	K	S	2194	2221
PSM	EGEEAGPGDPLLEAVPKTGDEK	937	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3354.5	39.76562	3	2317.032971	2317.036268	K	D	353	375
PSM	DTPENNPDTPFDFTPENYK	938	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3688.2	48.24208	3	2319.921971	2319.920904	R	R	43	62
PSM	SGSSSPDSEITELKFPSINHD	939	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3702.3	48.5984	3	2326.001471	2326.000217	R	-	571	592
PSM	IADPEHDHTGFLTEYVATR	940	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3327.4	39.06248	3	2330.957771	2330.961009	R	W	190	209
PSM	AHASPFSGALTPSAPPGPEMNR	941	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3355.4	39.78713	3	2350.981871	2350.980699	R	S	119	141
PSM	DFSPGLFEDPSVAFATPDPKK	942	sp|Q7Z5J4|RAI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4310.2	59.45558	3	2424.037271	2424.032777	K	T	681	702
PSM	DYEIESQNPLASPTNTLLGSAK	943	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3930.2	54.05222	3	2427.119771	2427.120667	K	E	618	640
PSM	AIVDALPPPCESACTVPTDVDK	944	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3473.6	42.74192	3	2434.079471	2434.079730	R	W	261	283
PSM	AAVPSGASTGIYEALELRDNDK	945	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3830.2	51.75105	4	2436.059694	2436.061117	R	T	33	55
PSM	GGPGSAVSPYPTFNPSSDVAALHK	946	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3651.6	47.30198	3	2515.080371	2515.082187	K	A	30	54
PSM	VMTIPYQPMPASSPVICAGGQDR	947	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3668.4	47.7349	3	2554.140671	2554.141953	R	C	178	201
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	948	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3518.5	43.9118	4	3393.346494	3393.345713	K	F	86	114
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	949	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3273.5	37.66917	4	3562.491694	3562.491898	K	V	60	92
PSM	GYISPYFINTSK	950	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	50.96673	3	1550.633771	1548.630279	R	G	222	234
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	951	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2798.4	25.41287	5	3566.427618	3565.448950	K	D	124	155
PSM	MDSAGQDINLNSPNK	952	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3340.6	39.40773	2	1724.7038	1724.7072	-	G	1	16
PSM	SAPELKTGISDVFAK	953	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3446.2	42.03662	3	1641.802271	1641.801505	K	N	319	334
PSM	AADVSVTHRPPLSPK	954	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3010.3	30.89348	3	1695.8308	1695.8340	M	S	2	17
PSM	AAAMDVDTPSGTNSGAGKK	955	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.2871.3	27.29853	3	1898.8033	1898.8076	M	R	2	21
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	956	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,11-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3531.2	44.24052	4	2882.1802	2882.1622	M	D	2	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	957	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,11-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3515.3	43.82673	4	2882.1802	2882.1622	M	D	2	29
PSM	MESAIAEGGASR	958	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3344.3	39.5018	2	1299.5129	1299.5161	-	F	1	13
PSM	MEDLVQDGVASPATPGTGK	959	sp|Q8IWJ2|GCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3839.3	51.96847	3	1993.8704	1993.8699	-	S	1	20
PSM	TFDQLTPDESK	960	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2938.5	29.01878	2	1359.557047	1359.559543	K	E	71	82
PSM	EGAASPAPETPQPTSPETSPK	961	sp|Q9Y3X0|CCDC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2710.4	23.14063	3	2237.911271	2237.913056	K	E	372	393
PSM	CESAFLSK	962	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3775.2	50.37567	2	1003.3681	1003.3717	K	R	36	44
PSM	QFVFDLHSGK	963	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=1.1.3847.2	52.18547	2	1239.5293	1239.5320	K	L	346	356
PSM	SGPKPFSAPKPQTSPSPK	964	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2713.3	23.21808	4	1916.940094	1916.939729	R	R	295	313
PSM	RVEPGSPAEAAALR	965	sp|Q15599|NHRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2849.2	26.72397	3	1502.719271	1502.724257	R	A	38	52
PSM	AGDLLEDSPKRPK	966	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2702.2	22.928	3	1504.728671	1504.728674	R	E	158	171
PSM	HELQANCYEEVK	967	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2734.2	23.75117	3	1518.674771	1518.677293	K	D	133	145
PSM	HGSYEDAVHSGALND	968	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2827.2	26.16082	3	1570.659671	1570.664814	K	-	542	557
PSM	GGNFGGRSSGPYGGGGQYFAK	969	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3113.2	33.56373	4	2099.892094	2099.885068	K	P	278	299
PSM	SSLGPVGLDK	970	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3054.2	32.04016	2	1051.492847	1051.495092	K	M	34	44
PSM	SALFSESQK	971	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2903.2	28.10675	2	1075.457047	1075.458706	K	A	566	575
PSM	DYDDMSPR	972	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2732.2	23.70097	2	1077.345447	1077.347441	R	R	279	287
PSM	DLHQPSLSPASPHSQGFER	973	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3029.3	31.39062	4	2168.965294	2168.964047	K	G	58	77
PSM	SCNCLLLK	974	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3142.2	34.31912	2	1086.457647	1086.460304	K	V	336	344
PSM	DYDDMSPR	975	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2436.2	17.71532	2	1093.340247	1093.342356	R	R	279	287
PSM	PYQYPALTPEQKK	976	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2955.2	29.45312	3	1641.7766	1641.7799	M	E	2	15
PSM	MESALDQLK	977	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3203.2	35.88928	2	1113.477047	1113.477727	R	Q	11	20
PSM	NQLTSNPENTVFDAK	978	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3148.3	34.47563	3	1676.797271	1676.800579	K	R	82	97
PSM	GKGGEIQPVSVKVGDK	979	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2787.3	25.12675	3	1676.842271	1676.849852	K	V	55	71
PSM	VDALLSAQPK	980	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2986.2	30.26318	2	1120.549847	1120.552941	K	G	950	960
PSM	GHASAPYFGKEEPSVAPSSTGK	981	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2897.2	27.95055	4	2283.022494	2283.020893	K	T	131	153
PSM	VGSLTPPSSPK	982	sp|Q2M2I8|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2760.5	24.4343	2	1148.545847	1148.547856	K	T	616	627
PSM	SVEAAAELSAK	983	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2789.4	25.1818	2	1154.516647	1154.522035	K	D	5	16
PSM	DPNSPLYSVK	984	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3027.2	31.33533	2	1198.524847	1198.527120	R	S	82	92
PSM	SGEGEVSGLMR	985	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3116.2	33.64235	2	1200.485047	1200.484604	R	K	473	484
PSM	LEGQGDVPTPK	986	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2748.3	24.1167	2	1219.544447	1219.548584	K	Q	257	268
PSM	LEGQGDVPTPK	987	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2756.5	24.33065	2	1219.544447	1219.548584	K	Q	257	268
PSM	NTCPGDRSAITPGGLR	988	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2906.3	28.18787	3	1830.743771	1830.748514	K	L	410	426
PSM	SQDATFSPGSEQAEKSPGPIVSR	989	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3000.3	30.63238	4	2454.102494	2454.106414	R	T	329	352
PSM	QNQTTAISTPASSEISK	990	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2834.4	26.3477	3	1841.837171	1841.840803	K	A	1753	1770
PSM	NCQTVLAPCSPNPCENAAVCK	991	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3091.2	32.99377	4	2468.996094	2468.994638	K	E	829	850
PSM	KITIADCGQLE	992	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3031.4	31.44628	2	1246.621247	1246.622738	K	-	155	166
PSM	ELASPVSPELR	993	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3110.3	33.48845	2	1276.601847	1276.606433	K	Q	175	186
PSM	VDSPTVNTTLR	994	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2865.3	27.1429	2	1281.592447	1281.596597	K	S	443	454
PSM	EALQDVEDENQ	995	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2890.3	27.77445	2	1288.540447	1288.541905	K	-	245	256
PSM	ELISNSSDALDK	996	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2912.5	28.35053	2	1290.626047	1290.630326	R	I	47	59
PSM	SSPNPFVGSPPK	997	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3128.4	33.96165	2	1292.578047	1292.580219	K	G	393	405
PSM	SVNGGPGSPDLAR	998	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2720.5	23.40293	2	1305.573647	1305.571445	R	H	982	995
PSM	ADSGPTQPPLSLSPAPETK	999	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3234.2	36.64915	3	1971.910871	1971.919054	R	R	2071	2090
PSM	NLSPGAVESDVR	1000	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3187.3	35.47477	2	1322.582047	1322.586761	K	G	171	183
PSM	SHSPSSPDPDTPSPVGDSR	1001	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2638.3	21.31817	3	2000.811671	2000.811294	R	A	616	635
PSM	YALYDATYETK	1002	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3132.2	34.05938	2	1336.619647	1336.618698	R	E	82	93
PSM	DGFPSGTPALNAK	1003	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3117.4	33.67492	2	1353.595847	1353.596597	K	G	148	161
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	1004	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2967.3	29.77013	4	2712.258894	2712.264371	K	T	139	165
PSM	HSPNLSFEPNFCQDNPRSPTSSK	1005	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3209.4	36.05248	4	2725.161694	2725.159194	K	E	107	130
PSM	ELISNSSDALDK	1006	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3022.2	31.20488	2	1370.593047	1370.596657	R	I	47	59
PSM	VSDQNSPVLPKK	1007	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2580.2	19.9275	3	1390.685171	1390.685746	R	S	2042	2054
PSM	NGEVVHTPETSV	1008	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2858.5	26.96745	2	1427.531647	1427.537107	K	-	454	466
PSM	SSDQPLTVPVSPK	1009	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3083.4	32.79222	2	1433.677847	1433.680327	K	F	728	741
PSM	EVDEQMLNVQNK	1010	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2991.4	30.40068	2	1445.676847	1445.682044	K	N	325	337
PSM	NAPAAVDEGSISPR	1011	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2813.5	25.80635	2	1462.640447	1462.645338	R	T	373	387
PSM	QSGSPTLDTAPNGR	1012	sp|Q9H2J7|S6A15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2665.3	21.99057	2	1479.632847	1479.635502	K	Y	698	712
PSM	DVSGPMPDSYSPR	1013	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3041.4	31.70742	2	1486.576447	1486.579961	K	Y	291	304
PSM	TTPSYVAFTDTER	1014	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3178.3	35.24615	2	1486.688247	1486.693989	R	L	37	50
PSM	NDSLVTPSPQQAR	1015	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2787.6	25.13675	2	1491.665047	1491.671887	R	V	144	157
PSM	NMAPGAVCSPGESK	1016	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2529.3	18.7957	2	1499.574047	1499.578581	R	E	1289	1303
PSM	RASPGTPLSPGSLR	1017	sp|Q96BD0|SO4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3011.2	30.9163	3	1554.690071	1554.695674	R	S	32	46
PSM	AKPAMPQDSVPSPR	1018	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2770.2	24.68325	3	1559.711771	1559.716729	K	S	470	484
PSM	VAAETQSPSLFGSTK	1019	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3143.5	34.355	2	1601.730047	1601.733819	K	L	215	230
PSM	AAVVTSPPPTTAPHK	1020	sp|P35611|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2612.2	20.69328	3	1632.731171	1632.731390	R	E	7	22
PSM	TPKTPKGPSSVEDIK	1021	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2714.4	23.24388	3	1662.822971	1662.822968	K	A	234	249
PSM	RITSPLMEPSSIEK	1022	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3157.2	34.7013	3	1666.796471	1666.800124	K	I	53	67
PSM	GKGGEIQPVSVKVGDK	1023	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2790.2	25.20102	4	1676.844094	1676.849852	K	V	55	71
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	1024	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2908.6	28.24968	4	3365.449694	3365.451593	K	K	799	833
PSM	DVYLSPRDDGYSTK	1025	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3002.3	30.6847	3	1694.715371	1694.718897	R	D	204	218
PSM	TLNAETPKSSPLPAK	1026	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2765.4	24.56103	3	1712.774471	1712.778735	R	G	208	223
PSM	DTGKTPVEPEVAIHR	1027	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2841.3	26.51923	3	1727.820971	1727.824365	K	I	5	20
PSM	NQVAMNPTNTVFDAK	1028	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3203.6	35.90262	2	1728.751647	1728.754237	K	R	57	72
PSM	TPKTPKGPSSVEDIK	1029	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2769.4	24.66413	3	1742.786771	1742.789299	K	A	234	249
PSM	DVQDSLTVSNEAQTAK	1030	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2966.3	29.74373	3	1784.778671	1784.782954	K	E	211	227
PSM	ADLNQGIGEPQSPSRR	1031	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2766.2	24.58032	4	1803.824094	1803.826490	R	V	63	79
PSM	LGAGGGSPEKSPSAQELK	1032	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2769.5	24.66747	3	1871.803571	1871.806740	R	E	13	31
PSM	SLIGVEYKPVSATGAEDK	1033	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3214.2	36.177	3	1942.925471	1942.928890	K	D	944	962
PSM	FIHQQPQSSSPVYGSSAK	1034	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2755.6	24.3079	3	2026.909571	2026.914971	R	T	76	94
PSM	DGARPDVTESESGSPEYR	1035	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2767.6	24.61953	3	2030.816171	2030.821859	K	Q	425	443
PSM	SVSTPSEAGSQDSGDGAVGSR	1036	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2633.5	21.19987	3	2029.819571	2029.822587	K	T	92	113
PSM	GPSPSSPTPPAAAAPAEQAPR	1037	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2855.5	26.88968	3	2035.930571	2035.936435	R	A	103	124
PSM	EVSDDEAEEKEDKEEEK	1038	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2368.2	17.212	4	2036.854494	2036.854584	K	E	229	246
PSM	AGEAAELQDAEVESSAKSGKP	1039	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2974.5	29.95967	3	2152.948271	2152.952539	K	-	657	678
PSM	GHASAPYFGKEEPSVAPSSTGK	1040	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2921.2	28.57483	4	2283.021294	2283.020893	K	T	131	153
PSM	NNEESPTATVAEQGEDITSKK	1041	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3050.6	31.94888	3	2327.011571	2327.016595	K	D	9	30
PSM	RSEACPCQPDSGSPLPAEEEK	1042	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2763.6	24.5154	3	2422.971071	2422.977056	R	R	492	513
PSM	QISSSSTGCLSSPNATVQSPKHEWK	1043	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4,12-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.2995.3	30.50208	4	2875.218094	2875.224905	K	I	266	291
PSM	ETESAPGSPRAVTPVPTKTEEVSNLK	1044	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2996.5	30.53475	4	2883.320494	2883.330416	K	T	514	540
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1045	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3100.6	33.24235	4	3173.240494	3173.243468	R	-	738	768
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	1046	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3065.4	32.3315	5	3704.515618	3704.512278	K	-	158	196
PSM	DLTDYLMK	1047	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3631.2	46.78992	2	997.476847	997.479034	R	I	186	194
PSM	ALLYLCGGDD	1048	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3583.2	45.56208	2	1095.489247	1095.490661	K	-	330	340
PSM	VVLAYEPVWAIGTGK	1049	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4006.2	55.31742	3	1681.848971	1681.848061	K	T	198	213
PSM	ESAFEFLSSA	1050	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4572.2	62.12368	2	1166.453247	1166.453287	K	-	325	335
PSM	ESAFEFLSSA	1051	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4598.2	62.35752	2	1166.453247	1166.453287	K	-	325	335
PSM	GTPLISPLIK	1052	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3754.3	49.82405	2	1197.579647	1197.581144	R	W	826	836
PSM	GPPQSPVFEGVYNNSR	1053	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3336.5	39.3001	3	1826.797571	1826.798879	K	M	107	123
PSM	LDIDSPPITAR	1054	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3296.5	38.26272	2	1276.601447	1276.606433	R	N	33	44
PSM	LSELVQAVSDPSSPQYGK	1055	sp|O14773|TPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3377.4	40.33492	3	1983.915671	1983.919054	R	Y	61	79
PSM	TLTPISAAYAR	1056	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3297.3	38.28223	2	1322.563247	1322.567285	K	A	295	306
PSM	SGFGEISSPVIR	1057	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	41.42598	2	1327.612847	1327.617332	R	E	4	16
PSM	AAMYDIISSPSK	1058	sp|Q6KC79|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3358.5	39.86507	2	1361.590047	1361.593820	K	D	342	354
PSM	ERPTPSLNNNCTTSEDSLVLYNR	1059	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3311.3	38.6406	4	2759.218894	2759.222189	K	V	734	757
PSM	DVIELTDDSFDK	1060	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3508.4	43.64779	2	1395.638447	1395.640556	K	N	161	173
PSM	DINTFLGTPVQK	1061	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3511.3	43.72282	2	1411.670847	1411.674847	K	L	1794	1806
PSM	DRYMSPMEAQEFGILDK	1062	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3582.4	45.54293	3	2124.891971	2124.889744	R	V	227	244
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1063	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3354.3	39.75895	4	2833.350094	2833.352672	K	S	362	389
PSM	TLTIVDTGIGMTK	1064	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3508.5	43.65112	2	1428.694447	1428.693534	R	A	28	41
PSM	LFMAQALQEYNN	1065	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3758.4	49.92727	2	1440.669447	1440.670751	K	-	341	353
PSM	SVFGTPTLETANK	1066	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3302.4	38.41475	2	1443.659447	1443.664677	K	N	1140	1153
PSM	ATLPSPDKLPGFK	1067	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3401.3	40.9575	3	1449.724871	1449.726883	K	M	831	844
PSM	IVSAQSLAEDDVE	1068	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3449.2	42.1126	2	1454.616847	1454.617786	R	-	133	146
PSM	SAVPFNQYLPNK	1069	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3527.4	44.14317	2	1456.670247	1456.675182	K	S	262	274
PSM	QASPNIVIALAGNK	1070	sp|P51148|RAB5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3596.4	45.9075	2	1474.753847	1474.754495	R	A	122	136
PSM	RVATPVDWKDGDSVMVLPTIPEEEAK	1071	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3711.4	48.83541	4	2961.422494	2961.419491	K	K	174	200
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRK	1072	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3897.3	53.38253	4	3109.3716941913203	3109.3682570769597	R	A	139	166
PSM	DTCYSPKPSVYLSTPSSASK	1073	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3241.3	36.8311	3	2333.945171	2333.952813	K	A	538	558
PSM	FSPVTPKFTPVASK	1074	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	38.79428	3	1664.759471	1664.761628	K	F	266	280
PSM	NPEVGLKPVWYSPK	1075	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3396.2	40.82348	3	1692.827771	1692.827660	K	V	536	550
PSM	RASGQAFELILSPR	1076	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3754.2	49.81738	3	1703.779271	1703.779738	K	S	14	28
PSM	NLEQILNGGESPKQK	1077	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3306.2	38.5069	3	1733.832371	1733.834930	K	G	219	234
PSM	ISLPGQMAGTPITPLK	1078	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3759.3	49.95038	3	1782.838871	1782.839226	K	D	213	229
PSM	ISLPGQMAGTPITPLK	1079	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3767.4	50.16117	3	1782.838871	1782.839226	K	D	213	229
PSM	ISLPGQMAGTPITPLK	1080	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:35,10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3562.2	45.01577	3	1798.830671	1798.834141	K	D	213	229
PSM	RTLDFDPLLSPASPK	1081	sp|Q53H80|AKIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3894.2	53.29728	3	1815.815771	1815.820934	K	R	9	24
PSM	GPPQSPVFEGVYNNSR	1082	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3328.2	39.0816	3	1826.798771	1826.798879	K	M	107	123
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	1083	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4027.2	55.63743	4	3681.645294	3681.639334	K	K	213	250
PSM	DMASPNWSILPEEER	1084	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3908.3	53.66433	3	1852.770371	1852.770281	R	N	327	342
PSM	DWILPSDYDHAEAEAR	1085	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3495.2	43.30142	3	1886.844371	1886.843506	K	H	256	272
PSM	NSDVLQSPLDSAARDEL	1086	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3670.2	47.78036	3	1908.844871	1908.846617	K	-	606	623
PSM	KISLPGQMAGTPITPLK	1087	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3519.3	43.93127	3	1910.934971	1910.934189	K	D	212	229
PSM	SATSSSPGSPLHSLETSL	1088	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4267.2	58.95353	3	1916.778971	1916.780585	K	-	1203	1221
PSM	YFQINQDEEEEEDED	1089	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3275.6	37.72317	2	1930.719847	1930.722842	R	-	114	129
PSM	MASPPAPSPAPPAISPIIK	1090	sp|Q00587|BORG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3677.2	47.96368	3	2000.943671	2000.944754	R	N	99	118
PSM	VAPEEHPVLLTEAPLNPK	1091	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3369.3	40.13762	3	2033.022671	2033.023459	R	A	96	114
PSM	TIGGGDDSFNTFFSETGAGK	1092	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3857.3	52.40272	3	2086.854071	2086.852096	K	H	41	61
PSM	ATESGAQSAPLPMEGVDISPK	1093	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3488.5	43.12882	3	2163.972671	2163.975917	K	Q	8	29
PSM	KYEQGFITDPVVLSPKDR	1094	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3325.2	39.00358	4	2171.065294	2171.066387	K	V	109	127
PSM	KGEQTSSGTLSAFASYFNSK	1095	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3851.2	52.27208	3	2188.965371	2188.967795	R	V	670	690
PSM	QHPQPYIFPDSPGGTSYER	1096	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3304.6	38.47048	3	2254.964471	2254.968463	R	Y	75	94
PSM	VPADTEVVCAPPTAYIDFAR	1097	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3904.5	53.56197	3	2271.026771	2271.028287	K	Q	71	91
PSM	LYGSAGPPPTGEEDTAEKDEL	1098	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3388.6	40.62668	3	2334.918671	2334.918201	K	-	634	655
PSM	DKNTPSPFIETFTEDDEASR	1099	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3672.4	47.83868	3	2377.995671	2377.995132	K	A	210	230
PSM	SSSSESEDEDVIPATQCLTPGIR	1100	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3482.6	42.9753	3	2557.087271	2557.089109	R	T	996	1019
PSM	MLAESDESGDEESVSQTDKTELQNTLR	1101	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3497.4	43.36028	4	3171.284494	3171.283996	K	T	186	213
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	1102	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3385.6	40.54898	4	3199.396094	3199.394275	K	N	213	241
PSM	GNPTVEVDLFTSK	1103	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3566.4	45.1265	2	1485.672047	1485.675241	R	G	16	29
PSM	RASGQAFELILSPR	1104	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3744.2	49.5938	3	1704.780071	1703.779738	K	S	14	28
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	1105	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3374.2	40.25807	4	3194.432494	3194.432255	K	R	65	93
PSM	CSGPGLSPGMVR	1106	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3438.4	41.83555	2	1279.5139	1279.5085	K	A	1453	1465
PSM	QLSSGVSEIR	1107	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3414.3	41.28275	2	1137.5041	1137.5062	R	H	80	90
PSM	IMNTFSVVPSPK	1108	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3481.2	42.93543	2	1398.660447	1398.661840	R	V	163	175
PSM	NVSSFPDDATSPLQENR	1109	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3254.3	37.16784	3	1956.829871	1955.826216	R	N	52	69
PSM	AFKDTGKTPVEPEVAIHR	1110	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3183.3	35.37217	4	2196.0031	2196.0012	M	I	2	20
PSM	NREPLMPSPQFIK	1111	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3394.2	40.77062	3	1636.784171	1635.784415	K	S	246	259
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1112	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3522.6	44.01937	3	2882.1613	2882.1618	M	D	2	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1113	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3525.3	44.08792	4	2882.1802	2882.1622	M	D	2	29
PSM	DALGDSLQVPVSPSSTTSSR	1114	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3433.3	41.70802	3	2083.944371	2082.947059	R	C	141	161
PSM	QQPPEPEWIGDGESTSPSDK	1115	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.3645.4	47.14052	3	2245.9021	2245.9047	K	V	7	27
PSM	SDAAVDTSSEITTK	1116	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=1.1.2967.5	29.7768	2	1465.6738	1465.6779	M	D	2	16
PSM	MEDLVQDGVASPATPGTGK	1117	sp|Q8IWJ2|GCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3830.3	51.75438	3	1993.8704	1993.8699	-	S	1	20
PSM	IYQYIQSR	1118	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2790.4	25.20768	2	1149.518647	1149.521975	R	F	318	326
PSM	NASTFEDVTQVSSAYQK	1119	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3261.2	37.34789	3	1955.825771	1953.835718	K	T	320	337
PSM	VLTPTQVK	1120	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2831.2	26.26362	2	964.496247	964.499449	K	N	40	48
PSM	NRVIGSGCNLDSARFR	1121	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3073.2	32.52475	4	1980.845294	1980.839060	K	Y	156	172
PSM	VKVDGPRSPSYGR	1122	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2589.2	20.11632	3	1496.714471	1496.713692	R	S	192	205
