MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000150 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617204740166495^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_16_K2_4.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	52.0	null	2-UNIMOD:1,19-UNIMOD:21,14-UNIMOD:21,757-UNIMOD:21,598-UNIMOD:21,628-UNIMOD:4,4-UNIMOD:21,756-UNIMOD:21,479-UNIMOD:21	0.12	52.0	10	4	2
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	118-UNIMOD:21,101-UNIMOD:21,27-UNIMOD:21,120-UNIMOD:21,81-UNIMOD:21	0.32	46.0	13	5	3
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	641-UNIMOD:21,646-UNIMOD:21,692-UNIMOD:21,696-UNIMOD:21,638-UNIMOD:21,691-UNIMOD:21,665-UNIMOD:21,681-UNIMOD:21	0.12	46.0	14	3	0
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	null	2-UNIMOD:1,15-UNIMOD:21	0.33	46.0	9	2	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	30-UNIMOD:21	0.16	45.0	7	2	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	23-UNIMOD:21,19-UNIMOD:21	0.06	44.0	3	1	0
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	373-UNIMOD:4,377-UNIMOD:21,386-UNIMOD:21,385-UNIMOD:21,173-UNIMOD:21,179-UNIMOD:4,285-UNIMOD:21,289-UNIMOD:21,64-UNIMOD:21	0.15	43.0	19	5	3
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	115-UNIMOD:21,447-UNIMOD:4,455-UNIMOD:21,225-UNIMOD:21,231-UNIMOD:21,159-UNIMOD:21,175-UNIMOD:21,206-UNIMOD:21,447-UNIMOD:385,70-UNIMOD:21,163-UNIMOD:21,114-UNIMOD:21,382-UNIMOD:21,158-UNIMOD:28,173-UNIMOD:21,164-UNIMOD:21,232-UNIMOD:21	0.26	43.0	43	12	4
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	160-UNIMOD:21,155-UNIMOD:21,145-UNIMOD:28,159-UNIMOD:21	0.07	43.0	15	3	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	263-UNIMOD:21,26-UNIMOD:21,229-UNIMOD:21,272-UNIMOD:21,19-UNIMOD:21,72-UNIMOD:21,79-UNIMOD:21,14-UNIMOD:21,37-UNIMOD:21,40-UNIMOD:21,205-UNIMOD:21,41-UNIMOD:21,27-UNIMOD:21	0.31	43.0	22	11	6
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	202-UNIMOD:21,204