PSM	GLTSVINQK	1123	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3196.2	35.70655	2	1038.506447	1038.511076	R	L	300	309
PSM	TPSPKEEDEEPESPPEKK	1124	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2517.2	18.60653	4	2131.919694	2131.919841	K	T	202	220
PSM	SQGDEAGGHGEDRPEPLSPK	1125	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2632.2	21.16817	4	2141.900494	2141.901506	R	E	361	381
PSM	AAHSEGNTTAGLDMR	1126	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2703.2	22.95348	3	1609.656071	1609.655585	R	E	467	482
PSM	LEPQIASASEYAHR	1127	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3031.2	31.43962	3	1650.741671	1650.740301	K	G	85	99
PSM	RLSSSSATLLNSPDR	1128	sp|Q14244|MAP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2899.2	28.00273	3	1682.796071	1682.798879	K	A	198	213
PSM	NYLQSLPSK	1129	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3142.3	34.32245	2	1128.519047	1128.521641	R	T	279	288
PSM	GLQSGVDIGVK	1130	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3191.2	35.57592	2	1151.554847	1151.558755	K	Y	135	146
PSM	GASLKSPLPSQ	1131	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2925.4	28.68587	2	1163.556447	1163.558755	K	-	113	124
PSM	LITPAVVSER	1132	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3185.4	35.42643	2	1163.591447	1163.595140	K	L	67	77
PSM	ERAMSTTSISSPQPGK	1133	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2668.4	22.06793	3	1755.784271	1755.786265	K	L	265	281
PSM	TISPMVMDAK	1134	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3129.4	33.98777	2	1171.499647	1171.501834	K	A	793	803
PSM	GNDPLTSSPGR	1135	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2707.3	23.05975	2	1179.490647	1179.492132	R	S	20	31
PSM	RVSLEPHQGPGTPESK	1136	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2624.3	21.00085	3	1797.835271	1797.841078	K	K	1989	2005
PSM	EAALPPVSPLK	1137	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3204.3	35.91873	2	1200.611647	1200.615542	R	A	1224	1235
PSM	VEIIANDQGNR	1138	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2727.2	23.5743	3	1227.619271	1227.620764	R	I	50	61
PSM	ELEREESGAAESPALVTPDSEK	1139	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2946.4	29.2237	4	2503.035694	2503.040441	K	S	173	195
PSM	GGETPGSEQWK	1140	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2765.5	24.56437	2	1254.488447	1254.491798	K	F	223	234
PSM	WNSVSPASAGK	1141	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2847.2	26.67215	2	1262.469247	1262.473385	K	R	304	315
PSM	DGNGYISAAELR	1142	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3180.3	35.29592	2	1264.600247	1264.604780	K	H	96	108
PSM	VKLESPTVSTLTPSSPGK	1143	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3127.2	33.92878	3	1906.964771	1906.965275	R	L	290	308
PSM	NQSPVLEPVGR	1144	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2907.3	28.2139	2	1274.598447	1274.602017	R	S	713	724
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	1145	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2646.4	21.51987	4	2611.080094	2611.085754	K	L	460	485
PSM	TREAQQALGSAAADATEAK	1146	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2997.2	30.5507	3	1967.887571	1967.894964	K	N	1405	1424
PSM	KITIADCGQLE	1147	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3175.5	35.17935	2	1326.585447	1326.589069	K	-	155	166
PSM	SSTPLHSPSPIR	1148	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2768.3	24.63542	3	1357.635671	1357.639131	R	V	283	295
PSM	STAQQELDGKPASPTPVIVASHTANK	1149	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2969.4	29.82547	4	2726.321294	2726.327640	R	E	847	873
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1150	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3185.5	35.42977	4	2727.230494	2727.234862	R	G	70	97
PSM	SGSLDSELSVSPK	1151	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3133.4	34.09225	2	1384.607447	1384.612307	K	R	2718	2731
PSM	ESDFSDTLSPSK	1152	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2996.4	30.53142	2	1391.544847	1391.549372	K	E	444	456
PSM	ETSAATLSPGASSR	1153	sp|Q9Y6I9|TX264_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2631.2	21.14355	2	1413.609847	1413.613704	R	G	237	251
PSM	NGEVVHTPETSV	1154	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2866.4	27.17238	2	1427.531647	1427.537107	K	-	454	466
PSM	SSTPLHSPSPIR	1155	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2789.2	25.17513	3	1437.601271	1437.605462	R	V	283	295
PSM	VDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1156	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3207.3	35.99707	4	2925.349694	2925.350560	K	A	461	493
PSM	PCSEETPAISPSK	1157	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2705.5	23.01498	2	1481.6077	1481.6104	M	R	2	15
PSM	NIIHGSDSVESAEK	1158	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2679.2	22.3455	3	1484.709071	1484.710701	R	E	115	129
PSM	SSDQPLTVPVSPK	1159	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3143.4	34.35167	2	1513.641847	1513.646658	K	F	728	741
PSM	YADEEIPRSPFK	1160	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3129.2	33.9811	3	1530.673571	1530.675576	K	V	1497	1509
PSM	AKPAMPQDSVPSPR	1161	sp|P53396|ACLY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2778.3	24.89363	3	1559.711771	1559.716729	K	S	470	484
PSM	TQSPGGCSAEAVLAR	1162	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3032.5	31.47585	2	1582.675647	1582.681072	R	K	74	89
PSM	LTFDSSFSPNTGKK	1163	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3162.2	34.83168	3	1607.722271	1607.723254	K	N	97	111
PSM	EVVKPVPITSPAVSK	1164	sp|Q96HC4|PDLI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2957.2	29.50495	3	1629.875171	1629.874276	K	V	102	117
PSM	SSGGREDLESSGLQR	1165	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2765.3	24.5577	3	1656.705071	1656.710458	K	R	70	85
PSM	ESVPEFPLSPPKKK	1166	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3128.2	33.95498	3	1661.838371	1661.842975	K	D	30	44
PSM	ESVPEFPLSPPKKK	1167	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3144.2	34.37083	3	1661.838371	1661.842975	K	D	30	44
PSM	SAPASPTHPGLMSPR	1168	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2931.3	28.83683	3	1664.676071	1664.678309	R	S	416	431
PSM	GVEPSPSPIKPGDIK	1169	sp|Q92890|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3062.2	32.2487	3	1679.754371	1679.757271	K	R	241	256
PSM	VLSPTAAKPSPFEGK	1170	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3074.3	32.55365	3	1687.764971	1687.762356	K	T	311	326
PSM	SSGPYGGGGQYFAKPR	1171	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2994.3	30.47592	3	1707.732371	1707.740636	R	N	337	353
PSM	NLDIERPTYTNLNR	1172	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3109.3	33.46255	3	1717.874171	1717.874747	R	L	216	230
PSM	LREVVETPLLHPER	1173	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3093.2	33.0458	3	1766.907971	1766.908035	K	F	187	201
PSM	ATEPPSPDAGELSLASR	1174	sp|Q8IYB8|SUV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	36.15088	3	1776.788771	1776.793125	K	L	720	737
PSM	VIVVGNPANTNCLTASK	1175	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3148.4	34.47897	3	1836.873371	1836.880500	K	S	126	143
PSM	DAGDKDKEQELSEEDK	1176	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2518.2	18.62142	3	1834.805771	1834.806846	R	Q	35	51
PSM	TTWGDGGENSPCNVVSK	1177	sp|O00161|SNP23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3039.3	31.65213	3	1886.765171	1886.750608	K	Q	101	118
PSM	LPQSSSSESSPPSPQPTK	1178	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2605.3	20.51405	3	1919.849171	1919.851368	K	V	412	430
PSM	NIGRDTPTSAGPNSFNK	1179	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2840.2	26.49088	3	1934.787371	1934.792487	K	G	134	151
PSM	EAENQGLDISSPGMSGHR	1180	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2958.4	29.53798	3	1963.807271	1963.809520	K	Q	191	209
PSM	STPSHGSVSSLNSTGSLSPK	1181	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2809.5	25.70285	3	2008.902971	2008.910280	R	H	238	258
PSM	GPSPSSPTPPAAAAPAEQAPR	1182	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2847.3	26.67548	3	2035.931771	2035.936435	R	A	103	124
PSM	KPVTVSPTTPTSPTEGEAS	1183	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2833.6	26.3287	3	2044.860971	2044.864315	R	-	505	524
PSM	KQEETAVLEEDSADWEK	1184	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3153.3	34.60097	3	2085.872171	2085.877977	K	E	302	319
PSM	AMHQAQTMEGCSSPMVVK	1185	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2798.3	25.40953	3	2086.830071	2086.834555	K	F	167	185
PSM	NPQSILKPHSPTYNDEGL	1186	sp|Q9NVA1|UQCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3208.4	36.02643	3	2088.949271	2088.951751	K	-	282	300
PSM	LDNTPASPPRSPAEPNDIPIAK	1187	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3188.5	35.50745	3	2459.104871	2459.113487	K	G	2311	2333
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1188	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2598.3	20.33002	4	3024.351694	3024.356099	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1189	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2590.5	20.13877	4	3104.320094	3104.322430	K	S	145	174
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1190	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3165.6	34.92387	4	3223.226494	3223.230486	K	-	122	148
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1191	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3173.5	35.1272	4	3223.226494	3223.230486	K	-	122	148
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	1192	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3061.4	32.22937	5	3704.515618	3704.512278	K	-	158	196
PSM	SSNLLDLK	1193	sp|Q86X55|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3341.2	39.4203	2	968.456047	968.457978	K	N	463	471
PSM	GLESAFTEK	1194	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3380.2	40.40495	2	1060.445447	1060.447807	K	V	1291	1300
PSM	DQLIYNLLK	1195	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3785.2	50.61578	2	1118.630647	1118.633560	K	E	6	15
PSM	VLPGVDALSNI	1196	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4080.2	56.42558	2	1176.578047	1176.579156	K	-	407	418
PSM	GEWFLLGSPGS	1197	sp|Q96T76|MMS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5767.2	70.81312	2	1228.516447	1228.516556	R	-	1020	1031
PSM	VLENAEGARTTPSVVAFTADGER	1198	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3316.3	38.77137	4	2549.118894	2549.120029	K	L	77	100
PSM	NLEELNISSAQ	1199	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3490.2	43.1709	2	1296.559247	1296.559877	K	-	120	131
PSM	GDNITLLQSVSN	1200	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3605.3	46.13877	2	1339.601047	1339.602076	K	-	81	93
PSM	NDPFTSDPFTK	1201	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3661.2	47.54655	2	1347.536447	1347.538413	K	N	684	695
PSM	VLTPELYAELR	1202	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3843.2	52.08143	2	1382.681847	1382.684684	K	A	33	44
PSM	VLDSGAPIKIPVGPETLGR	1203	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3808.3	51.2032	3	2078.019371	2078.021425	K	I	125	144
PSM	DMTSEQLDDILK	1204	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3669.3	47.75803	2	1406.657447	1406.659911	K	Y	672	684
PSM	ESVPEFPLSPPK	1205	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3563.3	45.04478	2	1405.650247	1405.653049	K	K	30	42
PSM	EQFLDGDGWTSR	1206	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3379.3	40.38213	2	1409.617847	1409.621158	K	W	25	37
PSM	WPDPEDLLTPR	1207	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3912.2	53.74785	2	1417.628447	1417.627897	R	W	39	50
PSM	GFPTIYFSPANK	1208	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3727.4	49.19495	2	1420.641647	1420.642819	R	K	449	461
PSM	GFPTIYFSPANK	1209	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3745.2	49.61962	2	1420.642847	1420.642819	R	K	449	461
PSM	PVQETQAPESPGENSEQALQTLSPR	1210	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3340.2	39.3944	4	2852.2264	2852.2262	M	A	2	27
PSM	PVQETQAPESPGENSEQALQTLSPR	1211	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3330.5	39.14433	4	2852.2264	2852.2262	M	A	2	27
PSM	VEIIANDQGNRTTPSYVAFTDTER	1212	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3498.4	43.38615	4	2856.241294	2856.236850	K	L	26	50
PSM	DILAQSPAAEPLK	1213	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3261.5	37.35788	2	1431.697247	1431.701062	K	N	1232	1245
PSM	ASGQAFELILSPR	1214	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3789.2	50.70958	2	1467.710247	1467.712296	R	S	15	28
PSM	IMNTFSVVPSPK	1215	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3602.3	46.0604	2	1478.625247	1478.628171	R	V	163	175
PSM	LTFDSSFSPNTGK	1216	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3384.5	40.51885	2	1479.627247	1479.628291	K	K	97	110
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	1217	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3609.5	46.24807	4	2963.272894	2963.274343	R	T	88	114
PSM	NQAIDACDANTTPGGVTDVIK	1218	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3310.5	38.62103	3	2238.972071	2238.982793	K	N	2144	2165
PSM	SVVTGGVQSVMGSR	1219	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3513.3	43.77765	2	1522.628647	1522.625211	K	L	167	181
PSM	TTPSVVAFTADGER	1220	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3341.4	39.42697	2	1529.672847	1529.676304	R	L	86	100
PSM	FVEWLQNAEEESESEGEEN	1221	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3929.2	54.03677	3	2333.885471	2333.884913	K	-	401	420
PSM	VVLAYEPVWAIGTGKTATPQQAQEVHEK	1222	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3845.2	52.13382	4	3289.486494	3289.486279	K	L	198	226
PSM	NTSLPPLWSPEAER	1223	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3678.2	47.9865	3	1675.759871	1675.760702	K	S	201	215
PSM	ISPLSSPCSSPLQGTPASSLVSK	1224	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3803.2	51.07343	3	2539.069571	2539.071956	K	I	519	542
PSM	APNTPDILEIEFKK	1225	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3585.4	45.62102	3	1693.830971	1693.832805	K	G	216	230
PSM	NRPTSISWDGLDSGK	1226	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3317.3	38.79762	3	1711.753271	1711.756680	K	L	48	63
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	1227	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3668.5	47.73823	4	3456.444094	3456.442334	R	-	207	238
PSM	VTNGAFTGEISPGMIK	1228	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3668.2	47.72823	3	1780.750571	1780.750805	K	D	107	123
PSM	VSSGYVPPPVATPFSSK	1229	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	39.18604	3	1798.851371	1798.854268	R	S	168	185
PSM	TWTTPEVTSPPPSPR	1230	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3301.4	38.3888	3	1811.748371	1811.753248	R	T	125	140
PSM	LSEKLDSTDFTGTIK	1231	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3358.2	39.85507	3	1813.777871	1813.778794	K	L	131	146
PSM	MDATANDVPSPYEVR	1232	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3263.2	37.39987	3	1823.679371	1823.683848	K	G	434	449
PSM	QATKDAGQISGLNVLR	1233	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3401.4	40.96083	3	1829.844671	1829.843794	R	V	203	219
PSM	ASSTSPVEISEWLDQK	1234	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3901.2	53.47527	3	1855.825571	1855.824091	K	L	188	204
PSM	SESAPTLHPYSPLSPK	1235	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3288.3	38.04677	3	1869.794171	1869.795113	R	G	100	116
PSM	DRSSFYVNGLTLGGQK	1236	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3609.3	46.2414	3	1900.811771	1900.812160	K	C	55	71
PSM	GFSEGLWEIENNPTVK	1237	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3827.2	51.67668	3	1898.845271	1898.845160	K	A	81	97
PSM	DLKPSNLLLNTTCDLK	1238	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3517.3	43.87932	3	1923.933671	1923.937681	R	I	149	165
PSM	TDGFAEAIHSPQVAGVPR	1239	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3307.4	38.5396	3	1930.890971	1930.893842	R	F	2146	2164
PSM	VAPEEHPVLLTEAPLNPK	1240	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3244.4	36.912	3	1953.053771	1953.057128	R	A	96	114
PSM	DQLIYNLLKEEQTPQNK	1241	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3788.2	50.68037	3	2153.037671	2153.040566	K	I	6	23
PSM	DKPTYDEIFYTLSPVNGK	1242	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3784.4	50.58342	3	2165.991371	2165.992219	K	I	444	462
PSM	SCEGQNPELLPKTPISPLK	1243	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3446.5	42.04662	3	2267.028071	2267.031003	K	T	308	327
PSM	DLGLSESGEDVNAAILDESGKK	1244	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3532.4	44.27315	3	2326.056071	2326.057732	K	F	464	486
PSM	GRLTPSPDIIVLSDNEASSPR	1245	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3635.2	46.88303	3	2383.073771	2383.082187	R	S	117	138
PSM	QLSSTSPLAPYPTSQMVSSDR	1246	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3591.5	45.78088	3	2411.013371	2411.011724	R	S	408	429
PSM	DYEIESQNPLASPTNTLLGSAK	1247	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4077.2	56.3607	3	2507.090771	2507.086998	K	E	618	640
PSM	SQEGESVTEDISFLESPNPENK	1248	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3797.3	50.92797	3	2515.062971	2515.063940	K	D	81	103
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1249	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3353.2	39.73035	5	2833.349118	2833.352672	K	S	362	389
PSM	RPPEPTTPWQEDPEPEDENLYEK	1250	sp|Q9NX14|NDUBB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3303.5	38.4457	3	2875.216571	2875.222566	K	N	47	70
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	1251	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3367.5	40.09582	4	2961.187294	2961.178529	R	V	870	899
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	1252	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3282.4	37.89343	4	3159.344894	3159.347523	R	G	2037	2066
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1253	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3543.4	44.55038	5	3385.515618	3385.515651	K	A	399	429
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1254	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3572.4	45.28198	4	3385.520494	3385.515651	K	A	399	429
PSM	ASGVAVSDGVIK	1255	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3350.3	39.65732	2	1223.5754	1223.5794	M	V	2	14
PSM	MEGPLSVFGDR	1256	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4020.2	55.50538	2	1344.5405	1344.5416	-	S	1	12
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1257	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3325.5	39.01358	5	3563.477618	3562.491898	K	V	60	92
PSM	CGNTIPDDDNQVVSLSPGSR	1258	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3234.3	36.65248	3	2209.925171	2209.931092	R	Y	643	663
PSM	ATAEVLNIGKK	1259	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3326.2	39.02979	2	1264.6413	1264.6423	M	L	2	13
PSM	DNLTLWTSDQQDDDGGEGNN	1260	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3683.5	48.12637	3	2194.879571	2192.873028	R	-	228	248
PSM	TEWETAAPAVAETPDIK	1261	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3756.2	49.86915	3	1949.8669	1949.8654	M	L	2	19
PSM	AQETNQTPGPMLCSTGCGFYGNPR	1262	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,7-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.3694.2	48.38917	4	2764.1084	2764.1076	M	T	2	26
PSM	ADQLTEEQIAEFK	1263	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3692.3	48.34315	2	1562.7453	1562.7459	M	E	2	15
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1264	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,11-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3529.3	44.19183	4	2882.1802	2882.1622	M	D	2	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1265	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3523.3	44.0358	4	2882.1802	2882.1622	M	D	2	29
PSM	MDEPSPLAQPLELNQHSR	1266	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3462.5	42.45145	3	2198.9674	2198.9662	-	F	1	19
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1267	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2642.2	21.41705	4	3025.333694	3024.356099	K	S	145	174
PSM	VKLDSPAGTALSPSGHTK	1268	sp|P32322|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2898.2	27.97637	4	1924.872494	1924.869675	K	L	290	308
PSM	IMNTFSVVPSPK	1269	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3306.6	38.52023	2	1415.648047	1414.656755	R	V	163	175
PSM	HEERQDEHGYISR	1270	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2439.2	17.75175	4	1654.744894	1654.744795	K	C	124	137
PSM	GGGTPDANSLAPPGK	1271	sp|Q9BRQ0|PYGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2795.2	25.33	3	1417.620671	1417.623874	R	A	299	314
PSM	SAITPGGLR	1272	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2892.2	27.82208	2	950.457447	950.458647	R	L	417	426
PSM	AGFAGDDAPR	1273	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2654.2	21.71747	2	975.437847	975.441009	K	A	21	31
PSM	SCNCLLLK	1274	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2942.2	29.11338	2	1006.490647	1006.493973	K	V	336	344
PSM	DVNAAIATIK	1275	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3103.2	33.3069	2	1014.569447	1014.570960	K	T	327	337
PSM	AQGAGVTLPPTPSGSR	1276	sp|Q6P996|PDXD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2926.3	28.70835	3	1574.744471	1574.745387	K	T	681	697
PSM	SGTSEFLNK	1277	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2911.3	28.31763	2	1061.440847	1061.443056	K	M	169	178
PSM	EGMTAFVEK	1278	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3237.2	36.7236	2	1090.437847	1090.440614	K	R	274	283
PSM	DVNAAIATIK	1279	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3012.3	30.94633	2	1094.535047	1094.537291	K	T	327	337
PSM	DVVICPDASLEDAKK	1280	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3076.3	32.60555	3	1658.815871	1658.818537	R	E	49	64
PSM	DANNGNLQLR	1281	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2738.3	23.85722	2	1113.548647	1113.552684	K	N	288	298
PSM	WLKSPTTPIDPEK	1282	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3211.2	36.0985	3	1670.731571	1670.735807	K	Q	859	872
PSM	SYDLTPVDK	1283	sp|Q8WVM8|SCFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2977.2	30.02773	2	1116.471047	1116.474022	K	F	316	325
PSM	VTLTSEEEAR	1284	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2699.3	22.85408	2	1133.553647	1133.556432	K	L	306	316
PSM	GHASAPYFGKEEPSVAPSSTGK	1285	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2913.3	28.36992	4	2283.021294	2283.020893	K	T	131	153
PSM	YIDQEELNK	1286	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2752.5	24.23017	2	1150.548847	1150.550619	K	T	198	207
PSM	GQAAVQQLQAEGLSPR	1287	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3144.3	34.37417	3	1731.829571	1731.830513	R	F	43	59
PSM	QLSSGVSEIR	1288	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2949.4	29.30253	2	1154.532047	1154.533268	R	H	80	90
PSM	GNDPLTSSPGR	1289	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2715.4	23.26982	2	1179.490647	1179.492132	R	S	20	31
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1290	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2836.4	26.3981	5	2968.356118	2968.358028	R	L	420	447
PSM	ERKLECLPPEPSPDDPESVK	1291	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3018.4	31.10652	4	2401.090094	2401.087258	K	I	344	364
PSM	NAGVEGSLIVEK	1292	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2987.2	30.28942	2	1214.645847	1214.650667	K	I	482	494
PSM	IGRIEDVTPIPSDSTR	1293	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3053.3	32.01723	3	1834.880471	1834.882608	K	R	126	142
PSM	EAESSPFVER	1294	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2811.4	25.75123	2	1229.493447	1229.496549	K	L	548	558
PSM	RDYDDMSPR	1295	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2634.2	21.22832	2	1233.444647	1233.448553	R	R	278	287
PSM	TSSGDPPSPLVK	1296	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2798.2	25.4062	2	1263.570247	1263.574799	K	Q	80	92
PSM	DKGDEEEEGEEKLEEK	1297	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2684.3	22.47418	3	1891.817771	1891.817077	K	Q	536	552
PSM	ALINSPEGAVGR	1298	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3088.3	32.91928	2	1262.599847	1262.602017	R	S	66	78
PSM	ALINSPEGAVGR	1299	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3096.3	33.1278	2	1262.599847	1262.602017	R	S	66	78
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1300	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3163.3	34.86095	4	2539.244894	2539.247205	R	D	175	200
PSM	GKGGEIQPVSVK	1301	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2694.4	22.72915	2	1277.636047	1277.638068	K	V	55	67
PSM	VGNESPVQELK	1302	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2850.4	26.75663	2	1278.581247	1278.585698	K	Q	46	57
PSM	EQNSPIYISR	1303	sp|O14910|LIN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2902.5	28.09042	2	1285.569047	1285.570382	K	I	127	137
PSM	YCRPESQEHPEADPGSAAPYLK	1304	sp|P40763|STAT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2949.5	29.30587	4	2581.090094	2581.094469	K	T	686	708
PSM	CSGPGLSPGMVR	1305	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3088.4	32.92262	2	1296.536047	1296.535594	K	A	1453	1465
PSM	HTIIPAKSPEK	1306	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2570.2	19.71318	3	1299.659471	1299.658803	R	C	1908	1919
PSM	TRSWDSSSPVDRPEPEAASPTTR	1307	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2894.3	27.87633	4	2608.160894	2608.155489	R	T	352	375
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1308	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3042.4	31.7335	4	2637.338494	2637.341499	R	R	31	56
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1309	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3174.3	35.14663	4	2639.206094	2639.207584	K	S	97	122
PSM	VKLESPTVSTLTPSSPGK	1310	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3175.4	35.17602	3	1986.928571	1986.931606	R	L	290	308
PSM	TQPDGTSVPGEPASPISQR	1311	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2948.5	29.2799	3	2002.896671	2002.899715	R	L	1744	1763
PSM	SSTPLHSPSPIR	1312	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2760.2	24.4243	3	1357.635671	1357.639131	R	V	283	295
PSM	TFDQLTPDESK	1313	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2922.6	28.61375	2	1359.557047	1359.559543	K	E	71	82
PSM	SGGLQTPECLSR	1314	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2930.4	28.81473	2	1383.587647	1383.585381	R	E	431	443
PSM	EFHLNESGDPSSKSTEIK	1315	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2920.6	28.5621	3	2083.903871	2083.909945	K	W	155	173
PSM	ESDFSDTLSPSK	1316	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2988.3	30.31882	2	1391.544847	1391.549372	K	E	444	456
PSM	ICEPGYSPTYK	1317	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2936.3	28.96182	2	1393.559447	1393.562520	K	Q	210	221
PSM	GVQVETISPGDGR	1318	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2905.4	28.16512	2	1393.6191	1393.6233	M	T	2	15
PSM	ASPGTPLSPGSLR	1319	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3199.3	35.78827	2	1398.591647	1398.594562	R	S	33	46
PSM	ASPGTPLSPGSLR	1320	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3207.2	35.99373	2	1398.591647	1398.594562	R	S	33	46
PSM	NQIHVKSPPREGSQGELTPANSQSR	1321	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2721.6	23.43222	4	2796.326894	2796.330434	R	M	462	487
PSM	GGNFGGRSSGPYGGGGQYFAK	1322	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3117.5	33.67825	3	2099.883371	2099.885068	K	P	278	299
PSM	INVYYNEATGGK	1323	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2980.3	30.10973	2	1407.604047	1407.607162	R	Y	47	59
PSM	DTPTSAGPNSFNK	1324	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2751.6	24.20418	2	1414.581247	1414.576590	R	G	138	151
PSM	DALKPNSPLTER	1325	sp|Q5R3I4|TTC38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2792.2	25.2528	3	1419.669971	1419.675910	R	L	446	458
PSM	SAGLEQPTDPVAR	1326	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2932.4	28.86573	2	1419.636647	1419.639524	K	D	361	374
PSM	TPAAAAAMNLASPR	1327	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3096.5	33.13447	2	1420.651647	1420.653400	R	T	2261	2275
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1328	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.2935.6	28.94703	4	2914.281294	2914.285140	K	L	281	308
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	1329	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3237.6	36.73693	4	2933.349694	2933.357299	K	K	62	95
PSM	DCNDTLEEENTNLETPTK	1330	sp|Q9BZE2|PUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3040.5	31.68478	3	2201.864471	2201.867154	R	R	452	470
PSM	TVEVAEGEAVRTPQSVTAKQPPEIDK	1331	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3086.5	32.87355	4	2938.368094	2938.372615	R	K	132	158
PSM	AIEINPDSAQPYK	1332	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3132.4	34.06605	2	1524.681847	1524.686140	R	W	174	187
PSM	NHCGIASAASYPTV	1333	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3210.4	36.07902	2	1526.619047	1526.622494	R	-	320	334
PSM	FQRPGDPQSAQDK	1334	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2610.4	20.63595	3	1552.666871	1552.667136	K	A	294	307
PSM	NRDSDKTDTDWR	1335	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2535.2	18.94638	3	1587.630671	1587.631479	R	A	189	201
PSM	APVPGTPDSLSSGSSR	1336	sp|Q9UJZ1|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2848.5	26.70797	2	1593.696847	1593.703581	K	D	322	338
PSM	ETPHSPGVEDAPIAK	1337	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2766.3	24.58365	3	1626.725171	1626.729068	R	V	486	501
PSM	TTEEQVQASTPCPR	1338	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2586.2	20.03188	3	1682.695871	1682.697116	K	T	97	111
PSM	IDEMPEAAVKSTANK	1339	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2719.2	23.36682	3	1698.750371	1698.753568	R	Y	30	45
PSM	GLGKPGGQGDAIQLSPK	1340	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2969.3	29.82213	3	1701.839171	1701.845101	K	L	160	177
PSM	NLDIERPTYTNLNR	1341	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3117.3	33.67159	3	1717.874171	1717.874747	R	L	216	230
PSM	FSEGVLQSPSQDQEK	1342	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3047.3	31.86068	3	1757.751071	1757.750926	R	L	428	443
PSM	MDATANDVPSPYEVR	1343	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3056.2	32.09243	3	1759.710971	1759.712432	K	G	434	449
PSM	RLSSSSATLLNSPDR	1344	sp|Q14244|MAP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2965.2	29.71438	3	1762.758371	1762.765210	K	A	198	213
PSM	SLSSQIETMRSPDGSK	1345	sp|P05997|CO5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3073.3	32.52808	3	1801.788071	1801.791745	K	K	1274	1290
PSM	VDCTAHSDVCSAQGVR	1346	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2607.5	20.56207	3	1840.724171	1840.723348	K	G	119	135
PSM	DETVSDCSPHIANIGR	1347	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3050.3	31.93888	3	1849.765571	1849.766593	K	L	200	216
PSM	TSPSSPAPLPHQEATPR	1348	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2757.5	24.3566	3	1851.848771	1851.851643	R	A	169	186
PSM	QLVRGEPNVSYICSR	1349	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3072.3	32.50303	3	1856.860871	1856.860433	K	Y	269	284
PSM	SAPAMQSSGSFNYARPK	1350	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2973.3	29.92662	3	1877.808971	1877.813149	R	Q	719	736
PSM	MLDAEDIVNTARPDEK	1351	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3205.3	35.94477	3	1895.832671	1895.833609	K	A	240	256
PSM	NRVIGSGCNLDSARFR	1352	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3072.4	32.50637	3	1980.835271	1980.839060	K	Y	156	172
PSM	GNSRPGTPSAEGGSTSSTLR	1353	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2593.5	20.2157	3	1997.877671	1997.880377	R	A	383	403
PSM	TPSPKEEDEEPESPPEK	1354	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2584.3	19.98442	3	2003.820071	2003.824878	K	K	202	219
PSM	EFQDAGEQVVSSPADVAEK	1355	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3174.4	35.14997	3	2084.888771	2084.893961	K	A	77	96
PSM	AEPQPLSPASSSYSVSSPR	1356	sp|P18850|ATF6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3159.5	34.76295	3	2105.867471	2105.870797	K	S	88	107
PSM	NVASGGGGVGDGVQEPTTGNWR	1357	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3138.6	34.22965	3	2193.941171	2193.944040	K	G	569	591
PSM	NSLDASRPAGLSPTLTPGER	1358	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3193.4	35.63493	3	2197.969571	2197.976994	K	Q	138	158
PSM	KLEKEEEEGISQESSEEEQ	1359	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2695.5	22.75812	3	2235.981071	2235.986661	K	-	89	108
PSM	GSLAEAVGSPPPAATPTPTPPTR	1360	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3220.5	36.34103	3	2331.047471	2331.054910	R	K	446	469
PSM	SISSPSVSSETMDKPVDLSTRK	1361	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3053.2	32.0139	4	2430.132894	2430.134936	K	E	2802	2824
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	1362	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3102.6	33.29448	3	2494.087871	2494.089063	R	L	815	839
PSM	DCAVKPCQSDEVPDGIKSASYK	1363	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.2980.2	30.1064	4	2533.082894	2533.086607	R	Y	98	120
PSM	DGVVEITGKHEERQDEHGYISR	1364	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2828.2	26.18685	5	2553.215618	2553.220792	K	C	115	137
PSM	IGPLGLSPK	1365	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	38.68958	2	960.501447	960.504534	K	K	32	41
PSM	SADTLWGIQK	1366	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3244.2	36.90533	2	1117.573047	1117.576774	K	E	319	329
PSM	LVLDSVKLEA	1367	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3598.2	45.95277	2	1165.597447	1165.599557	R	-	99	109
PSM	AAALAAAVAQDPAASGAPSS	1368	sp|Q8TAE8|G45IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3284.3	37.94245	3	1775.804171	1775.809109	R	-	203	223
PSM	DAGTIAGLNVLR	1369	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3510.2	43.69338	2	1198.665047	1198.666986	K	I	160	172
PSM	TLTPISAAYAR	1370	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3239.3	36.77851	2	1242.590047	1242.600954	K	A	295	306
PSM	LLLDPSSPPTK	1371	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3255.3	37.19338	2	1246.615847	1246.621021	K	A	21	32
PSM	NIEDVIAQGIGK	1372	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3671.3	47.80957	2	1255.675847	1255.677216	K	L	50	62
PSM	VLLSDSNLHDA	1373	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3245.2	36.9313	2	1262.553447	1262.554398	K	-	302	313
PSM	GYFEYIEENK	1374	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3395.2	40.79682	2	1290.574047	1290.576833	R	Y	256	266
PSM	DITEEIMSGAR	1375	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3558.2	44.91512	2	1300.534247	1300.537033	K	T	191	202
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	1376	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3273.2	37.65917	5	3265.402618	3265.402471	K	-	708	738
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	1377	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3612.3	46.31987	4	2644.237294	2644.238156	R	L	55	81
PSM	QVVESAYEVIK	1378	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3323.4	38.95723	2	1343.636647	1343.637399	K	L	233	244
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1379	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3558.3	44.91845	5	3385.515618	3385.515651	K	A	399	429
PSM	DFTPVCTTELGR	1380	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3252.4	37.11892	2	1394.645247	1394.650015	R	A	42	54
PSM	DINTFVGTPVEK	1381	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3275.2	37.70984	2	1398.641247	1398.643213	K	L	1916	1928
PSM	ESVPEFPLSPPK	1382	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	45.24932	2	1405.650247	1405.653049	K	K	30	42
PSM	FASENDLPEWK	1383	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3543.5	44.55372	2	1414.575647	1414.580613	R	E	58	69
PSM	AAPEASSPPASPLQHLLPGK	1384	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3599.3	45.98205	3	2126.976971	2126.980288	K	A	686	706
PSM	TLTIVDTGIGMTK	1385	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3453.4	42.22123	2	1428.693447	1428.693534	R	A	28	41
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1386	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3638.3	46.95982	4	2881.092894	2881.094982	K	T	701	725
PSM	TVDNFVALATGEK	1387	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3403.4	41.0136	2	1443.655447	1443.664677	K	G	72	85
PSM	ILATPPQEDAPSVDIANIR	1388	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3771.2	50.2616	3	2178.992771	2178.996332	K	M	284	303
PSM	SLPTPAVLLSPTK	1389	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3737.3	49.43647	2	1482.712647	1482.713615	K	E	632	645
PSM	SLPTPAVLLSPTK	1390	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3728.2	49.22747	2	1482.712647	1482.713615	K	E	632	645
PSM	QASPNIVIALSGNK	1391	sp|P20339|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3522.5	44.01603	2	1490.744047	1490.749409	R	A	121	135
PSM	TLTIVDTGIGMTK	1392	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3452.5	42.19912	2	1524.655047	1524.654780	R	A	28	41
PSM	TTPSVVAFTADGER	1393	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3333.4	39.21867	2	1529.672847	1529.676304	R	L	86	100
PSM	LQALVNSLCAGQSP	1394	sp|Q6XQN6|PNCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3603.5	46.09352	2	1536.699047	1536.700745	R	-	525	539
PSM	TSESTGSLPSPFLR	1395	sp|O95456|PSMG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3509.5	43.68062	2	1557.706247	1557.707604	K	A	177	191
PSM	NLNNSNLFSPVNR	1396	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3403.5	41.01693	2	1567.708647	1567.714421	K	D	604	617
PSM	VYELSNVQEDSQPMCYSNCPDGQSTAK	1397	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:4,19-UNIMOD:4,25-UNIMOD:21	ms_run[1]:scan=1.1.3381.5	40.44098	4	3186.262494	3186.261747	K	T	78	105
PSM	QQEPVTSTSLVFGK	1398	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3384.2	40.50885	3	1599.752471	1599.754554	K	K	1107	1121
PSM	DTCYSPKPSVYLSTPSSASK	1399	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,3-UNIMOD:4,14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3330.6	39.14767	3	2413.913471	2413.919144	K	A	538	558
PSM	QSKPVTTPEEIAQVATISANGDK	1400	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3399.5	40.91238	3	2463.182471	2463.189415	K	E	158	181
PSM	DHMVSPTAVAFLER	1401	sp|O60499|STX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3663.2	47.59842	3	1651.740971	1651.742944	K	N	104	118
PSM	TVSLTPSPTTQVETPDLVDHDNTSPLFR	1402	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,14-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3995.3	55.12342	4	3306.411694	3306.413568	K	T	565	593
PSM	DFTVSAMHGDMDQK	1403	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3243.2	36.8795	3	1660.621871	1660.626259	R	E	296	310
PSM	TLTAAAVSGAQPILSK	1404	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3500.2	43.43182	3	1686.801371	1686.799470	R	L	69	85
PSM	VTNGAFTGEISPGMIK	1405	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3344.2	39.49847	3	1716.775271	1716.779389	K	D	107	123
PSM	NQVAMNPTNTVFDAK	1406	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3251.5	37.0965	2	1728.749647	1728.754237	K	R	57	72
PSM	SQPEPSPVLSQLSQR	1407	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	38.01703	3	1731.814871	1731.819280	K	Q	427	442
PSM	NQEQLAAELAEFTAK	1408	sp|P35241|RADI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3743.3	49.57435	3	1741.794971	1741.792396	K	I	413	428
PSM	EAIQAYSESLMTSAPK	1409	sp|Q8WTV0-2|SCRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3477.2	42.83216	3	1804.799171	1804.795433	K	G	485	501
PSM	DMYTICQSAGLDGLAK	1410	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3682.3	48.09303	3	1821.767471	1821.767838	R	K	522	538
PSM	GQDGSPQIENIQPFSAK	1411	sp|P42226|STAT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3390.4	40.67268	3	1894.847171	1894.846223	R	D	579	596
PSM	KYEQGFITDPVVLSPK	1412	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3510.4	43.70005	3	1899.938771	1899.938332	K	D	109	125
PSM	EGSVLDILKSPGFASPK	1413	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4071.2	56.29343	3	1903.874471	1903.873363	K	I	605	622
PSM	EVDGLLTSEPMGSPVSSK	1414	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3479.2	42.88382	3	1911.851471	1911.853676	K	T	582	600
PSM	EVDGLLTSEPMGSPVSSK	1415	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	43.09292	3	1911.851471	1911.853676	K	T	582	600
PSM	DATNVGDEGGFAPNILENK	1416	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3538.2	44.41777	3	1959.916571	1959.917400	K	E	203	222
PSM	SQIFSTASDNQPTVTIK	1417	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3518.2	43.9018	3	1995.857171	1995.859170	K	V	448	465
PSM	KEESEESDDDMGFGLFD	1418	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4161.2	57.78308	3	2028.719471	2028.718364	K	-	98	115
PSM	SSSPAPADIAQTVQEDLR	1419	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3588.3	45.6962	3	2043.851471	2043.855147	K	T	230	248
PSM	AIGGEFSDTNAAVEGTPLPK	1420	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3349.5	39.63857	3	2052.937871	2052.940517	K	A	242	262
PSM	DCCVEPGTELSPTLPHQL	1421	sp|Q14012|KCC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3666.2	47.67636	3	2131.895171	2131.895558	R	-	353	371
PSM	SQGYDWSEPFSPGEDEFK	1422	sp|Q86TI2|DPP9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3895.2	53.31908	3	2183.837471	2183.836112	K	C	463	481
PSM	CGNTIPDDDNQVVSLSPGSR	1423	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3242.2	36.85367	3	2209.925171	2209.931092	R	Y	643	663
PSM	AGSPRGSPLAEGPQAFFPER	1424	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3756.4	49.88248	3	2229.962771	2229.960950	R	G	181	201
PSM	DSALQDTDDSDDDPVLIPGAR	1425	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3618.3	46.47495	3	2293.953071	2293.958746	R	Y	648	669
PSM	NSSTPGLQVPVSPTVPIQNQK	1426	sp|Q03164|KMT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3516.5	43.85945	3	2350.095071	2350.097109	R	Y	3025	3046
PSM	GRLTPSPDIIVLSDNEASSPR	1427	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3625.3	46.64608	3	2383.073771	2383.082187	R	S	117	138
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1428	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3706.4	48.70537	3	2407.989371	2407.988786	R	-	223	246
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1429	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3560.5	44.9751	3	2435.109971	2435.115856	K	A	30	54
PSM	ADLLLSTQPGREEGSPLELER	1430	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3683.6	48.1297	3	2469.118871	2469.118966	K	L	593	614
PSM	SQEGESVTEDISFLESPNPENK	1431	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3805.4	51.12928	3	2515.062971	2515.063940	K	D	81	103
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	1432	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3885.3	53.09807	3	2540.085971	2540.089049	K	S	180	204
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	1433	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4170.2	57.90692	3	2747.139671	2747.134344	K	D	208	233
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1434	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:21	ms_run[1]:scan=1.1.4633.2	62.67393	4	2968.328494	2968.325196	R	S	59	86
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1435	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3361.3	39.9358	5	2989.540118	2989.541321	K	G	202	228
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	1436	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3274.3	37.68785	4	3159.344894	3159.347523	R	G	2037	2066
PSM	DDDIAALVVDNGSGMCK	1437	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3822.3	51.55725	2	1836.7888	1836.7865	M	A	2	19
PSM	VAPEEHPVLLTEAPLNPK	1438	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3361.4	39.93913	3	2033.0221	2033.0229	R	A	96	114
PSM	VLLPEYGGTK	1439	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3235.2	36.67362	2	1155.554847	1155.557692	K	V	71	81
PSM	ATGANATPLDFPSK	1440	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3428.3	41.58658	2	1510.6666	1510.6700	M	K	2	16
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1441	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3778.4	50.45368	4	3523.454094	3522.472617	K	F	604	634
PSM	QLSSGVSEIR	1442	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	39.7085	2	1137.5031	1137.5062	R	H	80	90
PSM	DGLNQTTIPVSPPSTTKPSR	1443	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3130.3	34.01053	3	2175.051971	2175.057278	K	A	573	593
PSM	SSIGTGYDLSASTFSPDGR	1444	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3904.3	53.55197	3	2038.8536	2038.8516	M	V	2	21
PSM	SHPSPQAKPSNPSNPR	1445	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2449.2	17.89003	3	1821.8137	1821.8154	M	V	2	18
PSM	DVDDGSGSPHSPHQLSSK	1446	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2545.3	19.13427	3	2008.752071	2008.756496	R	S	2022	2040
PSM	ADDAGLETPLCSEQFGSGEAR	1447	sp|Q96GQ5|RUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3643.4	47.08897	3	2330.9419	2330.9357	M	G	2	23
PSM	AHSPVQSGLPGMQNLK	1448	sp|Q9Y6E0-2|STK24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3388.4	40.62002	3	1784.8234	1784.8275	M	A	2	18
PSM	MESETEPEPVTLLVKSPNQR	1449	sp|Q15011|HERP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=1.1.3777.2	50.41758	3	2405.1112	2405.1180	-	H	1	21
PSM	GPPSPPAPVMHSPSRK	1450	sp|Q13573|SNW1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2771.3	24.71247	3	1800.794771	1800.778357	R	M	221	237
PSM	KLEDVKNSPTFK	1451	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2689.6	22.60715	2	1484.724447	1484.727611	K	S	164	176
PSM	TLRLNQPGTPTR	1452	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2754.3	24.27213	3	1432.716371	1432.718778	K	T	386	398
PSM	DGLTDVYNK	1453	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2928.2	28.75652	2	1023.483647	1023.487290	K	I	182	191
PSM	NGRVEIIANDQGNR	1454	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2698.3	22.8283	3	1554.782771	1554.786266	K	I	47	61
PSM	AAVVTSPPPTTAPHK	1455	sp|P35611|ADDA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2654.3	21.72413	3	1552.763771	1552.765059	R	E	7	22
PSM	QSPASPPPLGGGAPVR	1456	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3021.2	31.17848	3	1566.755171	1566.755557	R	T	1444	1460
PSM	TLSDYNIQK	1457	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2829.2	26.21277	2	1080.541447	1080.545139	R	E	55	64
PSM	ELTSTCSPIISKPK	1458	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2872.2	27.32163	3	1639.785071	1639.789226	K	P	774	788
PSM	SPGAPGPLTLK	1459	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3123.4	33.8306	2	1116.557647	1116.558027	R	E	344	355
PSM	KVEPVPVTKQPTPPSEAAASK	1460	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2771.2	24.70913	4	2240.139694	2240.145365	K	K	142	163
PSM	DSGRGDSVSDSGSDALR	1461	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2618.3	20.83987	3	1679.732771	1679.734684	R	S	70	87
PSM	YGVQADRVDKSAVGFDYQGK	1462	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3110.2	33.48512	4	2282.037294	2282.036877	K	T	162	182
PSM	RLQEDPNYSPQRFPNAQR	1463	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2903.4	28.11342	4	2295.055294	2295.054593	K	A	1109	1127
PSM	APVQPQQSPAAAPGGTDEKPSGK	1464	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2567.4	19.63093	4	2297.064494	2297.068906	K	E	9	32
PSM	DKRPLSGPDVGTPQPAGLASGAK	1465	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2970.5	29.8551	4	2298.133294	2298.136926	R	L	176	199
PSM	AVASPEATVSQTDENK	1466	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2769.3	24.6608	3	1725.744371	1725.745840	K	A	495	511
PSM	QLRFEDVVNQSSPK	1467	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3206.3	35.97053	3	1725.804071	1725.808715	K	N	190	204
PSM	VLLPEYGGTK	1468	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3209.2	36.04582	2	1155.554847	1155.557692	K	V	71	81
PSM	ESEDKPEIEDVGSDEEEEKK	1469	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2753.3	24.24598	4	2320.007694	2320.007791	K	D	251	271
PSM	RGGSGSHNWGTVKDELTESPK	1470	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2951.3	29.35142	4	2321.042094	2321.043754	K	Y	216	237
PSM	KRDHANYEEDENGDITPIK	1471	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2744.3	24.01257	4	2323.010894	2323.011785	R	A	132	151
PSM	TISPMVMDAK	1472	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3137.4	34.19677	2	1171.499647	1171.501834	K	A	793	803
PSM	GHASAPYFGKEEPSVAPSSTGK	1473	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.2976.3	30.00512	4	2362.983694	2362.987224	K	T	131	153
PSM	WNSVSPASAGK	1474	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2775.4	24.81965	2	1182.502647	1182.507054	K	R	304	315
PSM	GCESAVDELK	1475	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.2935.3	28.93703	2	1186.453447	1186.457721	K	G	441	451
PSM	LPDLSPVENK	1476	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3187.2	35.47143	2	1190.550447	1190.558421	K	E	2101	2111
PSM	DITSDTSGDFR	1477	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2957.3	29.50828	2	1212.524247	1212.525861	K	N	167	178
PSM	AASPPASASDLIEQQQK	1478	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3173.2	35.1172	3	1819.832171	1819.835324	R	R	333	350
PSM	IPGSPPESMGR	1479	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.2626.2	21.05027	2	1222.505247	1222.505340	K	G	58	69
PSM	AVEHINKTIAPALVSK	1480	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2998.4	30.58362	3	1849.905071	1849.910417	K	K	65	81
PSM	EEGSPLELER	1481	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3023.3	31.23398	2	1237.522847	1237.522763	R	L	604	614
PSM	VDSPTVTTTLK	1482	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2875.2	27.39965	2	1240.591247	1240.595200	K	N	458	469
PSM	SSEHINEGETAMLVCK	1483	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2982.4	30.1654	3	1883.775371	1883.779466	K	S	228	244
PSM	DNSTMGYMMAK	1484	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:35	ms_run[1]:scan=1.1.2825.4	26.11545	2	1263.486247	1263.493380	R	K	486	497
PSM	ALINSPEGAVGR	1485	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3098.2	33.1765	2	1262.599847	1262.602017	R	S	66	78
PSM	ALINSPEGAVGR	1486	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3104.3	33.3361	2	1262.599847	1262.602017	R	S	66	78
PSM	ELASPVSPELR	1487	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3102.3	33.28448	2	1276.601847	1276.606433	K	Q	175	186
PSM	RFSEGVLQSPSQDQEK	1488	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2929.3	28.78537	3	1913.850071	1913.852037	R	L	427	443
PSM	GCLLYGPPGTGK	1489	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3165.3	34.91387	2	1298.570447	1298.573025	K	T	169	181
PSM	QHEAPSNRPLNELLTPQGPSPR	1490	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	36.04915	4	2597.175294	2597.178881	R	T	167	189
PSM	VIGSGCNLDSAR	1491	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2855.4	26.88635	2	1327.553847	1327.559166	R	F	158	170
PSM	LDQPVSAPPSPR	1492	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2785.6	25.08435	2	1342.623047	1342.628231	K	D	235	247
PSM	NGEVVHTPETSV	1493	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2822.4	26.03752	2	1347.568247	1347.570776	K	-	454	466
PSM	MDSTANEVEAVK	1494	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2783.6	25.03288	2	1372.552447	1372.558163	K	V	425	437
PSM	AVADAIRTSLGPK	1495	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2987.3	30.29275	2	1377.697447	1377.701731	K	G	43	56
PSM	VLQATVVAVGSGSK	1496	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3015.4	31.02728	2	1394.714847	1394.717047	K	G	41	55
PSM	NSGSFPSPSISPR	1497	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3125.5	33.88678	2	1411.619047	1411.613310	R	-	1258	1271
PSM	DQMEGSPNSSESFEHIAR	1498	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3002.5	30.69137	3	2115.815171	2115.820479	R	S	774	792
PSM	GILAADESTGSIAK	1499	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3073.5	32.53475	2	1411.654247	1411.659591	K	R	29	43
PSM	FQTGNKSPEVLR	1500	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2784.6	25.05865	2	1454.687247	1454.691894	R	A	432	444
PSM	TDGEPGPQGWSPR	1501	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3024.4	31.26322	2	1462.580847	1462.587823	K	E	75	88
PSM	NAPAAVDEGSISPR	1502	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2821.5	26.01488	2	1462.640447	1462.645338	R	T	373	387
PSM	SCFESSPDPELK	1503	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3014.5	31.00503	2	1474.564647	1474.568728	R	S	871	883
PSM	SPPKSPEEEGAVSS	1504	sp|Q01130|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2544.2	19.11503	2	1479.611447	1479.613035	K	-	208	222
PSM	CTGGEVGATSALAPK	1505	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2897.4	27.95722	2	1497.651847	1497.653460	R	I	17	32
PSM	RPESPSEISPIK	1506	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2837.4	26.42302	2	1498.644647	1498.646992	K	G	218	230
PSM	EGHLSPDIVAEQK	1507	sp|P15559|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2940.3	29.06417	3	1501.681871	1501.681389	K	K	78	91
PSM	SGSSSPDSEITELK	1508	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3128.6	33.96832	2	1515.632047	1515.634164	R	F	571	585
PSM	SPVSTRPLPSASQK	1509	sp|Q8ND56|LS14A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2667.2	22.03533	3	1533.753971	1533.755223	R	A	216	230
PSM	ELSDQATASPIVAR	1510	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2948.2	29.2699	3	1536.716471	1536.718503	K	T	88	102
PSM	TRVSDPISTSESSEEEEEAEAETAKATPR	1511	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3082.5	32.76992	4	3215.398094	3215.399086	K	L	76	105
PSM	GRTVIIEQSWGSPK	1512	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3138.2	34.21632	3	1636.792571	1636.797422	K	V	59	73
PSM	SCEVPTRLNSASLK	1513	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2969.5	29.8288	2	1640.753247	1640.759322	R	Q	97	111
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	1514	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2968.6	29.806	5	4165.734118	4165.736558	K	D	522	558
PSM	IDEMPEAAVKSTANK	1515	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2800.3	25.46128	3	1682.753171	1682.758653	R	Y	30	45
PSM	DSSQSPSQVDQFCK	1516	sp|Q13637|RAB32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2939.5	29.04445	2	1691.645247	1691.649832	K	E	150	164
PSM	KIFVGGLSPDTPEEK	1517	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3174.2	35.1433	3	1695.810071	1695.812069	K	I	183	198
PSM	ASSPSPLTIGTPESQR	1518	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3152.2	34.57224	3	1706.783471	1706.787645	K	K	521	537
PSM	QNSVQEQPGTACLSK	1519	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2701.3	22.9054	3	1725.738371	1725.739315	K	F	223	238
PSM	NQTAEKEEFEHQQK	1520	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2454.2	17.95965	4	1744.802894	1744.801642	K	E	584	598
PSM	EQGPYETYEGSPVSK	1521	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2933.6	28.89802	2	1749.710447	1749.713477	K	G	549	564
PSM	ICEPGYSPTYKQDK	1522	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2800.5	25.46795	3	1764.739271	1764.743004	K	H	210	224
PSM	ATEPPSPDAGELSLASR	1523	sp|Q8IYB8|SUV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3205.2	35.94143	3	1776.788771	1776.793125	K	L	720	737
PSM	RELHGQNPVVTPCNK	1524	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2574.3	19.80408	4	1827.844094	1827.845118	K	Q	147	162
PSM	GEAAAERPGEAAVASSPSK	1525	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2573.3	19.78218	3	1863.833171	1863.836387	K	A	12	31
PSM	DVQDSLTVSNEAQTAK	1526	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2961.4	29.61622	3	1864.744871	1864.749285	K	E	211	227
PSM	KPVTVSPTTPTSPTEGEAS	1527	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2818.4	25.93322	3	1964.895071	1964.897984	R	-	505	524
PSM	HRVIGSGCNLDSARFR	1528	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2970.3	29.84843	4	2003.852494	2003.855045	K	Y	157	173
PSM	NGNTNSLNLSSPNPMENK	1529	sp|Q9UPQ9|TNR6B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3177.5	35.22817	3	2009.849171	2009.851385	K	G	375	393
PSM	GPPASSPAPAPKFSPVTPK	1530	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	35.04278	3	2071.879871	2071.882228	R	F	254	273
PSM	IASPVSRKEPPLTPVPLK	1531	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3112.2	33.53702	4	2088.079694	2088.078545	K	R	207	225
PSM	STTPPPAEPVSLPQEPPKPR	1532	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3078.4	32.66212	3	2204.085371	2204.087850	K	V	225	245
PSM	EKTPSPKEEDEEPESPPEK	1533	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2565.4	19.58033	4	2260.958494	2260.962435	K	K	200	219
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	1534	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3092.3	33.02303	3	2268.858071	2268.864409	R	S	326	351
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1535	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3176.4	35.20038	4	2727.230494	2727.234862	R	G	70	97
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1536	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2829.3	26.2161	4	2968.351294	2968.358028	R	L	420	447
PSM	GAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE	1537	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3062.5	32.2587	5	3704.515618	3704.512278	K	-	158	196
PSM	ESVPEFPLSPPK	1538	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3554.3	44.81963	2	1405.645647	1405.653049	K	K	30	42
PSM	MLTFNPNK	1539	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3250.2	37.06045	2	1043.449247	1043.451119	R	R	310	318
PSM	GGVVTSNPLGF	1540	sp|P49748|ACADV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4059.2	56.01785	2	1126.506047	1126.505991	R	-	645	656
PSM	SCEGQNPELLPKTPISPLK	1541	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3447.2	42.06228	4	2267.028894	2267.031003	K	T	308	327
PSM	STFVLDEFK	1542	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3758.2	49.9206	2	1164.510647	1164.510408	K	R	286	295
PSM	DQIYDIFQK	1543	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3605.2	46.13543	2	1168.573647	1168.576440	K	L	194	203
PSM	ENSREALAEAALESPRPALVR	1544	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3288.2	38.04343	4	2358.163294	2358.169288	K	S	267	288
PSM	IVITDCGQLS	1545	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3276.2	37.73535	2	1184.515447	1184.514841	K	-	198	208
PSM	GTPLISPLIK	1546	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3744.3	49.59713	2	1197.579647	1197.581144	R	W	826	836
PSM	SMSAPVIFDR	1547	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3500.3	43.43515	2	1201.517847	1201.520261	K	S	117	127
PSM	SLNILTAFQK	1548	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3989.3	55.01975	2	1213.610247	1213.610790	K	K	244	254
PSM	VYWDNGAQIISPHDK	1549	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3294.3	38.2039	3	1821.805871	1821.808715	K	G	176	191
PSM	EVSSLEGSPPPCLGQEEAVCTK	1550	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3307.3	38.53627	4	2453.043294	2453.049158	K	I	1388	1410
PSM	DIDISSPEFK	1551	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3378.3	40.35658	2	1229.519847	1229.521701	K	I	172	182
PSM	GDVVNQDDLYQALASGK	1552	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3620.3	46.52419	3	1871.829371	1871.830239	R	I	246	263
PSM	SQIFSTASDNQPTVTIK	1553	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3312.3	38.6668	3	1915.889771	1915.892839	K	V	448	465
PSM	DLKPSNLLLNTTCDLK	1554	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3525.2	44.08458	3	1923.933671	1923.937681	R	I	149	165
PSM	SLNILTAFQK	1555	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4572.4	62.13702	2	1293.579247	1293.577121	K	K	244	254
PSM	NLEELNISSAQ	1556	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3482.3	42.9653	2	1296.559247	1296.559877	K	-	120	131
PSM	GHVTQDAPIPGSPLYTIK	1557	sp|Q15029|U5S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3345.4	39.53113	3	1972.961771	1972.965944	R	A	855	873
PSM	DQPAFTPSGILTPHALGSR	1558	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3760.4	49.98592	3	2123.941871	2123.944237	R	N	428	447
PSM	WPDPEDLLTPR	1559	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3902.4	53.5109	2	1417.628447	1417.627897	R	W	39	50
PSM	SATLASIDAELQK	1560	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3588.4	45.69953	2	1425.672847	1425.675241	K	L	527	540
PSM	EFSPFGSITSAK	1561	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3890.2	53.20735	2	1429.554247	1429.556780	K	V	313	325
PSM	NEDGTWPRGPSTPKSPGASNFSTLPK	1562	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3310.3	38.61437	4	2887.252894	2887.257920	K	I	215	241
PSM	SSTVGLVTLNDMK	1563	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3557.4	44.897	2	1443.663647	1443.668047	K	A	62	75
PSM	KYEQGFITDPVVLSPKDR	1564	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3327.3	39.05915	3	2171.061671	2171.066387	K	V	109	127
PSM	SVWGSLAVQNSPK	1565	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3439.5	41.86478	2	1451.678247	1451.680995	K	G	343	356
PSM	LNSPTDSTPALLSATVTPQK	1566	sp|Q9H4X1|RGCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3575.4	45.36015	3	2199.992771	2200.006562	K	A	95	115
PSM	LNSPTDSTPALLSATVTPQK	1567	sp|Q9H4X1|RGCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3567.2	45.14557	3	2199.992771	2200.006562	K	A	95	115
PSM	GALQNIIPASTGAAK	1568	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3318.5	38.83028	2	1490.746447	1490.749409	R	A	201	216
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1569	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3343.6	39.48578	4	2989.537694	2989.541321	K	G	202	228
PSM	LTFDTTFSPNTGK	1570	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3469.5	42.63463	2	1507.658447	1507.659591	K	K	108	121
PSM	TPSSDVLVFDYTK	1571	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3729.4	49.24682	2	1550.691047	1550.690557	K	H	144	157
PSM	EAAFGGGLLSPGPEAT	1572	sp|Q01201|RELB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3868.2	52.67073	2	1552.679647	1552.681055	R	-	564	580
PSM	GSPHYFSPFRPY	1573	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3804.2	51.09628	3	1613.609171	1613.610547	R	-	210	222
PSM	QEEEQDLDGEKGPSSEGPEEEDGEGFSFK	1574	sp|P84157|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	39.53447	4	3264.270094	3264.277968	R	Y	114	143
PSM	IFVGGLSPDTPEEK	1575	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3528.3	44.16602	2	1647.682047	1647.683437	K	I	184	198
PSM	VDIDTPDINIEGSEGK	1576	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3387.3	40.59093	3	1780.781171	1780.776806	K	F	3712	3728
PSM	DDGLFSGDPNWFPKK	1577	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3870.2	52.71737	3	1801.770071	1801.771267	R	S	140	155
PSM	RTLDFDPLLSPASPK	1578	sp|Q53H80|AKIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3902.2	53.49757	3	1815.815771	1815.820934	K	R	9	24
PSM	VLLPEYGGTKVVLDDK	1579	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3443.2	41.95878	3	1824.930971	1824.927433	K	D	71	87
PSM	GADFLVTEVENGGSLGSK	1580	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3825.2	51.62177	3	1858.836371	1858.834990	K	K	189	207
PSM	VSSGYVPPPVATPFSSK	1581	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3419.2	41.4049	3	1878.817271	1878.820599	R	S	168	185
PSM	ALYDNVAESPDELSFR	1582	sp|P56945|BCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3684.2	48.14163	3	1904.815271	1904.819339	K	K	10	26
PSM	LSPPYSSPQEFAQDVGR	1583	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3580.3	45.48728	3	1956.858071	1956.861873	K	M	751	768
PSM	SAESPTSPVTSETGSTFK	1584	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3286.3	37.99428	3	1971.772271	1971.775165	K	K	280	298
PSM	DMGAQYAAASPAWAAAQQR	1585	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3392.4	40.72497	3	2042.865671	2042.866975	K	S	478	497
PSM	LSGSNPYTTVTPQIINSK	1586	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3452.4	42.19578	3	2078.928971	2078.932669	K	W	605	623
PSM	DNLTLWTSDQQDEEAGEGN	1587	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3659.3	47.49795	3	2120.874071	2120.877051	R	-	228	247
PSM	DQLIYNLLKEEQTPQNK	1588	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3779.2	50.466	3	2153.037671	2153.040566	K	I	6	23
PSM	ATESGAQSAPLPMEGVDISPK	1589	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3504.2	43.53643	3	2163.972671	2163.975917	K	Q	8	29
PSM	IIEVAPQVATQNVNPTPGATS	1590	sp|P49903|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3430.5	41.64183	3	2186.061671	2186.062029	R	-	372	393
PSM	DLGTQNHTSELILSSPPGQK	1591	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3263.4	37.40653	3	2201.030471	2201.036543	K	V	385	405
PSM	QFTPCQLLADHANSPNKK	1592	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3295.6	38.23995	3	2227.941371	2227.948671	K	F	743	761
PSM	QFTPCQLLADHANSPNKK	1593	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3291.3	38.12538	4	2227.946494	2227.948671	K	F	743	761
PSM	QHPQPYIFPDSPGGTSYER	1594	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3312.6	38.6768	3	2254.964471	2254.968463	R	Y	75	94
PSM	TLEAEFNSPSPPTPEPGEGPR	1595	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3377.6	40.34158	3	2367.964271	2367.966154	K	K	525	546
PSM	DSGSDEDFLMEDDDDSDYGSSK	1596	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3472.5	42.71265	3	2427.867071	2427.865619	K	K	129	151
PSM	LRELDPSLVSANDSPSGMQTR	1597	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3375.5	40.28905	3	2432.040371	2432.044421	K	C	2148	2169
PSM	EGPYSISVLYGDEEVPRSPFK	1598	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3796.2	50.90192	3	2448.122771	2448.125024	R	V	1516	1537
PSM	GVSASAVPFTPSSPLLSCSQEGSR	1599	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3721.2	49.08337	3	2580.095771	2580.096851	K	H	559	583
PSM	TDLNPDNLQGGDDLDPNYVLSSR	1600	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3704.5	48.66043	3	2597.126471	2597.128271	K	V	108	131
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1601	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3250.6	37.07378	3	2619.207371	2619.213536	R	D	175	200
PSM	FNEEHIPDSPFVVPVASPSGDAR	1602	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3709.2	48.78012	3	2626.118471	2626.114215	K	R	2311	2334
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	1603	sp|Q9Y5Y0|FLVC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3619.4	46.50288	3	2644.237571	2644.238156	R	L	55	81
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1604	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3625.4	46.64942	3	2881.093571	2881.094982	K	T	701	725
PSM	VVLAYEPVWAIGTGKTATPQQAQEVHEK	1605	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3842.2	52.04207	5	3289.491118	3289.486279	K	L	198	226
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	1606	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4,17-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3488.4	43.12548	5	3544.545118	3544.541154	K	E	218	249
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	1607	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3613.4	46.34947	4	3637.649294	3637.645482	R	V	592	630
PSM	GVVDSEDLPLNISR	1608	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3459.4	42.37125	2	1512.777447	1512.778387	R	E	387	401
PSM	CIPALDSLTPANEDQK	1609	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4469.2	61.11495	3	1833.7883	1833.7851	R	I	447	463
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1610	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3362.3	39.9615	4	2508.0731	2508.0760	M	R	2	32
PSM	ATGANATPLDFPSK	1611	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3408.3	41.1339	2	1510.6682	1510.6700	M	K	2	16
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1612	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3787.3	50.66772	4	3523.454094	3522.472617	K	F	604	634
PSM	DNNQFASASLDR	1613	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2947.6	29.25698	2	1337.601847	1336.600757	K	T	154	166
PSM	SVTEQGAELSNEER	1614	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2744.2	24.00923	3	1549.711571	1547.706344	K	N	28	42
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1615	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3877.2	52.90093	4	2829.1971	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1616	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3761.4	50.01223	3	2749.2301	2749.2301	-	Y	1	25
PSM	ASGADSKGDDLSTAILK	1617	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3570.3	45.22668	3	1849.7719	1849.7742	M	Q	2	19
PSM	VASGGGGVGDGVQEPTTGNWR	1618	sp|O00429-2|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3098.5	33.1865	3	2079.898571	2079.901112	K	G	559	580
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1619	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3524.3	44.06163	4	2882.1802	2882.1622	M	D	2	29
PSM	DSPESPFEVIIDK	1620	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3897.3	53.38253	2	1554.685847	1554.685472	K	A	242	255
PSM	CESAFLSK	1621	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3767.2	50.1545	2	1003.3681	1003.3717	K	R	36	44
PSM	DGLNDDDFEPYLSPQAR	1622	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3754.4	49.83072	3	2030.825771	2030.825881	K	P	27	44
PSM	PRPDPSPEIEGDLQPATHGSR	1623	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2983.3	30.188	4	2335.057294	2335.059404	R	F	146	167
PSM	CDFTEDQTAEFK	1624	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3492.5	43.23317	2	1611.5793	1611.5795	M	E	2	14
PSM	QAGGFLGPPPPSGK	1625	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=1.1.3498.2	43.37948	2	1371.6173	1371.6219	K	F	224	238
PSM	YPLFEGQETGKKETIEE	1626	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3240.4	36.80792	3	2076.922271	2076.929284	R	-	723	740
PSM	KLENSPLGEALRSGQAR	1627	sp|Q9NX40|OCAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3026.2	31.3091	4	1984.910894	1984.913271	K	R	104	121
PSM	CPNLTHLNLSGNK	1628	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3171.2	35.06535	3	1626.664571	1626.662659	K	I	87	100
PSM	TYYIELWDVGGSVGSASSVK	1629	sp|Q5HYI8|RABL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2879.5	27.50857	3	2276.948471	2276.964363	K	S	59	79
PSM	HYGGLTGLNKAETAAK	1630	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2960.3	29.58673	3	1789.778771	1789.780132	R	H	91	107
PSM	NILLTNEQLESARK	1631	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3142.4	34.32578	3	1707.849971	1707.855665	R	I	36	50
PSM	IMNTFSVVPSPK	1632	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3290.5	38.10587	2	1415.648047	1414.656755	R	V	163	175
PSM	QSKPVTTPEEIAQVATISANGDK	1633	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3312.4	38.67013	4	2623.118494	2623.122077	K	E	158	181
PSM	VLTPTQVK	1634	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2823.2	26.05678	2	964.496247	964.499449	K	N	40	48
PSM	APLKPYPVSPSDK	1635	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2843.3	26.57083	3	1477.719371	1477.721798	K	V	1039	1052
PSM	DYSSGFGGK	1636	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2804.3	25.56572	2	996.355647	996.358992	K	Y	153	162
PSM	AMAPTSPQI	1637	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2909.2	28.26237	2	1010.412247	1010.414399	K	-	259	268
PSM	GVISTPVIR	1638	sp|Q9NZB2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3137.2	34.1901	2	1020.532847	1020.536897	R	T	987	996
PSM	DWDDDQND	1639	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2775.2	24.81298	2	1021.323847	1021.326098	K	-	541	549
PSM	FQRPGDPQSAQDK	1640	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2602.2	20.42425	3	1552.666871	1552.667136	K	A	294	307
PSM	IESPKLER	1641	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2651.2	21.64223	2	1050.508447	1050.511076	K	T	807	815
PSM	NLETPLCK	1642	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2828.3	26.19018	2	1053.452847	1053.456598	K	N	86	94
PSM	NLETPLCK	1643	sp|P54819|KAD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2820.4	25.98522	2	1053.452847	1053.456598	K	N	86	94
PSM	SWHDVQVSSAYVK	1644	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3161.3	34.80843	3	1584.696371	1584.697374	R	T	96	109
PSM	DGYNYTLSK	1645	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2895.2	27.89877	2	1059.486047	1059.487290	K	T	28	37
PSM	SGLTVPTSPK	1646	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2879.2	27.49857	2	1065.508447	1065.510742	R	G	87	97
PSM	DLVAQAPLKPKTPR	1647	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2887.2	27.69608	3	1612.870571	1612.870193	K	G	523	537
PSM	ALENVLSGKA	1648	sp|O43678|NDUA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3181.2	35.31795	2	1080.517047	1080.521641	R	-	90	100
PSM	TTIFSPEGR	1649	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3185.3	35.4231	2	1086.471647	1086.474691	R	L	9	18
PSM	ASTLQLGSPR	1650	sp|Q7L8L6|FAKD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2891.4	27.8031	2	1108.525447	1108.527789	K	A	88	98
PSM	DLEGSDIDTR	1651	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2767.3	24.60953	2	1119.501447	1119.504397	R	R	373	383
PSM	KYEDICPSTHNMDVPNIK	1652	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3120.2	33.74655	4	2239.964894	2239.964306	K	R	68	86
PSM	DVNQQEFVR	1653	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2845.2	26.61953	2	1133.540847	1133.546536	K	A	8	17
PSM	EEDCHSPTSKPPKPDQPLK	1654	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2557.2	19.40405	4	2269.006894	2269.008614	K	V	454	473
PSM	SGCSEAQPPESPETR	1655	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2562.2	19.51152	3	1710.651371	1710.655645	K	L	424	439
PSM	GTGLLSSDYR	1656	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3154.3	34.62665	2	1147.488847	1147.491069	K	I	402	412
PSM	HSDSGTSEASLSPPSSPPSRPR	1657	sp|Q7Z4S6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2776.3	24.84217	4	2315.015294	2315.017933	K	N	1260	1282
PSM	DKVDKSAVGFEYQGK	1658	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2860.4	27.01617	3	1749.7895	1749.7970	K	T	204	219
PSM	DNLTSATLPR	1659	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3129.3	33.98443	2	1166.532047	1166.533268	K	N	302	312
PSM	EHYPVSSPSSPSPPAQPGGVSR	1660	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2920.3	28.5521	4	2378.992094	2378.993372	K	N	2036	2058
PSM	KKPRPPPALGPEETSASAGLPK	1661	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	16.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2927.3	28.73428	4	2387.1632941913203	2387.1651280448195	K	K	14	36
PSM	LGAGGGSPEKSPSAQELK	1662	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2734.4	23.75783	3	1791.835571	1791.840409	R	E	13	31
PSM	GMGPGTPAGYGR	1663	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2802.4	25.5169	2	1199.478847	1199.479459	R	G	682	694
PSM	GGLGAPPLQSAR	1664	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2984.2	30.21077	2	1202.576247	1202.580887	R	S	88	100
PSM	TASRPDDIPDSPSSPK	1665	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2739.3	23.88323	3	1828.726571	1828.728156	R	V	1278	1294
PSM	QNTLVNNVSSPLPGEGK	1666	sp|Q15771|RAB30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3152.4	34.5789	3	1832.863871	1832.866958	R	S	176	193
PSM	NLQTVNVDEN	1667	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2957.4	29.51162	2	1224.499047	1224.502362	K	-	116	126
PSM	GPTTGEGALDLSDVHSPPKSPEGK	1668	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3034.2	31.5184	4	2455.126894	2455.126815	K	T	141	165
PSM	EAESSPFVER	1669	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2803.3	25.53937	2	1229.493447	1229.496549	K	L	548	558
PSM	IVRGDQPAASGDSDDDEPPPLPR	1670	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2975.3	29.97867	4	2483.098094	2483.096577	K	L	45	68
PSM	STGCDFAVSPK	1671	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2887.4	27.70275	2	1247.486447	1247.489355	K	L	501	512
PSM	QTESTSFLEK	1672	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2991.2	30.39402	2	1248.523847	1248.527514	K	K	172	182
PSM	EQVANSAFVER	1673	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2828.5	26.19685	2	1248.605647	1248.609865	K	V	365	376
PSM	TSSGDPPSPLVK	1674	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2790.5	25.21102	2	1263.570247	1263.574799	K	Q	80	92
PSM	TSVQTEDDQLIAGQSAR	1675	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3024.3	31.25988	3	1897.842071	1897.841866	R	A	654	671
PSM	TANVPQTVPMR	1676	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2924.3	28.65647	2	1292.591847	1292.594823	K	L	77	88
PSM	SASSSAAGSPGGLTSLQQQK	1677	sp|Q8NEZ2|VP37A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2972.5	29.90725	3	1940.877071	1940.884065	K	Q	10	30
PSM	EAMEDGEIDGNK	1678	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2666.2	22.0129	2	1306.537847	1306.534711	K	V	628	640
PSM	VNTPTTTVYR	1679	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2794.5	25.31452	2	1310.526447	1310.530900	K	C	244	254
PSM	SLVESVSSSPNK	1680	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2812.5	25.78062	2	1312.585847	1312.591177	R	E	309	321
PSM	SLVESVSSSPNK	1681	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2804.5	25.57238	2	1312.585847	1312.591177	R	E	309	321
PSM	ASPGTPLSPGSLR	1682	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3136.5	34.17405	2	1318.624447	1318.628231	R	S	33	46
PSM	NSNPALNDNLEK	1683	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2755.4	24.30123	2	1327.634647	1327.636808	K	G	120	132
PSM	HRNDHLTSTTSSPGVIVPESSENK	1684	sp|O75496|GEMI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2813.4	25.80302	4	2671.222494	2671.223903	K	N	53	77
PSM	REAALPPVSPLK	1685	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3020.2	31.15173	3	1356.718571	1356.716653	K	A	1223	1235
PSM	SQSLPNSLDYTQTSDPGR	1686	sp|Q96TC7|RMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3225.4	36.43893	3	2044.871171	2044.873894	R	H	44	62
PSM	ALPSLNTGSSSPR	1687	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3026.5	31.3191	2	1365.624647	1365.628960	R	G	317	330
PSM	ADGYEPPVQESV	1688	sp|P61247|RS3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3187.4	35.4781	2	1369.540247	1369.543893	R	-	253	265
PSM	ISVYYNEATGGK	1689	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2991.3	30.39735	2	1380.590647	1380.596263	R	Y	47	59
PSM	PVQETQAPESPGENSEQALQTLSPR	1690	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3235.4	36.68028	4	2772.2563	2772.2598	M	A	2	27
PSM	EMPQDLRSPARTPPSEEDSAEAER	1691	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2900.3	28.0321	4	2777.200494	2777.196368	K	L	70	94
PSM	QAGGFLGPPPPSGK	1692	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3079.4	32.68783	2	1388.646247	1388.648967	K	F	224	238
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	1693	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2956.3	29.48257	4	2779.092094	2779.094999	K	M	571	596
PSM	ICEPGYSPTYK	1694	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2944.5	29.17538	2	1393.559447	1393.562520	K	Q	210	221
PSM	TTTWNDPRVPSEGPKETPSSANGPSR	1695	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2937.5	28.99367	4	2847.278494	2847.282480	R	E	46	72
PSM	ADVVPKTAENFR	1696	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2923.2	28.6271	3	1425.671471	1425.665345	K	A	68	80
PSM	RRSPSPYYSR	1697	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2533.3	18.89638	3	1427.573171	1427.574830	R	Y	258	268
PSM	TKTPGPGAQSALR	1698	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2647.2	21.53903	3	1442.634071	1442.632011	R	A	105	118
PSM	STNEAMEWMNNK	1699	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3208.5	36.02977	2	1453.596647	1453.596599	K	L	737	749
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1700	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.3033.4	31.49823	4	2914.285294	2914.285140	K	L	281	308
PSM	ETPAATEAPSSTPK	1701	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2530.6	18.82122	2	1465.629447	1465.633770	K	A	185	199
PSM	DVSGPMPDSYSPR	1702	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3057.3	32.12214	2	1486.576447	1486.579961	K	Y	291	304
PSM	QQNSGRMSPMGTASGSNSPTSDSASVQR	1703	sp|O76080|ZFAN5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2832.5	26.29935	4	2984.175294	2984.179094	R	A	41	69
PSM	LRECELSPGVNR	1704	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2784.4	25.05198	3	1508.676071	1508.680678	R	D	487	499
PSM	SARDHAISLSEPR	1705	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2774.3	24.79028	3	1517.696471	1517.698771	R	M	792	805
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	1706	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3187.5	35.48143	4	3037.294494	3037.291647	K	E	117	144
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	1707	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3199.5	35.79493	4	3044.150894	3044.151982	K	L	595	622
PSM	NWMVGGEGGAGGRSP	1708	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.2981.5	30.14258	2	1526.592047	1526.597342	K	-	79	94
PSM	YLLGDAPVSPSSQK	1709	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3213.4	36.15755	2	1540.713047	1540.717440	K	L	195	209
PSM	DTCYSPKPSVYLSTPSSASK	1710	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,4-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3236.4	36.70493	3	2333.945171	2333.952813	K	A	538	558
PSM	ESQRSGNVAELALK	1711	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3004.2	30.73343	3	1580.751971	1580.755951	K	A	658	672
PSM	DGSLASNPYSGDLTK	1712	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3192.5	35.61228	2	1603.674247	1603.676698	R	F	850	865
PSM	DLVAQAPLKPKTPR	1713	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2895.3	27.9021	3	1612.870571	1612.870193	K	G	523	537
PSM	EVVKPVPITSPAVSK	1714	sp|Q96HC4|PDLI5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2949.3	29.2992	3	1629.875171	1629.874276	K	V	102	117
PSM	ESEPESPMDVDNSK	1715	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2758.6	24.38572	2	1642.599647	1642.606963	K	N	297	311
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1716	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	23-UNIMOD:21	ms_run[1]:scan=1.1.2953.5	29.41003	4	3290.595694	3290.597273	K	E	178	210
PSM	STAGDTHLGGEDFDNR	1717	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2808.6	25.67945	2	1690.714047	1690.718306	K	M	224	240
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1718	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3146.5	34.43213	3	2559.234071	2559.241253	K	S	97	122
PSM	LKGEATVSFDDPPSAK	1719	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2986.4	30.26985	3	1740.795071	1740.797147	K	A	333	349
PSM	TPKTPKGPSSVEDIK	1720	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2777.4	24.87118	3	1742.786771	1742.789299	K	A	234	249
PSM	TPKTPKGPSSVEDIK	1721	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2761.5	24.45998	3	1742.786771	1742.789299	K	A	234	249
PSM	DKPHVNVGTIGHVDHGK	1722	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2677.2	22.29403	4	1808.928094	1808.928179	R	T	54	71
PSM	RTEGVGPGVPGEVEMVK	1723	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.2986.5	30.27318	3	1835.844071	1835.848866	R	G	16	33
PSM	QLVRGEPNVSYICSR	1724	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3080.2	32.70725	3	1856.860871	1856.860433	K	Y	269	284
PSM	QASTDAGTAGALTPQHVR	1725	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2709.5	23.11817	3	1859.849471	1859.852705	R	A	107	125
PSM	AEPQPLSPASSSYSVSSPR	1726	sp|P18850|ATF6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3168.4	34.9944	3	2105.867471	2105.870797	K	S	88	107
PSM	HVSTSSDEGSPSASTPMINK	1727	sp|Q7L1W4|LRC8D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2717.6	23.32833	3	2190.851471	2190.854161	K	T	237	257
PSM	ESEDKPEIEDVGSDEEEEK	1728	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2843.6	26.58083	3	2191.907771	2191.912828	K	K	251	270
PSM	PAETPVATSPTATDSTSGDSSR	1729	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2697.5	22.80945	3	2213.928971	2213.932531	K	S	152	174
PSM	YNLQEVVKSPKDPSQLNSK	1730	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3117.2	33.66825	4	2253.105294	2253.104229	K	Q	262	281
PSM	DGLNQTTIPVSPPSTTKPSR	1731	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3181.5	35.32795	3	2255.016071	2255.023609	K	A	573	593
PSM	GSLAEAVGSPPPAATPTPTPPTR	1732	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3204.5	35.9254	3	2331.047471	2331.054910	R	K	446	469
PSM	VGDSTPVSEKPVSAAVDANASESP	1733	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3155.6	34.66243	3	2473.024271	2473.029877	R	-	429	453
PSM	IVRGDQPAASGDSDDDEPPPLPR	1734	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2987.5	30.29942	3	2483.091971	2483.096577	K	L	45	68
PSM	SVTSNQSDGTQESCESPDVLDR	1735	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2965.6	29.72772	3	2489.977871	2489.985372	R	H	346	368
PSM	QFSQYIK	1736	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3290.2	38.09587	2	992.434847	992.436849	K	N	222	229
PSM	KQSLGELIGTLNAAK	1737	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3659.2	47.49462	3	1621.845671	1621.844038	R	V	56	71
PSM	RASGQAFELILSPR	1738	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3508.2	43.64112	3	1623.811871	1623.813407	K	S	14	28
PSM	DLASPLIGRS	1739	sp|O95067|CCNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3380.3	40.40828	2	1107.530447	1107.532540	K	-	389	399
PSM	ALLLLCGEDD	1740	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3767.3	50.15783	2	1117.531647	1117.532526	K	-	311	321
PSM	GTPLISPLIK	1741	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3633.2	46.83462	2	1117.612847	1117.614813	R	W	826	836
PSM	GDLGIEIPAEK	1742	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3259.2	37.2948	2	1140.597847	1140.602654	R	V	295	306
PSM	AAVPSGASTGIYEALELRDNDK	1743	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3665.3	47.65362	4	2356.099694	2356.094786	R	T	33	55
PSM	FIVSPVPESR	1744	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3269.3	37.56098	2	1209.576047	1209.579490	R	L	1258	1268
PSM	NSGELEATSAFLASGQR	1745	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3454.2	42.23988	3	1816.799171	1816.799273	K	A	339	356
PSM	GVLLFGPPGTGK	1746	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3685.2	48.1679	2	1221.613847	1221.615876	K	T	211	223
PSM	DLRSPLIATPTFVADK	1747	sp|P49116|NR2C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3701.2	48.56907	3	1902.892271	1902.889348	K	D	216	232
PSM	VLLPEYGGTKVVLDDK	1748	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3440.2	41.88047	3	1904.890871	1904.893764	K	D	71	87
PSM	NDSWGSFDLR	1749	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3693.3	48.3678	2	1275.491647	1275.492132	R	A	650	660
PSM	KKIEEAMDGSETPQLFTVLPEK	1750	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3526.2	44.11045	4	2569.241294	2569.238673	K	R	769	791
PSM	YFEADPPGQVAASPDPTT	1751	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3320.4	38.87932	3	1941.800771	1941.803355	R	-	157	175
PSM	GRPSSPRTPLYLQPDAYGSLDR	1752	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3462.3	42.44478	4	2605.172894	2605.172733	K	A	116	138
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1753	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3248.5	37.01897	4	2619.210494	2619.213536	R	D	175	200
PSM	EITALAPSTMK	1754	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3317.5	38.80428	2	1320.541447	1320.543772	K	I	318	329
PSM	EVYELLDSPGK	1755	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3354.2	39.75562	2	1328.588447	1328.590115	K	V	20	31
PSM	TVSLPLSSPNIK	1756	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3380.5	40.41495	2	1334.683647	1334.684684	K	L	1663	1675
PSM	YDSDGDKSDDLVVDVSNEDPATPR	1757	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3314.5	38.72523	4	2688.109294	2688.107595	R	V	238	262
PSM	SILSPGGSCGPIK	1758	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3280.3	37.8401	2	1351.617247	1351.620704	R	V	207	220
PSM	LDIDSPPITAR	1759	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3335.3	39.26731	2	1356.568647	1356.572764	R	N	33	44
PSM	GLFSANDWQCK	1760	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3674.2	47.88325	2	1404.552047	1404.553352	R	T	62	73
PSM	ESVPEFPLSPPK	1761	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3579.2	45.45787	3	1405.651271	1405.653049	K	K	30	42
PSM	VNQSALEAVTPSPSFQQR	1762	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3267.2	37.5053	3	2117.916371	2117.918416	R	H	390	408
PSM	EGFSIPVSADGFK	1763	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3769.3	50.2098	2	1432.627247	1432.627563	K	F	1887	1900
PSM	EFSPFGTITSAK	1764	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3878.2	52.92678	2	1443.571647	1443.572430	K	V	313	325
PSM	GVAQTPGSVEEDALLCGPVSK	1765	sp|Q9BQP7|MGME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3598.3	45.95943	3	2192.999471	2193.002466	R	H	64	85
PSM	TSDIFGSPVTATSR	1766	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3302.5	38.41808	2	1517.670647	1517.676304	K	L	91	105
PSM	TSDIFGSPVTATSR	1767	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3310.6	38.62437	2	1517.670647	1517.676304	K	L	91	105
PSM	DEILPTTPISEQK	1768	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3265.5	37.46268	2	1549.723447	1549.727671	K	G	215	228
PSM	ANTTAFLTPLEIK	1769	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3909.2	53.6899	3	1577.716271	1577.714343	K	A	558	571
PSM	IIAFVGSPVEDNEK	1770	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3416.2	41.34187	2	1596.738047	1596.743655	R	D	109	123
PSM	LTFDSSFSPNTGKK	1771	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3290.3	38.0992	3	1687.687571	1687.689585	K	N	97	111
PSM	GNCVSLLSPSPEGDPR	1772	sp|P17813|EGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3248.2	37.00897	3	1763.753471	1763.754965	K	F	514	530
PSM	NQLTSNPENTVFDAK	1773	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3311.6	38.6506	2	1836.726847	1836.733241	K	R	82	97
PSM	SESAPTLHPYSPLSPK	1774	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3280.2	37.83677	3	1869.794171	1869.795113	R	G	100	116
PSM	CFSPGVIEVQEVQGKK	1775	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3320.3	38.87598	3	1883.879471	1883.885251	R	V	256	272
PSM	QGAIVAVTGDGVNDSPALK	1776	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3287.3	38.02037	3	1890.906371	1890.908823	R	K	708	727
PSM	SATSSSPGSPLHSLETSL	1777	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4202.2	58.24253	3	1916.781071	1916.780585	K	-	1203	1221
PSM	TDGFAEAIHSPQVAGVPR	1778	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3299.4	38.33757	3	1930.890971	1930.893842	R	F	2146	2164
PSM	KEESEESDDDMGFGLFD	1779	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3582.3	45.5396	3	1964.748371	1964.746948	K	-	98	115
PSM	QIESKTAFQEALDAAGDK	1780	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3467.4	42.57918	3	2000.908271	2000.909217	K	L	4	22
PSM	GTIVLASPGWTTHSISDGK	1781	sp|Q14914|PTGR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3479.4	42.89048	3	2005.949471	2005.951022	K	D	82	101
PSM	GTDECAIESIAVAATPIPK	1782	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3591.3	45.77422	3	2021.937671	2021.938075	R	L	444	463
PSM	DLLLTSSYLSDSGSTGEHTK	1783	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3439.3	41.85812	3	2110.003271	2110.006609	K	S	397	417
PSM	DQPAFTPSGILTPHALGSR	1784	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3769.2	50.20647	3	2123.941871	2123.944237	R	N	428	447
PSM	STAALSGEAASCSPIIMPYK	1785	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3485.4	43.04713	3	2132.952671	2132.952345	K	A	242	262
PSM	RIDFTPVSPAPSPTRGFGK	1786	sp|Q7Z309|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3357.4	39.8367	3	2189.002271	2189.007171	K	M	108	127
PSM	DNLTLWTSDQQDDDGGEGNN	1787	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3667.3	47.7055	3	2192.872271	2192.873028	R	-	228	248
PSM	EYIPTVFDNYSAQSAVDGR	1788	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3812.2	51.30359	3	2210.956271	2210.952145	K	T	31	50
PSM	DGYADIVDVLNSPLEGPDQK	1789	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4452.2	60.90763	3	2224.002971	2223.993675	K	S	287	307
PSM	DKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFK	1790	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3566.6	45.13317	6	4555.940541	4555.941265	K	R	720	764
PSM	QLSSTSPLAPYPTSQMVSSDR	1791	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3441.5	41.91678	3	2331.041771	2331.045393	R	S	408	429
PSM	DYEEVGVDSVEGEGEEEGEEY	1792	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3577.6	45.4186	3	2347.896671	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	1793	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3662.2	47.57233	3	2349.944471	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	1794	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3638.4	46.96315	3	2349.945971	2349.946922	R	-	225	247
PSM	ERIQQFDDGGSDEEDIWEEK	1795	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3490.6	43.18423	3	2504.001971	2504.001674	K	H	607	627
PSM	DYEIESQNPLASPTNTLLGSAK	1796	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4089.3	56.56412	3	2507.090771	2507.086998	K	E	618	640
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	1797	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3498.3	43.38282	4	2835.274894	2835.274618	R	T	350	376
PSM	VSTTTDSPVSPAQAASPFIPLDELSSK	1798	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4394.2	60.24315	3	2904.315371	2904.308283	K	-	261	288
PSM	DDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN	1799	sp|Q9BVG9|PTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	34-UNIMOD:21	ms_run[1]:scan=1.1.4065.2	56.14202	4	3607.562894	3607.558775	K	-	452	488
PSM	PVTTPEEIAQVATISANGDK	1800	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3537.4	44.39943	3	2120.003771	2120.003846	K	E	161	181
PSM	CIPALDSLTPANEDQK	1801	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4419.2	60.50918	3	1833.7847	1833.7851	R	I	447	463
PSM	SAESPTSPVTSETGSTFK	1802	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3262.4	37.38035	3	1972.770671	1971.775165	K	K	280	298
PSM	QAGPASVPLRTEEEFKK	1803	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3200.5	35.82075	3	2028.8984	2028.8954	K	F	131	148
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	1804	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3509.4	43.67395	4	2896.366494	2896.363082	K	A	2621	2646
PSM	ASGVAVSDGVIK	1805	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3503.4	43.51715	2	1303.5445	1303.5457	M	V	2	14
PSM	KEESEESDDDMGFGLFD	1806	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3794.2	50.84922	3	2044.717271	2044.713279	K	-	98	115
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1807	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:35,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3520.2	43.95408	4	2845.1935	2845.1913	-	Y	1	25
PSM	PFSAPKPQTSPSPK	1808	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2736.3	23.80582	3	1548.742571	1547.738510	K	R	299	313
PSM	ASGADSKGDDLSTAILK	1809	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3360.3	39.90952	3	1769.8060	1769.8079	M	Q	2	19
PSM	CTGGEVGATSALAPK	1810	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3304.4	38.46382	2	1480.6291	1480.6264	R	I	17	32
PSM	SSIGTGYDLSASTFSPDGR	1811	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4070.2	56.26812	3	2118.8200	2118.8179	M	V	2	21
PSM	TAGNSEFLGKTPGQNAQK	1812	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2880.4	27.52982	3	2006.852771	2006.850002	K	W	32	50
PSM	AENVVEPGPPSAK	1813	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3060.4	32.20332	2	1415.6286	1415.6329	M	R	2	15
PSM	AENVVEPGPPSAKRPK	1814	sp|Q09472|EP300_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.2815.4	25.8553	3	1796.8763	1796.8817	M	L	2	18
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	1815	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	21-UNIMOD:4,25-UNIMOD:21	ms_run[1]:scan=1.1.3155.5	34.6591	4	2993.307694	2991.328110	R	V	221	251
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPK	1816	sp|Q9H2V7|SPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=1.1.3986.2	54.96897	4	3356.4752	3356.4717	M	S	2	36
PSM	QLLKSPELPSPQAEK	1817	sp|Q9H078|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3208.2	36.01977	3	1823.844071	1823.847148	K	R	659	674
PSM	AGGSPAPGPETPAISPSK	1818	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2826.3	26.13827	3	1779.744371	1779.748163	K	R	85	103
PSM	EGTCQRGDQCCYSHSPPTPR	1819	sp|Q9NXH9|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.2572.4	19.76368	4	2471.938094	2471.940628	K	V	611	631
PSM	IEIPVTPTGQSVPSSPSIPGTPTLK	1820	sp|Q9H4Z3|CAPAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3928.2	54.01055	3	2742.252971	2742.257114	K	M	130	155
PSM	SAHVTVSGGTPKGEAVLGTHK	1821	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2809.4	25.69952	4	2191.997294	2192.002814	K	L	305	326
PSM	NSPFQIPPPSPDSK	1822	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3255.2	37.19005	3	1591.711571	1589.712689	R	K	570	584
PSM	VGVNGFGR	1823	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2800.2	25.45795	2	804.421047	804.424236	K	I	6	14
PSM	FVLSSGK	1824	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2885.2	27.64645	2	816.376647	816.378271	K	F	49	56
PSM	LILDSAR	1825	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2972.2	29.89725	2	866.424647	866.426284	K	A	544	551
PSM	IKDPDASKPEDWDER	1826	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2804.2	25.56238	4	1799.827294	1799.832607	K	A	208	223
PSM	CIACQAAKLSPR	1827	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2778.2	24.8903	3	1453.656971	1453.657106	K	D	678	690
PSM	EIAEAYLGK	1828	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2989.2	30.34173	2	992.516247	992.517862	K	T	129	138
PSM	AMAPTSPQI	1829	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3123.3	33.82727	2	994.417647	994.419484	K	-	259	268
PSM	GNLTPLTGR	1830	sp|O75683|SURF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2905.3	28.16178	2	1007.479647	1007.480111	K	N	226	235
PSM	DLSIRSVR	1831	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2886.2	27.6712	2	1024.503247	1024.506660	K	L	64	72
PSM	HRVIGSGCNLDSAR	1832	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2614.4	20.74412	3	1540.747271	1540.752858	K	F	157	171
PSM	DGGFCEVCK	1833	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2759.3	24.4015	2	1070.414847	1070.416116	K	K	405	414
PSM	HVTLPSSPR	1834	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2686.2	22.51977	2	1072.505647	1072.506660	R	S	2713	2722
PSM	AQQNNVEHKVETFSGVYK	1835	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3030.2	31.41343	4	2156.979694	2156.989199	K	K	161	179
PSM	SAFSGGYYR	1836	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3006.3	30.78875	2	1086.414847	1086.417176	K	G	43	52
PSM	VLGTSPEAIDSAENR	1837	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	33.22902	3	1637.731571	1637.729796	R	F	1034	1049
PSM	ASAVSELSPR	1838	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2791.4	25.23332	2	1095.492647	1095.496155	R	E	236	246
PSM	LQNMEVTDA	1839	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2995.2	30.49875	2	1099.423647	1099.425692	R	-	506	515
PSM	STTPPPAEPVSLPQEPPKPR	1840	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3078.2	32.65545	4	2204.089294	2204.087850	K	V	225	245
PSM	QTSSTPSSLALTSASR	1841	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2975.2	29.97533	3	1672.761071	1672.766910	K	I	859	875
PSM	YLRYTPQP	1842	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3004.4	30.7401	2	1116.497247	1116.500512	K	-	217	225
PSM	GVEPSPSPIKPGDIK	1843	sp|Q92890|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3054.3	32.0435	3	1679.754371	1679.757271	K	R	241	256
PSM	GHTDTEGRPPSPPPTSTPEK	1844	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2539.2	19.02785	4	2246.923294	2246.924624	R	C	353	373
PSM	GHTDTEGRPPSPPPTSTPEK	1845	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2568.3	19.65623	4	2246.922894	2246.924624	R	C	353	373
PSM	TPGPGAQSALR	1846	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2672.3	22.1684	2	1133.519047	1133.523038	K	A	107	118
PSM	SASVAPFTCK	1847	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2909.4	28.26903	2	1146.475647	1146.478062	K	T	1057	1067
PSM	RLQEDPNYSPQRFPNAQR	1848	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2912.3	28.34387	4	2295.055294	2295.054593	K	A	1109	1127
PSM	GESPVDYDGGR	1849	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2709.3	23.1115	2	1150.491247	1150.489081	K	T	246	257
PSM	LSQVPMSALK	1850	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	36.52857	2	1152.554447	1152.561397	R	S	398	408
PSM	VQAYEEPSVASSPNGK	1851	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2835.2	26.36627	3	1741.751771	1741.756011	R	E	719	735
PSM	LASPMKPVPGTPPSSK	1852	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2915.4	28.42528	3	1752.795671	1752.792276	K	A	1205	1221
PSM	GGNFGGRSSGPYGGGGQYFAKPR	1853	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3036.4	31.57697	4	2353.036894	2353.038943	K	N	330	353
PSM	YLSEVASGDNK	1854	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2675.4	22.24917	2	1181.553847	1181.556432	R	Q	130	141
PSM	SLSASPALGSTK	1855	sp|O95544|NADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2825.3	26.11212	2	1197.558047	1197.564234	R	E	46	58
PSM	SNSPLPVPPSK	1856	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2815.5	25.85863	2	1201.570447	1201.574405	R	A	301	312
PSM	GGLGAPPLQSAR	1857	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2976.4	30.00845	2	1202.576247	1202.580887	R	S	88	100
PSM	VQEKPDSPGGSTQIQR	1858	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2567.6	19.6376	3	1805.826671	1805.830907	R	Y	1284	1300
PSM	RTEGVGPGVPGEVEMVK	1859	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3161.4	34.81177	3	1819.849571	1819.853951	R	G	16	33
PSM	ADTSQEICSPRLPISASHSSK	1860	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3089.2	32.94192	4	2430.028894	2430.028771	K	T	1020	1041
PSM	YATALYSAASK	1861	sp|P48047|ATPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3012.6	30.95633	2	1224.542047	1224.542771	R	Q	41	52
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	1862	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3067.2	32.37497	4	2449.052094	2449.048187	R	A	90	114
PSM	EQGQAPITPQQGQALAK	1863	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2896.3	27.92818	3	1843.879871	1843.882943	K	Q	131	148
PSM	VNTPTTTVYR	1864	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2747.4	24.09388	2	1230.561447	1230.564569	K	C	244	254
PSM	TDYNASVSVPDSSGPER	1865	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2982.3	30.16207	3	1859.758871	1859.757467	R	I	70	87
PSM	EITALAPSTMK	1866	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3085.3	32.84117	2	1240.572647	1240.577441	K	I	318	329
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1867	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2910.4	28.29523	5	3112.507118	3112.507789	R	S	847	876
PSM	VLQSPATTVVR	1868	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2890.2	27.77112	2	1249.642847	1249.643153	K	T	751	762
PSM	TSSGDPPSPLVK	1869	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2806.3	25.61785	2	1263.570247	1263.574799	K	Q	80	92
PSM	GSSGENNNPGSPTVSNFR	1870	sp|Q99576-3|T22D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2883.2	27.59712	3	1899.776771	1899.774849	R	Q	32	50
PSM	EAAENSLVAYK	1871	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2927.4	28.73762	2	1273.555247	1273.559149	K	A	143	154
PSM	TKTEQELPRPQSPSDLDSLDGR	1872	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3133.2	34.08558	4	2548.177294	2548.180641	K	S	90	112
PSM	LMIEMDGTENK	1873	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3105.4	33.36487	2	1279.578647	1279.578824	K	S	93	104
PSM	NFSDNQLQEGK	1874	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2763.3	24.5054	2	1278.580247	1278.584044	R	N	161	172
PSM	SSPNPFVGSPPK	1875	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3120.4	33.75322	2	1292.577647	1292.580219	K	G	393	405
PSM	NLQYYDISAK	1876	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3218.4	36.28803	2	1293.558847	1293.564234	K	S	143	153
PSM	EGNTTEDDFPSSPGNGNK	1877	sp|Q15007|FL2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2791.6	25.23998	3	1944.731771	1944.737460	R	S	295	313
PSM	ISVYYNEATGGK	1878	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2947.5	29.25365	2	1300.625647	1300.629932	R	Y	47	59
PSM	GAGAGHPGAGGAQPPDSPAGVR	1879	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2644.3	21.46942	3	1962.867371	1962.869752	R	T	71	93
PSM	APASVLPAATPR	1880	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3000.4	30.63572	2	1309.578047	1309.583269	R	Q	45	57
PSM	DKDAYSSFGSR	1881	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2830.3	26.24142	2	1311.510247	1311.513261	K	S	65	76
PSM	SERPPTILMTEEPSSPK	1882	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3159.3	34.75628	3	1977.905171	1977.911860	K	G	1080	1097
PSM	EITALAPSTMK	1883	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3200.4	35.81742	2	1320.541647	1320.543772	K	I	318	329
PSM	EQVANSAFVER	1884	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2915.5	28.42862	2	1328.572047	1328.576196	K	V	365	376
PSM	NSTLNSAAVTVSS	1885	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3029.4	31.39395	2	1329.577047	1329.581341	R	-	523	536
PSM	QEMQEVQSSRSGRGGNFGFGDSR	1886	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3071.3	32.47788	4	2675.058494	2675.058508	R	G	191	214
PSM	LAEQAERYDDMATCMK	1887	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3058.2	32.14455	3	2010.781871	2010.788650	K	A	12	28
PSM	TRSWDSSSPVDRPEPEAASPTTR	1888	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.2935.5	28.9437	4	2688.122494	2688.121820	R	T	352	375
PSM	LPQPPEGQTYNN	1889	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2925.5	28.6892	2	1356.623847	1356.630994	K	-	134	146
PSM	GEPNVSYICSR	1890	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2949.6	29.3092	2	1360.546647	1360.548267	R	Y	273	284
PSM	NLYPSSSPYTR	1891	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3056.3	32.09577	2	1363.579047	1363.580947	K	N	275	286
PSM	TPQEWAPQTAR	1892	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2880.5	27.53315	2	1363.585247	1363.592180	K	I	286	297
PSM	RSRLTPVSPESSSTEEK	1893	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2664.5	21.97113	3	2048.875871	2048.881696	K	S	265	282
PSM	YQLDPTASISAK	1894	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3188.3	35.50078	2	1372.622447	1372.627563	K	V	236	248
PSM	TAAALAPASLTSAR	1895	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3104.5	33.34277	2	1379.677847	1379.680995	R	M	2357	2371
PSM	LLGGTRTPINDAS	1896	sp|Q8N357|S35F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2959.4	29.56412	2	1393.654647	1393.660260	R	-	359	372
PSM	NSEPAGLETPEAK	1897	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2744.5	24.01923	2	1421.605647	1421.607556	R	V	890	903
PSM	NSEPAGLETPEAK	1898	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2735.4	23.7833	2	1421.605647	1421.607556	R	V	890	903
PSM	ESYDAPPTPSGAR	1899	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2741.5	23.94173	2	1426.573647	1426.576590	R	L	109	122
PSM	NGEVVHTPETSV	1900	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2850.5	26.75997	2	1427.531647	1427.537107	K	-	454	466
PSM	EALSPCPSTVSTK	1901	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2776.5	24.84883	2	1455.627447	1455.631662	R	S	670	683
PSM	ANTPDSDITEKTEDSSVPETPDNERK	1902	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2807.4	25.64712	4	2954.267294	2954.266615	R	A	52	78
PSM	LVEDERSDREETESSEGEEAAAGGGAK	1903	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2668.6	22.0746	4	2967.162894	2967.165595	K	S	335	362
PSM	KYEEIDNAPEER	1904	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2664.3	21.96113	3	1491.682271	1491.684152	K	A	91	103
PSM	SESPKEPEQLRK	1905	sp|P09651|ROA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2536.2	18.96137	3	1506.705371	1506.707938	K	L	4	16
PSM	AEEDEILNRSPR	1906	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2844.2	26.59363	3	1507.664771	1507.666802	K	N	574	586
PSM	NIDINDVTPNCR	1907	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3058.4	32.15122	2	1509.624447	1509.628308	K	V	102	114
PSM	SSDQPLTVPVSPK	1908	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3159.6	34.76628	2	1513.641847	1513.646658	K	F	728	741
PSM	SCTPSPDQISHR	1909	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2675.3	22.24583	3	1543.554371	1543.552774	R	A	271	283
PSM	LAVDEEENADNNTK	1910	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2638.4	21.3215	2	1560.682447	1560.690360	K	A	40	54
PSM	NDAPTPGTSTTPGLR	1911	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2793.6	25.29188	2	1563.685847	1563.693017	R	S	324	339
PSM	GRNLPSSAQPFIPK	1912	sp|Q5VT52|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3115.3	33.61925	3	1590.789971	1590.791943	K	S	575	589
PSM	VAAETQSPSLFGSTK	1913	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3127.5	33.93878	2	1601.730047	1601.733819	K	L	215	230
PSM	ESVPEFPLSPPKKK	1914	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3136.2	34.16405	3	1661.838371	1661.842975	K	D	30	44
PSM	ADDTDSQSWRSPLK	1915	sp|O75369-8|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2981.4	30.13925	3	1684.705871	1684.709395	R	A	1464	1478
PSM	NPNTSEPQHLLVMK	1916	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	34.522	3	1686.780671	1686.780058	K	G	495	509
PSM	GRSRSPQRPGWSR	1917	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2590.2	20.12877	4	1685.73089419132	1685.7301015848898	R	S	532	545
PSM	ASPEPQRENASPAPGTTAEEAMSR	1918	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2898.6	27.9897	3	2563.0946	2563.1005	R	G	963	987
PSM	TLNAETPKSSPLPAK	1919	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2757.3	24.34993	3	1712.774471	1712.778735	R	G	208	223
PSM	SSTPLPTISSSAENTR	1920	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3027.6	31.34867	2	1726.774047	1726.777475	R	Q	158	174
PSM	VQAYEEPSVASSPNGK	1921	sp|Q99575|POP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2835.5	26.37627	2	1741.755247	1741.756011	R	E	719	735
PSM	EQGPYETYEGSPVSK	1922	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2916.6	28.45778	2	1749.710447	1749.713477	K	G	549	564
PSM	GVQVETISPGDGRTFPK	1923	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3161.5	34.8151	3	1866.8843	1866.8872	M	R	2	19
PSM	DAINQGMDEELERDEK	1924	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3097.3	33.15367	3	1890.825671	1890.826536	R	V	37	53
PSM	FQEQECPPSPEPTRK	1925	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2683.4	22.45297	3	1908.807371	1908.807729	K	E	178	193
PSM	AVPMAPAPASPGSSNDSSAR	1926	sp|Q66K74|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2852.4	26.80837	3	1948.831271	1948.835006	K	S	750	770
PSM	SMGTGDTPGLEVPSSPLRK	1927	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3110.5	33.49512	3	2023.928771	2023.928573	R	A	381	400
PSM	SQSPAASDCSSSSSSASLPSSGR	1928	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2661.2	21.88355	3	2278.897271	2278.900914	R	S	171	194
PSM	WLNSGRGDEASEEGQNGSSPK	1929	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2763.5	24.51207	3	2283.939671	2283.939348	R	S	447	468
PSM	TEAQDLCRASPEPPGPESSSR	1930	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2811.5	25.75457	3	2349.982571	2349.989669	R	W	663	684
PSM	ITRKPVTVSPTTPTSPTEGEAS	1931	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2822.6	26.04418	3	2415.089771	2415.097168	R	-	502	524
PSM	ELEREESGAAESPALVTPDSEK	1932	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2940.6	29.07417	3	2503.036271	2503.040441	K	S	173	195
PSM	SSSSVTTSETQPCTPSSSDYSDLQR	1933	sp|P50552|VASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3029.5	31.39728	3	2786.120771	2786.122594	K	V	322	347
PSM	GLFIIDDK	1934	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3462.2	42.44145	2	919.502647	919.501484	R	G	129	137
PSM	SDLLSAIR	1935	sp|Q9Y6W5|WASF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3603.2	46.08352	2	953.456047	953.458313	R	Q	438	446
PSM	IGPLGLSPK	1936	sp|P30050|RL12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3305.2	38.48203	2	960.501447	960.504534	K	K	32	41
PSM	DLYSALIK	1937	sp|O75844|FACE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3949.2	54.39812	2	1001.479047	1001.483465	K	L	430	438
PSM	RIDFTPVSPAPSPTRGFGK	1938	sp|Q7Z309|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3355.2	39.78047	4	2189.006894	2189.007171	K	M	108	127
PSM	GLATFCLDK	1939	sp|O00264|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3469.2	42.62463	2	1103.468047	1103.472248	R	E	124	133
PSM	FEDENFILK	1940	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3387.2	40.5876	2	1153.563047	1153.565540	K	H	83	92
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1941	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3335.2	39.26398	5	2989.540118	2989.541321	K	G	202	228
PSM	DLLTPCYSR	1942	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3252.2	37.11225	2	1203.497647	1203.499526	K	Q	304	313
PSM	QVPDSAATATAYLCGVK	1943	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3483.2	42.98812	3	1830.823271	1830.822317	R	A	107	124
PSM	DLFDPIIEDR	1944	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3806.2	51.14842	2	1231.606447	1231.608468	K	H	87	97
PSM	LLLDPSSPPTK	1945	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3247.3	36.98637	2	1246.615847	1246.621021	K	A	21	32
PSM	RQPPVSPLTLSPGPEAHQGFSR	1946	sp|Q6UUV7|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3244.3	36.90867	4	2517.152894	2517.156689	R	Q	386	408
PSM	SGEISLPIKEEPSPISK	1947	sp|Q9ULH7|MRTFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	38.59157	3	1889.937071	1889.938726	K	M	909	926
PSM	QSKPVTTPEEIAQVATISANGDK	1948	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	39.47245	4	2543.154894	2543.155746	K	E	158	181
PSM	QSKPVTTPEEIAQVATISANGDK	1949	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3356.2	39.80525	4	2543.154894	2543.155746	K	E	158	181
PSM	GYFEYIEENK	1950	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3394.3	40.77395	2	1290.574047	1290.576833	R	Y	256	266
PSM	QQGFNYCTSAISSPLTK	1951	sp|Q12802|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3414.5	41.28942	3	1980.867971	1980.865244	K	S	1671	1688
PSM	ADLINNLGTIAK	1952	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3466.3	42.5496	2	1321.661847	1321.664283	K	F	96	108
PSM	TLTPISAAYAR	1953	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3305.4	38.4887	2	1322.563247	1322.567285	K	A	295	306
PSM	EDFDSLLQSAK	1954	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3589.3	45.7225	2	1331.561447	1331.564628	K	K	288	299
PSM	ESHSPFGLDSFNSTAKVSPLTPK	1955	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,18-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3727.3	49.19162	4	2685.126094	2685.116598	K	L	1250	1273
PSM	VPLFSPNFSEK	1956	sp|Q9BQ52|RNZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3658.2	47.46863	2	1343.614447	1343.616270	K	V	732	743
PSM	EFSPFGTITSAK	1957	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3705.3	48.67648	2	1363.602847	1363.606099	K	V	313	325
PSM	SESVEGFLSPSR	1958	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3389.3	40.64315	2	1373.584847	1373.586426	R	C	1311	1323
PSM	FNVWDTAGQEK	1959	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3299.5	38.3409	2	1373.565847	1373.565297	K	F	61	72
PSM	FNEEHIPDSPFVVPVASPSGDARR	1960	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3553.3	44.795	4	2782.209294	2782.215326	K	L	2311	2335
PSM	NLSSPFIFHEK	1961	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3454.4	42.24655	2	1397.635647	1397.638068	R	T	644	655
PSM	GFPTIYFSPANK	1962	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3733.3	49.33832	2	1420.641647	1420.642819	R	K	449	461
PSM	YHTSQSGDEMTSLSEYVSR	1963	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3290.6	38.1092	3	2175.930371	2175.937877	R	M	457	476
PSM	SAVPFNQYLPNK	1964	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3519.6	43.94127	2	1456.670247	1456.675182	K	S	262	274
PSM	NDSPTQIPVSSDVCRLTPA	1965	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,14-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3482.5	42.97197	3	2215.924271	2215.922181	R	-	673	692
PSM	KAVVQSPQVTEVL	1966	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3324.6	38.99055	2	1476.753847	1476.758911	K	-	829	842
PSM	NLEQILNGGESPK	1967	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3560.4	44.97177	2	1477.676647	1477.681389	K	Q	219	232
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1968	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3484.5	43.02443	4	2972.326094	2972.324602	K	Q	178	204
PSM	DVNSSSPVMLAFK	1969	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3404.5	41.04273	2	1489.648247	1489.652398	K	S	28	41
PSM	SIDSNSEIVSFGSPCSINSR	1970	sp|P42702|LIFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3531.4	44.24718	3	2234.953571	2234.951493	R	Q	1047	1067
PSM	NCTCGLAEELEK	1971	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3293.6	38.18778	2	1502.570847	1502.578247	K	E	248	260
PSM	DLLLTSSYLSDSGSTGEHTK	1972	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3737.4	49.44313	3	2269.940471	2269.939271	K	S	397	417
PSM	TSDIFGSPVTATSR	1973	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3331.5	39.17033	2	1517.673847	1517.676304	K	L	91	105
PSM	DNPGVVTCLDEAR	1974	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3434.3	41.73248	2	1524.628047	1524.627974	K	H	227	240
PSM	GYISPYFINTSK	1975	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3791.4	50.76503	2	1548.627447	1548.630279	R	G	222	234
PSM	AIVDALPPPCESACTVPTDVDK	1976	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3513.4	43.78432	3	2434.078271	2434.079730	R	W	261	283
PSM	ESVTDYTTPSSSLPNTVATNNTK	1977	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3273.4	37.66583	3	2506.102571	2506.111224	K	M	2185	2208
PSM	APNTPDILEIEFKK	1978	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3601.3	46.03417	3	1693.830971	1693.832805	K	G	216	230
PSM	NLEQILNGGESPKQK	1979	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3298.2	38.30505	3	1733.832371	1733.834930	K	G	219	234
PSM	GNCVSLLSPSPEGDPR	1980	sp|P17813|EGLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3256.2	37.2171	3	1763.753471	1763.754965	K	F	514	530
PSM	VSSGYVPPPVATPFSSK	1981	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3410.4	41.18699	3	1878.818771	1878.820599	R	S	168	185
PSM	DLDLLASVPSPSSSGSRK	1982	sp|Q8WU79|SMAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	44.21418	3	1894.904771	1894.903738	K	V	210	228
PSM	SATSSSPGSPLHSLETSL	1983	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3898.2	53.40843	3	1916.777471	1916.780585	K	-	1203	1221
PSM	SSTPPGESYFGVSSLQLK	1984	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3820.2	51.49162	3	1962.898271	1962.897590	K	G	1041	1059
PSM	DTQSPSTCSEGLLGWSQK	1985	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3637.2	46.93192	3	2059.850471	2059.855802	K	D	709	727
PSM	QQGFNYCTSAISSPLTK	1986	sp|Q12802|AKP13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:4,9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3600.2	46.00493	3	2060.835071	2060.831575	K	S	1671	1688
PSM	CTNSEVTVQPSPYLSYR	1987	sp|O75794|CD123_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3349.6	39.6419	3	2079.894371	2079.897273	R	L	289	306
PSM	LHIIEVGTPPTGNQPFPK	1988	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3649.3	47.24075	3	2103.980171	2103.979560	K	K	228	246
PSM	ESMCSTPAFPVSPETPYVK	1989	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3682.5	48.0997	3	2285.901371	2285.902691	K	T	839	858
PSM	ELSNSPLRENSFGSPLEFR	1990	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3773.5	50.32348	3	2338.000571	2338.003208	K	N	1316	1335
PSM	DYEEVGVDSVEGEGEEEGEEY	1991	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3569.5	45.20745	3	2347.896671	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	1992	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3654.3	47.36895	3	2349.944471	2349.946922	R	-	225	247
PSM	ASYHFSPEELDENTSPLLGDAR	1993	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3645.6	47.14718	3	2527.087571	2527.090429	K	F	262	284
PSM	VMTIPYQPMPASSPVICAGGQDR	1994	sp|Q15365|PCBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3476.5	42.81652	3	2570.133371	2570.136868	R	C	178	201
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1995	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3701.3	48.5724	4	3465.484494	3465.481982	K	A	399	429
PSM	YDSDGDKSDDLVVDVSNEDPATPR	1996	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3317.6	38.80762	3	2688.101171	2688.107595	R	V	238	262
PSM	PVQETQAPESPGENSEQALQTLSPR	1997	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3334.6	39.25128	3	2852.2229	2852.2262	M	A	2	27
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1998	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3465.2	42.51993	4	2972.324894	2972.324602	K	Q	178	204
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1999	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3362.2	39.95817	5	2989.540118	2989.541321	K	G	202	228
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2000	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3281.6	37.8753	4	3562.491694	3562.491898	K	V	60	92
PSM	IEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSR	2001	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3545.5	44.60358	4	3698.646894	3698.647255	K	A	17	52
PSM	TVIIEQSWGSPK	2002	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3355.3	39.7838	2	1423.671447	1423.674847	R	V	61	73
PSM	SAESPTSPVTSETGSTFK	2003	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3254.4	37.17117	3	1972.775471	1971.775165	K	K	280	298
PSM	VTNGAFTGEISPGMIK	2004	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3336.3	39.29343	3	1716.775271	1716.779389	K	D	107	123
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	2005	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2770.5	24.69325	5	3566.4292	3565.4482	K	D	124	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2006	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2663.5	21.94197	4	2674.028094	2673.045055	K	G	134	157
PSM	VSHVSTGGGASLELLEGK	2007	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3535.3	44.34583	3	1899.840071	1899.838040	K	V	389	407
PSM	ASGVAVSDGVIK	2008	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3495.3	43.30475	2	1303.5445	1303.5457	M	V	2	14
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	2009	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3130.3	34.01053	4	2898.288094	2898.290225	K	L	281	308
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2010	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3710.3	48.80617	4	2749.2320	2749.2301	-	Y	1	25
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	2011	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3099.3	33.20583	4	2660.146894	2660.147901	R	-	621	645
PSM	QFSQYIK	2012	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4039.2	55.83378	2	975.4105	975.4098	K	N	222	229
PSM	AAPEASSPPASPLQHLLPGK	2013	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3469.3	42.62797	3	2047.015271	2047.013957	K	A	686	706
PSM	SCEGQNPELLPKTPISPLK	2014	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3433.2	41.70469	4	2268.022094	2267.031003	K	T	308	327
PSM	ASGVTVNDEVIK	2015	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3356.3	39.80858	2	1352.6200	1352.6220	M	V	2	14
PSM	SSAPTTPPSVDKVDGFSRK	2016	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3143.2	34.345	3	2096.9764	2096.9774	M	S	2	21
PSM	FLMECRNSPVTK	2017	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2930.5	28.81807	2	1560.6776	1560.6825	K	T	58	70
PSM	CMMAQYNRHDSPEDVK	2018	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2773.3	24.76423	4	2059.793294	2059.795132	R	R	471	487
PSM	LDNVPHTPSSYIETLPK	2019	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3500.5	43.44182	3	1990.945271	1989.944874	R	A	45	62
PSM	SDAAVDTSSEITTK	2020	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.2980.6	30.11973	2	1545.6369	1545.6442	M	D	2	16
PSM	TLNAETPKSSPLPAK	2021	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2762.2	24.4762	4	1712.778094	1712.778735	R	G	208	223
PSM	SSVSHSVLSEMQVIEQETPVSAK	2022	sp|Q8N6H7|ARFG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	18-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3744.5	49.60713	3	2631.1549	2631.1535	R	S	314	337
PSM	MLSPQR	2023	sp|Q6DD88|ATLA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.2993.2	30.44632	2	852.3526	852.3560	-	V	1	7
PSM	MPPRTPAEASSTGQTGPQSAL	2024	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3089.4	32.94858	3	2242.931471	2242.933080	K	-	238	259
PSM	NGEVVHTPETSV	2025	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2839.3	26.46937	2	1428.531247	1427.537107	K	-	454	466
PSM	KLENSPLGEALRSGQAR	2026	sp|Q9NX40|OCAD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3025.4	31.28965	3	1984.912271	1984.913271	K	R	104	121
PSM	YLDEDTIYHLQPSGR	2027	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3398.3	40.87882	3	1885.825271	1885.824759	K	F	235	250
PSM	LISPYK	2028	sp|O14929|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2863.2	27.08735	2	799.386847	799.388108	R	K	359	365
PSM	NHSGSRTPPVALNSSR	2029	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2664.2	21.9578	4	1838.788094	1838.782591	R	M	2098	2114
PSM	DISLSDYK	2030	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3074.2	32.55032	2	939.454247	939.454927	K	G	28	36
PSM	AQAAAPASVPAQAPK	2031	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2697.2	22.79945	3	1456.708271	1456.707544	K	R	135	150
PSM	TFNSPNLK	2032	sp|Q9Y6N7|ROBO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2782.2	24.99375	2	999.439247	999.442662	K	D	1052	1060
PSM	CESAFLSK	2033	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2925.2	28.6792	2	1020.397447	1020.398749	K	R	36	44
PSM	DWDDDQND	2034	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2767.2	24.6062	2	1021.323847	1021.326098	K	-	541	549
PSM	TVSPALISR	2035	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2952.2	29.37405	2	1022.513247	1022.516162	K	F	374	383
PSM	DLEEDHACIPIKK	2036	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2851.3	26.77922	3	1566.764471	1566.771193	K	S	560	573
PSM	DLSLEEIQK	2037	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3206.2	35.9672	2	1073.558047	1073.560455	K	K	44	53
PSM	DLHQPSLSPASPHSQGFER	2038	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3014.2	30.99503	4	2168.960494	2168.964047	K	G	58	77
PSM	ETGKPKGDATVSYEDPPTAK	2039	sp|Q01844|EWS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2659.3	21.83527	4	2169.980894	2169.983110	K	A	405	425
PSM	GVVFDVTSGK	2040	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3201.2	35.83708	2	1087.493847	1087.495092	K	E	70	80
PSM	FFVSSSQGR	2041	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2981.3	30.13592	2	1093.456847	1093.459375	R	S	274	283
PSM	LVEPGSPAEK	2042	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2616.3	20.78858	2	1105.503447	1105.505657	R	A	41	51
PSM	GNDTPLALESTNTEK	2043	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3012.4	30.94967	3	1668.734171	1668.724376	K	E	1719	1734
PSM	AGDLLEDSPK	2044	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2909.3	28.2657	2	1123.476047	1123.479836	R	R	158	168
PSM	LQTPNTFPK	2045	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2904.3	28.1359	2	1124.524847	1124.526726	K	R	605	614
PSM	QFPPSPSAPK	2046	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3043.2	31.75258	2	1134.509647	1134.511076	R	I	228	238
PSM	LGIHEDSTNR	2047	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2546.2	19.15598	3	1140.551171	1140.552350	K	R	439	449
PSM	NLQTVNVDEN	2048	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2867.3	27.19525	2	1144.531847	1144.536031	K	-	116	126
PSM	GVTIKPTVDDD	2049	sp|Q2VIR3|IF2GL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2800.4	25.46462	2	1158.570447	1158.576833	R	-	462	473
PSM	GASLKSPLPSQ	2050	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2901.3	28.05803	2	1163.556447	1163.558755	K	-	113	124
PSM	RVTNDISPESSPGVGR	2051	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2743.3	23.98682	3	1749.800171	1749.804692	K	R	59	75
PSM	ADTSQEICSPRLPISASHSSK	2052	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3018.3	31.10318	4	2350.061294	2350.062440	K	T	1020	1041
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	2053	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2834.3	26.34437	5	2968.356118	2968.358028	R	L	420	447
PSM	EHYPVSSPSSPSPPAQPGGVSR	2054	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2921.3	28.57817	4	2378.992094	2378.993372	K	N	2036	2058
PSM	EAALPPVSPLK	2055	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3196.4	35.71321	2	1200.611647	1200.615542	R	A	1224	1235
PSM	SNSPLPVPPSK	2056	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2807.2	25.64045	2	1201.570447	1201.574405	R	A	301	312
PSM	VTLTSEEEAR	2057	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2854.3	26.85692	2	1213.517647	1213.522763	K	L	306	316
PSM	SISSPSVSSETMDKPVDLSTRK	2058	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2914.3	28.39563	4	2446.125294	2446.129851	K	E	2802	2824
PSM	SASVAPFTCK	2059	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3027.3	31.33867	2	1226.442447	1226.444393	K	T	1057	1067
PSM	LEAIEDDSVKETDSSSASAATPSK	2060	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21	ms_run[1]:scan=1.1.2875.3	27.40298	4	2517.102494	2517.100719	K	K	215	239
PSM	IGEGTYGVVYK	2061	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2977.3	30.03107	2	1264.5735	1264.5735	K	G	10	21
PSM	SMGLPTSDEQK	2062	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2902.4	28.08708	2	1271.507847	1271.510484	K	K	298	309
PSM	ELISNASDALDK	2063	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3057.2	32.1188	2	1274.631447	1274.635411	R	I	103	115
PSM	LFVSGACDASAK	2064	sp|P62873|GBB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2935.4	28.94037	2	1304.548647	1304.547204	R	L	198	210
PSM	APASVLPAATPR	2065	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3008.3	30.84128	2	1309.578047	1309.583269	R	Q	45	57
PSM	AGGPTTPLSPTR	2066	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2728.6	23.61357	2	1313.538447	1313.541799	R	L	15	27
PSM	TYGEPESAGPSR	2067	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2611.3	20.65808	2	1329.519247	1329.523826	R	A	104	116
PSM	EITALAPSTMK	2068	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.2960.4	29.59007	2	1336.534047	1336.538687	K	I	318	329
PSM	ASQEPSPKPGTEVIPAAPR	2069	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2961.6	29.62288	3	2010.973571	2010.977571	K	K	16	35
PSM	EIDCLSPEAQK	2070	sp|Q32MZ4|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2857.4	26.93818	2	1368.559247	1368.563248	R	L	11	22
PSM	MDSTANEVEAVK	2071	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.2688.2	22.58222	2	1388.553647	1388.553078	K	V	425	437
PSM	EMPQDLRSPARTPPSEEDSAEAER	2072	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2892.3	27.82542	4	2777.192894	2777.196368	K	L	70	94
PSM	GILAADESTGSIAK	2073	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3045.4	31.81172	2	1411.657247	1411.659591	K	R	29	43
PSM	DNNQFASASLDR	2074	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2999.3	30.60635	2	1416.559447	1416.567088	K	T	154	166
PSM	AQTPPGPSLSGSKSPCPQEK	2075	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2727.5	23.58763	3	2131.958171	2131.960935	K	S	1001	1021
PSM	LDQPVSAPPSPR	2076	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2799.2	25.43222	3	1422.593171	1422.594562	K	D	235	247
PSM	NQIHVKSPPREGSQGELTPANSQSR	2077	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2725.6	23.53585	4	2876.290894	2876.296765	R	M	462	487
PSM	KAEGEPQEESPLK	2078	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2572.3	19.75702	3	1520.677871	1520.675970	K	S	168	181
PSM	SPVSTRPLPSASQK	2079	sp|Q8ND56|LS14A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2675.2	22.2425	3	1533.753971	1533.755223	R	A	216	230
PSM	SLPTTVPESPNYR	2080	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3095.5	33.10778	2	1539.695847	1539.697039	R	N	766	779
PSM	SLPTTVPESPNYR	2081	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3087.5	32.89982	2	1539.695847	1539.697039	R	N	766	779
PSM	LGNNEACSSCHCSPVGSLSTQCDSYGR	2082	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,9-UNIMOD:21,10-UNIMOD:4,12-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3010.5	30.90015	4	3082.162494	3082.167470	R	C	389	416
PSM	YRDVAECGPQQELDLNSPR	2083	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3165.5	34.92053	3	2326.001471	2326.004926	K	N	102	121
PSM	NNEESPTATVAEQGEDITSKK	2084	sp|Q13451|FKBP5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3042.6	31.74017	3	2327.011571	2327.016595	K	D	9	30
PSM	STSQGSINSPVYSR	2085	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2756.2	24.32065	3	1561.691171	1561.677367	R	H	450	464
PSM	ATLLEDQQDPSPSS	2086	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3092.4	33.02637	2	1566.641447	1566.645063	K	-	968	982
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	2087	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3058.5	32.15455	4	3162.496894	3162.502310	K	E	179	210
PSM	TESTPITAVKQPEK	2088	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2739.2	23.8799	3	1687.748171	1687.747100	R	V	591	605
PSM	VIGSGCNLDSARFR	2089	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3169.3	35.01683	3	1710.693671	1710.695022	R	Y	158	172
PSM	GQAAVQQLQAEGLSPR	2090	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3160.3	34.78303	3	1731.829571	1731.830513	R	F	43	59
PSM	KPAAAAAPGTAEKLSPK	2091	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2609.4	20.61028	3	1766.835071	1766.836918	K	A	23	40
PSM	KTTEEQVQASTPCPR	2092	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2530.4	18.81455	3	1810.790471	1810.792079	K	T	96	111
PSM	SPGETSKPRPFAGGGYR	2093	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2735.2	23.77663	4	1842.840094	1842.841412	K	L	140	157
PSM	DGARPDVTESESGSPEYR	2094	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2737.3	23.8313	3	1950.844871	1950.855528	K	Q	425	443
PSM	NSSQDDLFPTSDTPRAK	2095	sp|Q9H6T3|RPAP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3034.3	31.52173	3	1957.839371	1957.841866	K	V	479	496
PSM	IRYESLTDPSKLDSGK	2096	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3090.3	32.97118	3	1967.863271	1967.864255	K	E	54	70
PSM	DCDRAIEINPDSAQPYK	2097	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3126.5	33.91262	3	2070.870671	2070.871786	R	W	170	187
PSM	GPPASSPAPAPKFSPVTPK	2098	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3154.4	34.62998	3	2071.879871	2071.882228	R	F	254	273
PSM	SHSPSSPDPDTPSPVGDSR	2099	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2662.6	21.91938	3	2080.776371	2080.777625	R	A	616	635
PSM	VASEAPLEHKPQVEASSPR	2100	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2721.3	23.42222	4	2111.004894	2111.004849	K	L	853	872
PSM	KLECLPPEPSPDDPESVK	2101	sp|Q96CS3|FAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3085.5	32.84783	3	2115.940571	2115.943554	R	I	346	364
PSM	AQTPPGPSLSGSKSPCPQEK	2102	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2779.5	24.92938	3	2211.923471	2211.927266	K	S	1001	1021
PSM	DQQNLPYGVTPASPSGHSQGR	2103	sp|Q7KZI7|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3005.5	30.76943	3	2274.995471	2275.001889	R	R	607	628
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	2104	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2885.4	27.65312	4	3048.316894	3048.324359	R	L	420	447
PSM	EHYPVSSPSSPSPPAQPGGVSR	2105	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2911.6	28.32763	3	2378.991071	2378.993372	K	N	2036	2058
PSM	GSLAEAVGSPPPAATPTPTPPTRK	2106	sp|Q9Y6I3|EPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3048.5	31.89335	3	2459.150471	2459.149873	R	T	446	470
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	2107	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2959.5	29.56745	3	2612.319971	2612.322435	R	Q	24	52
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	2108	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3057.5	32.1288	4	3156.394094	3156.395856	K	G	306	335
PSM	DIGFIKLD	2109	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3748.2	49.66412	2	919.499047	919.501484	K	-	49	57
PSM	QVVPFSSSV	2110	sp|Q9Y2T3|GUAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3564.2	45.0678	2	1028.454847	1028.457978	K	-	446	455
PSM	IADPEHDHTGFLTEYVATR	2111	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	38.82028	4	2330.960494	2330.961009	R	W	190	209
PSM	LNDPFQPFPGNDSPK	2112	sp|P42566|EPS15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3664.2	47.62463	3	1751.756171	1751.755617	K	E	802	817
PSM	ELIFQETAR	2113	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3323.3	38.9539	2	1185.540047	1185.543105	K	F	362	371
PSM	DLLTPCYSR	2114	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3260.4	37.32733	2	1203.497647	1203.499526	K	Q	304	313
PSM	QVPDSAATATAYLCGVK	2115	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3509.2	43.66728	3	1830.823271	1830.822317	R	A	107	124
PSM	TLLLSSDDEF	2116	sp|Q9Y519|T184B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4342.2	59.69962	2	1218.505247	1218.505716	K	-	398	408
PSM	DIDISSPEFK	2117	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3369.2	40.13428	2	1229.519847	1229.521701	K	I	172	182
PSM	QSKPVTTPEEIAQVATISANGDK	2118	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3305.3	38.48537	4	2463.186894	2463.189415	K	E	158	181
PSM	TVFSPTLPAAR	2119	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3393.2	40.74446	2	1238.602047	1238.606039	K	S	375	386
PSM	CSPTVAFVEFPSSPQLK	2120	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3832.2	51.80605	3	1972.903271	1972.900567	R	N	669	686
PSM	EDFDSLLQSAK	2121	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	45.92677	2	1331.561447	1331.564628	K	K	288	299
PSM	SIYDDISSPGLGSTPLTSR	2122	sp|Q8NFH5|NUP35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3717.4	48.97272	3	2044.937471	2044.935432	R	R	93	112
PSM	QIWLSSPSSGPK	2123	sp|Q16595|FRDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3256.4	37.22377	2	1365.634447	1365.632983	K	R	153	165
PSM	ADSGPTQPPLSLSPAPETK	2124	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3271.2	37.60927	3	2051.886671	2051.885385	R	R	2071	2090
PSM	DQPPFGDSDDSVEADKSSPGIHLER	2125	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3271.4	37.61593	4	2777.174094	2777.181763	K	S	488	513
PSM	QMGSPTGSLPLVM	2126	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4258.2	58.80122	2	1396.6118470956603	1396.6131752980002	R	H	196	209
PSM	ESVPEFPLSPPK	2127	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3611.2	46.29047	2	1405.650247	1405.653049	K	K	30	42
PSM	GFPTIYFSPANK	2128	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3756.3	49.87582	2	1420.642847	1420.642819	R	K	449	461
PSM	LISPLASPADGVK	2129	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3439.4	41.86145	2	1426.649047	1426.651015	R	S	2220	2233
PSM	AALEALGSCLNNK	2130	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3332.4	39.1927	2	1439.646847	1439.647981	R	Y	83	96
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2131	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3636.4	46.91408	4	2881.092894	2881.094982	K	T	701	725
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	2132	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3632.4	46.8172	4	2881.092894	2881.094982	K	T	701	725
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	2133	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	44.11378	4	2908.396094	2908.396782	R	S	67	92
PSM	VEIIANDQGNRITPSYVAFTPEGER	2134	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3647.2	47.18573	4	2935.316894	2935.315434	R	L	50	75
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	2135	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3577.5	45.41527	4	2952.319294	2952.317863	K	I	350	377
PSM	LTFDSSFSPNTGK	2136	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3376.3	40.30682	2	1479.627247	1479.628291	K	K	97	110
PSM	AGSPRGSPLAEGPQAFFPER	2137	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3745.4	49.62628	3	2229.954971	2229.960950	R	G	181	201
PSM	TQVLSPDSLFTAK	2138	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3774.4	50.34337	2	1485.708847	1485.711627	K	F	1717	1730
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	2139	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3335.4	39.27065	4	2989.537694	2989.541321	K	G	202	228
PSM	QQPPEPEWIGDGESTSPSDK	2140	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3313.5	38.69958	3	2262.928571	2262.931803	K	V	7	27
PSM	DTPENNPDTPFDFTPENYK	2141	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3680.2	48.03805	3	2319.921971	2319.920904	R	R	43	62
PSM	DSAGQDINLNSPNK	2142	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	39.55723	2	1551.6529	1551.6561	M	G	2	16
PSM	RPPSPDVIVLSDNEQPSSPR	2143	sp|Q86YP4|P66A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3327.5	39.06581	3	2349.038471	2349.040322	R	V	97	117
PSM	IFVGGLSPDTPEEK	2144	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3381.4	40.43765	2	1567.712447	1567.717106	K	I	184	198
PSM	GALQNIIPASTGAAK	2145	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3469.6	42.63797	2	1570.712647	1570.715740	R	A	201	216
PSM	MLAESDESGDEESVSQTDKTELQNTLR	2146	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3489.5	43.15482	4	3171.284494	3171.283996	K	T	186	213
PSM	DMSPLSETEMALGK	2147	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3802.3	51.05136	2	1603.647447	1603.651077	K	D	505	519
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	2148	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3396.5	40.83348	4	3246.385294	3246.383770	K	V	233	262
PSM	GGPGSAVSPYPTFNPSSDVAALHK	2149	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3634.3	46.86547	3	2515.0799	2515.0817	K	A	30	54
PSM	NGYELSPTAAANFTR	2150	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3474.3	42.75805	3	1690.734971	1690.735216	R	R	71	86
PSM	AGSEECVFYTDETASPLAPDLAK	2151	sp|Q765P7|MTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3700.4	48.55643	3	2550.090671	2550.087318	R	A	610	633
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2152	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4025.2	55.58698	4	3425.466894	3425.458138	K	-	610	647
PSM	GLSPAQADSQFLENAK	2153	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3461.2	42.41543	3	1754.787971	1754.787645	R	R	384	400
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	2154	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:4,20-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3486.5	43.07662	4	3544.539694	3544.541154	K	E	218	249
PSM	EPSYPMPVQETQAPESPGENSEQALQTLSPR	2155	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21,29-UNIMOD:21	ms_run[1]:scan=1.1.3720.4	49.05067	4	3556.515694	3556.510642	K	A	137	168
PSM	SESAPTLHPYSPLSPK	2156	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3272.2	37.63408	3	1869.794171	1869.795113	R	G	100	116
PSM	LLSPRPSLLTPTGDPR	2157	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3478.3	42.861	3	1878.895271	1878.900581	R	A	937	953
PSM	LSPPYSSPQEFAQDVGR	2158	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3572.3	45.27865	3	1956.858071	1956.861873	K	M	751	768
PSM	DSSTSPGDYVLSVSENSR	2159	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3593.5	45.83263	3	1978.814471	1978.815711	R	V	39	57
PSM	EGYNNPPISGENLIGLSR	2160	sp|Q9Y5Q8|TF3C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3660.3	47.52415	3	2008.928471	2008.925536	R	A	192	210
PSM	TVQGPPTSDDIFEREYK	2161	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3323.5	38.96057	3	2060.908871	2060.909217	K	Y	33	50
PSM	LTPSPDIIVLSDNEASSPR	2162	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3656.4	47.42392	3	2089.991771	2089.993281	R	S	119	138
PSM	LHIIEVGTPPTGNQPFPK	2163	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3657.2	47.44285	3	2103.980171	2103.979560	K	K	228	246
PSM	TEFSPAAFEQEQLGSPQVR	2164	sp|Q92585|MAML1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3704.4	48.65377	3	2199.980171	2199.983779	K	A	300	319
PSM	DSLGAHSITSPGGNNVQLIDK	2165	sp|Q92503|S14L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3312.5	38.67347	3	2202.025271	2202.031792	K	V	577	598
PSM	EASRPPEEPSAPSPTLPAQFK	2166	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3250.4	37.06712	3	2315.074271	2315.083493	R	Q	351	372
PSM	DNLTLWTSENQGDEGDAGEGEN	2167	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3612.4	46.3232	3	2349.944171	2349.946922	R	-	225	247
PSM	SAMDSPVPASMFAPEPSSPGAAR	2168	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3801.4	51.02493	3	2418.968171	2418.962665	R	A	8	31
PSM	AIVDALPPPCESACTVPTDVDK	2169	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3489.6	43.15815	3	2434.079471	2434.079730	R	W	261	283
PSM	DSGSDEDFLMEDDDDSDYGSSK	2170	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3291.5	38.13205	3	2443.852571	2443.860534	K	K	129	151
PSM	EEKESEDKPEIEDVGSDEEEEK	2171	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2360.2	17.1435	5	2579.097118	2578.092977	K	K	248	270
PSM	DLEVTCDPDSGGSQGLR	2172	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3144.4	34.3775	3	1884.756671	1884.756088	R	G	1319	1336
PSM	NLLSVAYK	2173	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3467.2	42.57252	2	986.481447	986.483799	R	N	44	52
PSM	IDEMPEAAVKSTANK	2174	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2695.3	22.75145	3	1698.753071	1698.753568	R	Y	30	45
PSM	ASGVAVSDGVIK	2175	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3237.4	36.73027	2	1223.5734	1223.5794	M	V	2	14
PSM	AESSESFTMASSPAQRR	2176	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3092.2	33.0197	3	1962.8146	1962.8137	M	R	2	19
PSM	GILAADESTGSIAK	2177	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3053.5	32.0239	2	1411.657247	1411.659591	K	R	29	43
PSM	WNSVSPASAGK	2178	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2839.2	26.46603	2	1262.469247	1262.473385	K	R	304	315
PSM	LGMLSPEGTCK	2179	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3119.5	33.73034	2	1271.529447	1271.529111	R	A	203	214
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2180	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3716.2	48.94007	4	2749.2320	2749.2301	-	Y	1	25
PSM	MTEWETAAPAVAETPDIK	2181	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3714.3	48.89152	3	2096.9026	2096.9008	-	L	1	19
PSM	QEEEAAQQGPVVVSPASDYK	2182	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=1.1.3295.5	38.23662	3	2193.9427	2193.9462	R	D	145	165
PSM	SSAPTTPPSVDKVDGFSR	2183	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3324.4	38.98388	3	1968.8822	1968.8825	M	K	2	20
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	2184	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2954.6	29.43933	3	2779.087871	2779.094999	K	M	571	596
PSM	FLMECRNSPVTK	2185	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2724.2	23.49653	3	1576.676171	1576.677901	K	T	58	70
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	2186	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3527.3	44.13983	4	2882.1802	2882.1622	M	D	2	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	2187	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3530.5	44.22752	3	2882.1613	2882.1618	M	D	2	29
PSM	QREEYQPATPGLGMFVEVKDPEDK	2188	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3770.3	50.2355	4	2825.2640	2825.2614	K	V	72	96
PSM	ESMCSTPAFPVSPETPYVK	2189	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,4-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3578.4	45.43818	3	2301.897071	2301.897606	K	T	839	858
PSM	SDAAVDTSSEITTK	2190	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.2898.5	27.98637	2	1545.6379	1545.6442	M	D	2	16
PSM	DGLLSPGAWNGEPSGEGSR	2191	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3795.2	50.86275	3	1965.839771	1964.826550	K	S	504	523
PSM	MMCGAPSATQPATAETQHIADQVR	2192	sp|P04080|CYTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,3-UNIMOD:4,7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3639.2	46.98123	4	2772.1084	2772.1103	-	S	1	25
PSM	RRDEDMLYSPELAQR	2193	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3115.6	33.62925	3	1958.861471	1957.871726	R	G	229	244
PSM	ELQSMADQEQVSPAAIKK	2194	sp|P32322|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2989.5	30.35173	3	2051.954771	2051.959873	R	T	267	285
PSM	MLSPQR	2195	sp|Q6DD88|ATLA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.2985.2	30.23642	2	852.3526	852.3560	-	V	1	7
PSM	VSSPLSPLSPGIKSPTIPR	2196	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3784.5	50.59008	3	2172.002171	2172.003406	K	A	555	574
PSM	WLCPLSGK	2197	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	39.83003	2	1039.453647	1039.456204	K	K	713	721
PSM	DLSTIEPLK	2198	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3382.2	40.45708	2	1094.523047	1094.526058	K	K	102	111
PSM	ASLEVSRSPR	2199	sp|O60762|DPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.2867.4	27.19858	2	1222.5661	1222.5702	M	R	2	12
PSM	DRLGSPLAVDEALRR	2200	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3286.2	37.99095	3	1746.882671	1746.877798	K	S	1306	1321
PSM	YEELQSLAGK	2201	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3166.4	34.9425	2	1216.535647	1216.537685	K	H	286	296
PSM	VAPDEHPILLTEAPLNPK	2202	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3361.4	39.93913	3	2033.022671	2033.023459	R	I	97	115
PSM	ELTEEKESAFEFLSSA	2203	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4115.2	56.96442	3	1975.774871	1975.774103	K	-	319	335
PSM	YNWSAK	2204	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2852.2	26.8017	2	847.324247	847.326570	K	A	47	53
PSM	FYEAFSK	2205	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2983.2	30.18467	2	890.413447	890.417420	K	N	429	436
PSM	APQSPRRPPHPLPPR	2206	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2578.2	19.88555	4	1781.922094	1781.920272	R	L	2070	2085
PSM	HAQDSDPRSPTLGIAR	2207	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2777.2	24.86452	4	1799.829694	1799.831576	K	T	60	76
PSM	SSTPLHSPSPIR	2208	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2752.2	24.21683	3	1357.635671	1357.639131	R	V	283	295
PSM	DGLILTSR	2209	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3184.2	35.39397	2	953.455447	953.458313	K	G	149	157
PSM	ISVREPMQTGIK	2210	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2944.2	29.16538	3	1437.712271	1437.705102	R	A	183	195
PSM	TIAPALVSK	2211	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2946.2	29.21703	2	978.514647	978.515099	K	K	72	81
PSM	VLDSGAPIK	2212	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2856.2	26.90558	2	978.474847	978.478714	K	I	125	134
PSM	SGTSEFLNK	2213	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2780.2	24.94183	2	981.472447	981.476725	K	M	169	178
PSM	FANLTPSR	2214	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2913.2	28.36658	2	984.441447	984.442997	K	T	2050	2058
PSM	SLSPGLDTK	2215	sp|O95900|TRUB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2812.2	25.77062	2	996.449247	996.452893	K	Q	297	306
PSM	SGKPAELLK	2216	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2720.2	23.39293	2	1021.516847	1021.520913	R	M	595	604
PSM	ENLSAAFSR	2217	sp|P15170-2|ERF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3185.2	35.41977	2	1073.450847	1073.454290	R	Q	59	68
PSM	DGGAWGTEQR	2218	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2689.2	22.59382	2	1075.470047	1075.468286	K	E	65	75
PSM	DYDDMSPR	2219	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2740.3	23.90888	2	1077.345447	1077.347441	R	R	279	287
PSM	GGEIQPVSVK	2220	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2818.2	25.92655	2	1092.517647	1092.521641	K	V	57	67
PSM	AVNSATGVPTV	2221	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	35.36883	2	1094.496847	1094.500906	K	-	626	637
PSM	HGSYEDAVHSGALND	2222	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2853.2	26.82767	3	1650.627071	1650.631145	K	-	542	557
PSM	VSGAGFSPSSK	2223	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2686.3	22.5231	2	1102.471247	1102.469606	R	M	1132	1143
PSM	ENFSCLTR	2224	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3131.3	34.03655	2	1105.425047	1105.426361	K	L	150	158
PSM	DNVVCLSPK	2225	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2972.3	29.90058	2	1110.474847	1110.478062	K	L	252	261
PSM	ATAGDTHLGGEDFDNR	2226	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2811.3	25.7479	3	1674.725771	1674.723391	K	L	221	237
PSM	SLSYSPVER	2227	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2926.4	28.71168	2	1116.484047	1116.485256	R	R	2690	2699
PSM	LESPTVSTLTPSSPGK	2228	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3137.3	34.19343	3	1679.796971	1679.801898	K	L	292	308
PSM	NYLQSLPSK	2229	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3134.2	34.11175	2	1128.519047	1128.521641	R	T	279	288
PSM	RDQMEGSPNSSESFEHIAR	2230	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2960.2	29.5834	4	2255.938494	2255.926675	R	S	773	792
PSM	GYSFTTTAER	2231	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2893.2	27.84762	2	1131.517447	1131.519653	R	E	197	207
PSM	SSTPLPTISSSAENTR	2232	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3020.3	31.15507	3	1726.775471	1726.777475	R	Q	158	174
PSM	NIGLGFKTPK	2233	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3094.3	33.07535	2	1153.587047	1153.589661	K	E	39	49
PSM	FTPVASKFSPGAPGGSGSQPNQK	2234	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2994.4	30.47925	4	2325.076494	2325.079076	K	L	273	296
PSM	ILKSPEIQR	2235	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2700.3	22.88298	2	1162.609647	1162.611125	R	A	292	301
PSM	TLTPDQWAR	2236	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3196.3	35.70988	2	1166.508447	1166.512139	K	E	74	83
PSM	LGIHEDSQNR	2237	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2529.2	18.7857	3	1167.562871	1167.563249	K	K	447	457
PSM	TLSPEFNER	2238	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3009.2	30.8642	2	1171.491847	1171.491069	R	F	1032	1041
PSM	YESSTASALVA	2239	sp|P62277|RS13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3142.5	34.32912	2	1177.488647	1177.490401	K	-	141	152
PSM	AAISQLRSPR	2240	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2700.4	22.88965	2	1177.594047	1177.596872	K	V	352	362
PSM	WNSVSPASAGK	2241	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2791.5	25.23665	2	1182.502647	1182.507054	K	R	304	315
PSM	EHYPVSSPSSPSPPAQPGGVSR	2242	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2922.4	28.60708	4	2378.992094	2378.993372	K	N	2036	2058
PSM	SILVSPTGPSR	2243	sp|Q14684|RRP1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3020.4	31.1584	2	1192.581447	1192.585304	K	V	702	713
PSM	EAALPPVSPLK	2244	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3212.3	36.12803	2	1200.611647	1200.615542	R	A	1224	1235
PSM	RTEGVGPGVPGEVEMVK	2245	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3151.3	34.55048	3	1819.849571	1819.853951	R	G	16	33
PSM	GMKDDKEEEEDGTGSPQLNNR	2246	sp|P49407|ARRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2585.5	20.0177	4	2427.984494	2427.984978	K	-	398	419
PSM	AIPGDQHPESPVHTEPMGIQGR	2247	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2955.5	29.46312	4	2432.090094	2432.094409	R	G	784	806
PSM	SWSPPPEVSR	2248	sp|Q9NR19|ACSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3125.2	33.87678	2	1220.521847	1220.522704	R	S	28	38
PSM	EAPEGWQTPK	2249	sp|Q9NWT8|AKIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2877.3	27.45258	2	1221.503247	1221.506719	K	I	184	194
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	2250	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3079.3	32.6845	4	2449.046094	2449.048187	R	A	90	114
PSM	SASVAPFTCK	2251	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2937.2	28.98367	2	1226.438247	1226.444393	K	T	1057	1067
PSM	GPTTGEGALDLSDVHSPPKSPEGK	2252	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3042.3	31.73017	4	2455.126894	2455.126815	K	T	141	165
PSM	EITALAPSTMK	2253	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.2879.3	27.5019	2	1256.563847	1256.572356	K	I	318	329
PSM	EAPGSPPLSPR	2254	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2772.3	24.74823	2	1266.502047	1266.504685	R	G	17	28
PSM	VDGPRSPSYGR	2255	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2533.2	18.88638	3	1269.549671	1269.550315	K	S	194	205
PSM	ELASPVSPELR	2256	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3183.4	35.3755	2	1276.599047	1276.606433	K	Q	175	186
PSM	YCRPESQEHPEADPGSAAPYLK	2257	sp|P40763|STAT3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2941.6	29.10038	4	2581.090094	2581.094469	K	T	686	708
PSM	SKWDEEWDK	2258	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3110.4	33.49178	2	1301.497847	1301.496549	K	N	182	191
PSM	QSSLAEPVSPSK	2259	sp|O43572|AKA10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2729.2	23.62608	2	1308.591847	1308.596263	K	K	179	191
PSM	ARPESERERDGEQSPNVSLMQR	2260	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2767.5	24.6162	4	2650.1848941913204	2650.1918908244097	R	M	323	345
PSM	SGTSSPQSPVFR	2261	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2827.4	26.16748	2	1328.573247	1328.576196	K	H	661	673
PSM	GPPASSPAPAPKFSPVTPK	2262	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3099.2	33.2025	3	1991.917271	1991.915897	R	F	254	273
PSM	GILAADESTGSIAK	2263	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2986.6	30.27652	2	1331.685847	1331.693260	K	R	29	43
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2264	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2563.3	19.52997	4	2673.043294	2673.045055	K	G	134	157
PSM	TVSGPGTPEPRPATPGASSVEQLRK	2265	sp|Q9H3U1|UN45A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2964.5	29.69813	4	2678.2424	2678.2461	M	E	2	27
PSM	LAIQGPEDSPSR	2266	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2906.5	28.19453	2	1348.597847	1348.602411	R	Q	230	242
PSM	LAIQGPEDSPSR	2267	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2900.2	28.02877	2	1348.597847	1348.602411	R	Q	230	242
PSM	DGFPSGTPALNAK	2268	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3109.4	33.46589	2	1353.595847	1353.596597	K	G	148	161
PSM	EAGVEMGDEDDLSTPNEK	2269	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.2792.4	25.25947	3	2030.760671	2030.766378	R	L	357	375
PSM	ELASPVSPELR	2270	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3181.4	35.32462	2	1356.570447	1356.572764	K	Q	175	186
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	2271	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2959.3	29.56078	4	2712.258894	2712.264371	K	T	139	165
PSM	GEPNVSYICSR	2272	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2957.6	29.51828	2	1360.546647	1360.548267	R	Y	273	284
PSM	NLYPSSSPYTR	2273	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3048.3	31.88668	2	1363.579047	1363.580947	K	N	275	286
PSM	VLQATVVAVGSGSK	2274	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3023.5	31.24065	2	1394.714847	1394.717047	K	G	41	55
PSM	SSDASTAQPPESQPLPASQTPASNQPK	2275	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2836.5	26.40143	4	2800.246894	2800.255263	K	R	97	124
PSM	LNQPGTPTRTAV	2276	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2759.5	24.40817	2	1413.602047	1413.605462	R	-	389	401
PSM	RYPSSISSSPQK	2277	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2609.2	20.60362	3	1415.641571	1415.644610	R	D	601	613
PSM	NQDECVIALHDCNGDVNR	2278	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2958.5	29.54132	3	2127.906671	2127.906200	K	A	64	82
PSM	SSDQPLTVPVSPK	2279	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3075.4	32.58302	2	1433.677847	1433.680327	K	F	728	741
PSM	SSTPLHSPSPIR	2280	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2781.2	24.96753	3	1437.601271	1437.605462	R	V	283	295
PSM	SGAQASSTPLSPTR	2281	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2655.6	21.75665	2	1438.640247	1438.645338	R	I	12	26
PSM	NTGIICTIGPASR	2282	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3197.3	35.73618	2	1438.665847	1438.663965	R	S	44	57
PSM	SIDTQTPSVQER	2283	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2705.4	23.01165	2	1439.626647	1439.629354	R	S	345	357
PSM	GSGSGGSGSDSEPDSPVFEDSK	2284	sp|P36956|SRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2893.6	27.86095	3	2163.806771	2163.811748	R	A	447	469
PSM	GGDSIGETPTPGASK	2285	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2669.6	22.10087	2	1452.611647	1452.613369	R	R	319	334
PSM	SSGPYGGGGQYFAK	2286	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3102.4	33.28782	2	1454.583247	1454.586761	R	P	285	299
PSM	NPSDSAVHSPFTK	2287	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2728.2	23.60023	3	1465.619771	1465.623874	K	R	408	421
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	2288	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3116.6	33.65568	4	2957.326494	2957.325316	K	E	117	144
PSM	GTDTQTPAVLSPSK	2289	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2836.6	26.40477	2	1480.673247	1480.681055	K	T	722	736
PSM	IIYGGSVTGATCK	2290	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3000.6	30.64238	2	1485.594047	1485.597599	R	E	244	257
PSM	DVSGPMPDSYSPR	2291	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2793.5	25.28855	2	1502.571447	1502.574876	K	Y	291	304
PSM	NIDINDVTPNCR	2292	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3050.4	31.94222	2	1509.624447	1509.628308	K	V	102	114
PSM	NWMVGGEGGAGGRSP	2293	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3198.4	35.76577	2	1510.598447	1510.602427	K	-	79	94
PSM	YRDVAECGPQQELDLNSPRNTTLER	2294	sp|Q9BTE3|MCMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3203.5	35.89928	4	3040.366094	3040.370978	K	Q	102	127
PSM	PFSAPKPQTSPSPK	2295	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2720.3	23.39627	3	1547.735471	1547.738510	K	R	299	313
PSM	VPSPLEGSEGDGDTD	2296	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3089.5	32.95192	2	1553.574647	1553.577043	K	-	413	428
PSM	VGDSTPVSEKPVSAAVDANASESP	2297	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3077.5	32.639	3	2393.061071	2393.063546	R	-	429	453
PSM	AGMTSSPDATTGQTFG	2298	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3157.5	34.7113	2	1607.611247	1607.617468	R	-	779	795
PSM	VIGSGCNLDSARFR	2299	sp|Q6ZMR3|LDH6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3036.2	31.5703	3	1630.727471	1630.728691	R	Y	158	172
PSM	TTSPLEEEEREIK	2300	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3038.2	31.62237	3	1639.7462	1639.7332	K	S	363	376
PSM	GGKPEPPAMPQPVPTA	2301	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3098.6	33.18983	2	1652.760647	1652.763345	K	-	228	244
PSM	SSGGREDLESSGLQR	2302	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2712.3	23.18892	3	1656.709871	1656.710458	K	R	70	85
PSM	AGGPTTPLSPTRLSR	2303	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3044.3	31.78233	3	1669.760471	1669.759002	R	L	15	30
PSM	SSDEENGPPSSPDLDR	2304	sp|Q96B36|AKTS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2770.4	24.68992	3	1780.674971	1780.678883	R	I	202	218
PSM	RLQSIGTENTEENRR	2305	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2566.3	19.60235	4	1801.900894	1801.903087	K	F	43	58
PSM	RKIDAGTMAEPSASPSK	2306	sp|Q8IXQ3|CI040_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2647.4	21.5457	3	1824.837371	1824.844114	K	R	56	73
PSM	AASPPASASDLIEQQQK	2307	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3216.4	36.23565	3	1899.799871	1899.801655	R	R	333	350
PSM	EVNVSPCPTQPCQLSK	2308	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.2948.4	29.27657	3	1922.825771	1922.826750	K	G	36	52
PSM	DSENLASPSEYPENGER	2309	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3003.5	30.71742	2	1972.764847	1972.768760	R	F	617	634
PSM	SASQGALTSPSVSFSNHR	2310	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3127.4	33.93545	3	1991.814671	1991.813951	R	T	475	493
PSM	SGPKPFSAPKPQTSPSPK	2311	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2755.3	24.2979	4	1996.906494	1996.906060	R	R	295	313
PSM	SAESPTSPVTSETGSTFKK	2312	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3055.3	32.06962	3	2099.868071	2099.870128	K	F	280	299
PSM	NSLDASRPAGLSPTLTPGER	2313	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3167.6	34.97515	3	2118.006071	2118.010663	K	Q	138	158
PSM	TVEVAEGEAVRTPQSVTAK	2314	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2972.6	29.91058	3	2130.953471	2130.959947	R	Q	132	151
PSM	SYLMTNYESAPPSPQYKK	2315	sp|O75223|GGCT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3158.5	34.73687	3	2182.960271	2182.964624	R	I	124	142
PSM	TVGTPIASVPGSTNTGTVPGSEK	2316	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3122.5	33.8084	3	2236.058471	2236.062423	R	D	270	293
PSM	VSEEQTQPPSPAGAGMSTAMGR	2317	sp|Q16666|IF16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3100.5	33.23902	3	2267.949371	2267.955198	K	S	144	166
PSM	IYQEEEMPESGAGSEFNRK	2318	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3050.5	31.94555	3	2279.941271	2279.940594	K	L	56	75
PSM	SVSVDSGEQREAGTPSLDSEAK	2319	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2834.5	26.35103	3	2328.004271	2328.011844	R	E	116	138
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	2320	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3214.5	36.187	3	2574.216971	2574.222781	K	K	453	479
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	2321	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2647.6	21.55237	3	2611.081271	2611.085754	K	L	460	485
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	2322	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3103.6	33.32023	3	3722.189171	3722.195067	K	A	158	190
PSM	DSLIDSLT	2323	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3729.2	49.24015	2	862.427847	862.428378	R	-	238	246
PSM	DVIEEYFK	2324	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3566.2	45.11983	2	1041.498047	1041.501878	K	C	122	130
PSM	DLNSYLEDK	2325	sp|O43324|MCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3247.2	36.98303	2	1095.505647	1095.508420	K	V	97	106
PSM	ALLLLCGEDD	2326	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3759.2	49.94705	2	1117.531647	1117.532526	K	-	311	321
PSM	DLFPYEESK	2327	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3300.3	38.35997	2	1126.514447	1126.518256	K	E	62	71
PSM	SVDFDSLTVR	2328	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3551.3	44.74586	2	1217.535447	1217.532934	K	T	458	468
PSM	GVLLYGPPGTGK	2329	sp|Q8NB90|AFG2H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3297.2	38.2789	2	1237.603447	1237.610790	R	T	389	401
PSM	TVFSPTLPAAR	2330	sp|Q7Z2W4|ZCCHV_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3385.2	40.53565	2	1238.602047	1238.606039	K	S	375	386
PSM	LDIDSPPITAR	2331	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3288.4	38.0501	2	1276.601447	1276.606433	R	N	33	44
PSM	EGMNIVEAMER	2332	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3467.3	42.57585	2	1277.572647	1277.574407	K	F	134	145
PSM	DSPSVWAAVPGK	2333	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3410.5	41.19032	2	1292.576647	1292.580219	K	T	27	39
PSM	NSLESYAFNMK	2334	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3391.4	40.6991	2	1302.589047	1302.591438	K	A	540	551
PSM	SVPTSTVFYPSDGVATEK	2335	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3408.2	41.13057	3	1963.880771	1963.881605	R	A	439	457
PSM	DVLSVAFSSDNR	2336	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3499.4	43.41247	2	1308.627447	1308.630994	K	Q	107	119
PSM	AITGASLADIMAK	2337	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3705.2	48.67315	2	1340.639047	1340.641104	R	R	81	94
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	2338	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,5-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3328.4	39.08827	4	2699.182894	2699.179867	R	D	175	200
PSM	IFRDGEEAGAYDGPRTADGIVSHLK	2339	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3288.5	38.05343	4	2753.282094	2753.281024	K	K	105	130
PSM	TLPLTTAPEAGEVTPSDSGGQEDSPAK	2340	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	5-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3378.4	40.35992	4	2814.1952941913205	2814.1885613794893	K	G	2233	2260
PSM	EFVSISSPAHVAT	2341	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3322.5	38.9352	2	1423.636847	1423.638462	R	-	894	907
PSM	TVIIEQSWGSPK	2342	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3331.3	39.16367	2	1423.671447	1423.674847	R	V	61	73
PSM	DTQSPSTCSEGLLGWSQK	2343	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3870.4	52.72403	3	2139.822371	2139.822133	K	D	709	727
PSM	TSSLAPVVGTTTTTPSPSAIK	2344	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3397.3	40.85185	3	2175.007571	2175.011313	K	A	226	247
PSM	CDENILWLDYK	2345	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3753.4	49.7983	2	1467.667647	1467.670417	K	N	152	163
PSM	TQVLSPDSLFTAK	2346	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3783.4	50.55753	2	1485.708847	1485.711627	K	F	1717	1730
PSM	TGTAEMSSILEER	2347	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3462.6	42.45478	2	1502.631247	1502.632390	K	I	46	59
PSM	LYGSAGPPPTGEEDTAEKDEL	2348	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3264.5	37.43608	3	2254.968971	2254.951870	K	-	634	655
PSM	VEGIYTYSLSPSK	2349	sp|O95197|RTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3392.5	40.7283	2	1522.696247	1522.695642	K	V	220	233
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	2350	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3275.5	37.71983	4	3114.462494	3114.465924	K	R	65	93
PSM	TQVLSPDSLFTAK	2351	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3984.3	54.91788	2	1565.675647	1565.677958	K	F	1717	1730
PSM	TSDIFGSPVTATSR	2352	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3478.4	42.86433	2	1597.639847	1597.642635	K	L	91	105
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	2353	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3375.4	40.28572	4	3199.396094	3199.394275	K	N	213	241
PSM	NREPLMPSPQFIK	2354	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3402.2	40.98085	3	1635.787571	1635.784415	K	S	246	259
PSM	NPEVGLKPVWYSPK	2355	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3388.2	40.61335	3	1692.827771	1692.827660	K	V	536	550
PSM	VTNGAFTGEISPGMIK	2356	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3559.4	44.94663	2	1700.782047	1700.784474	K	D	107	123
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2357	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4011.2	55.37926	4	3425.466894	3425.458138	K	-	610	647
PSM	TWTTPEVTSPPPSPR	2358	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3309.3	38.58823	3	1811.748371	1811.753248	R	T	125	140
PSM	ELSPDFYQPGPDYVK	2359	sp|Q9HDC5|JPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3568.3	45.1748	3	1833.782471	1833.786248	R	Q	411	426
PSM	RIPSIVSSPLNSPLDR	2360	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3590.3	45.74807	3	1909.899971	1909.906395	K	S	327	343
PSM	SATSSSPGSPLHSLETSL	2361	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4180.2	58.02195	2	1916.781247	1916.780585	K	-	1203	1221
PSM	ALSSGGSITSPPLSPALPK	2362	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3601.4	46.0375	3	1938.907571	1938.910477	R	Y	17	36
PSM	FDRGYISPYFINTSK	2363	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3683.3	48.1197	3	1966.826471	1966.826747	K	G	219	234
PSM	GLSLVDKENTPPALSGTR	2364	sp|P31350|RIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3290.4	38.10253	3	2013.912071	2013.917353	K	V	24	42
PSM	SMGTGDTPGLEVPSSPLRK	2365	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3313.4	38.69625	3	2087.899871	2087.899989	R	A	381	400
PSM	DNLTLWTSDQQDEEAGEGN	2366	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3643.2	47.0823	3	2120.874071	2120.877051	R	-	228	247
PSM	TDKSSASAPDVDDPEAFPALA	2367	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3694.3	48.3925	3	2182.930571	2182.930741	R	-	388	409
PSM	NVVVVDGVRTPFLLSGTSYK	2368	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3867.3	52.64963	3	2310.105371	2310.106217	R	D	53	73
PSM	ADLLLSTQPGREEGSPLELER	2369	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3561.2	44.99032	4	2389.148094	2389.152635	K	L	593	614
PSM	AIVDALPPPCESACTVPTDVDK	2370	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3505.4	43.56937	3	2434.079771	2434.079730	R	W	261	283
PSM	VLENAEGARTTPSVVAFTADGER	2371	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3315.5	38.75182	3	2469.149771	2469.153698	K	L	77	100
PSM	DNLTLWTADNAGEEGGEAPQEPQS	2372	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3907.3	53.63873	3	2608.058171	2608.060251	R	-	225	249
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	2373	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.3811.3	51.28413	3	2763.130571	2763.129259	K	D	208	233
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	2374	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3439.6	41.86812	3	2988.155171	2988.155727	K	E	144	170
PSM	DGDSYDPYDFSDTEEEMPQVHTPKTADSQETK	2375	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	45.80002	4	3821.450494	3821.448889	K	E	701	733
PSM	EITALAPSTMK	2376	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.2968.5	29.80267	2	1336.534047	1336.538687	K	I	318	329
PSM	TIAPALVSK	2377	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2954.2	29.426	2	978.514647	978.515099	K	K	72	81
PSM	SESAPTLHPYSPLSPK	2378	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3264.2	37.42608	3	1869.794171	1869.795113	R	G	100	116
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	2379	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,3-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3413.4	41.26115	3	2588.0465	2588.0424	M	R	2	32
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	2380	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.2729.5	23.63608	4	3007.3259	3007.3290	K	S	145	174
PSM	DSSQGPCEPLPGPLTQPR	2381	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3306.4	38.51357	3	2015.884871	2014.881957	R	A	101	119
PSM	AESSESFTMASSPAQR	2382	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3007.6	30.82522	2	1822.7022	1822.7076	M	R	2	18
PSM	QEDSESSEEESDSEEAAASPAQVK	2383	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2737.6	23.8413	3	2617.997171	2618.002856	K	T	759	783
PSM	AQLGGPEAAKSDETAAK	2384	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2578.3	19.89555	3	1722.779771	1722.782560	R	-	189	206
PSM	WNSVSPASAGK	2385	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2855.3	26.88302	2	1262.469247	1262.473385	K	R	304	315
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2386	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3711.6	48.84208	3	2749.2325	2749.2301	-	Y	1	25
PSM	NGSTAVAESVASPQK	2387	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2680.5	22.38135	2	1525.690247	1524.682118	K	T	1017	1032
PSM	DITEEIMSGAR	2388	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3158.3	34.7302	2	1316.532647	1316.531948	K	T	191	202
PSM	SSFYPDGGDQETAKTGK	2389	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2784.5	25.05532	3	1866.765671	1866.767304	R	F	319	336
PSM	AENVVEPGPPSAK	2390	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3052.5	31.99738	2	1415.6286	1415.6329	M	R	2	15
PSM	ATSEEDVSIKSPICEK	2391	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2895.4	27.90543	3	1871.822171	1871.822376	K	Q	1606	1622
PSM	SSDQPLTVPVSPK	2392	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3091.5	33.00377	2	1433.677847	1433.680327	K	F	728	741
PSM	NSNSPPSPSSMNQR	2393	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2655.3	21.74665	3	1582.626971	1581.624285	R	R	454	468
PSM	LITPAVVSER	2394	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3176.2	35.19372	2	1163.591447	1163.595140	K	L	67	77
PSM	KLNSPEETAFQTPK	2395	sp|Q9BTX1|NDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2946.3	29.22037	3	1668.780971	1668.776018	K	S	403	417
PSM	KTGEAYVQFEEPEMANQALLK	2396	sp|Q12849|GRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2489.2	18.27593	4	2411.1782	2411.1672	R	H	289	310
PSM	SETAPAAPAAPAPAEKTPVK	2397	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.2853.6	26.841	3	2024.9771	2024.9815	M	K	2	22
PSM	NTLNGDLASATIPEESR	2398	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3338.3	39.34558	3	1866.837971	1866.836052	K	L	266	283
PSM	EPGGRSPAFVQLAPLSSK	2399	sp|P51610|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3489.4	43.15148	3	1999.915871	1999.916959	R	V	1200	1218
PSM	YTPASPSSPDFTTWSCAK	2400	sp|O75808|CAN15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3648.2	47.22467	3	2161.809371	2161.810505	R	C	331	349
PSM	QHEAPSNRPLNELLTPQGPSPR	2401	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3386.4	40.56822	4	2580.1572	2580.1518	R	T	167	189
PSM	TLEEVVMAEEEDEGTDRPGSPA	2402	sp|A6NKF1|SAC31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3714.4	48.89485	3	2440.002371	2439.998897	R	-	383	405
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	2403	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	27-UNIMOD:21	ms_run[1]:scan=1.1.2692.6	22.68413	4	3173.324894	3173.326984	K	E	337	367
PSM	EVLDEDTDEEKETLK	2404	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2938.4	29.01545	3	1871.792771	1871.792516	K	N	990	1005
PSM	NGSLDSPGKQDTEEDEEEDEK	2405	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2693.6	22.71015	3	2430.904571	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEK	2406	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2710.5	23.14397	3	2430.905171	2429.923149	K	D	134	155
PSM	RGSLSNAGDPEIVKSPSDPK	2407	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2777.3	24.86785	4	2135.001294	2133.010328	R	Q	92	112
PSM	KLILDSAR	2408	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2821.2	26.00488	2	994.517047	994.521247	R	A	543	551
PSM	SSFYPDGGDQETAKTGK	2409	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2870.3	27.27317	3	1946.730371	1946.733635	R	F	319	336
PSM	LGAPALTSR	2410	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2873.2	27.3473	2	964.474047	964.474297	R	Q	426	435
PSM	TYYIELWDVGGSVGSASSVK	2411	sp|Q5HYI8|RABL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2888.4	27.72773	3	2276.948471	2276.964363	K	S	59	79
PSM	MPPRTPAEASSTGQTGPQSAL	2412	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35,5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.2936.6	28.97182	3	2258.922971	2258.927995	K	-	238	259
PSM	TINEVENQILTRDAK	2413	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3149.2	34.4974	3	1822.878971	1822.882608	R	G	727	742
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	2414	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3315.6	38.75515	3	2654.187071	2654.189112	K	K	453	479
PSM	ESAEYRCSVLSSAGNK	2415	sp|Q92854-2|SEM4D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3985.2	54.94383	3	1916.752271	1916.737675	R	T	671	687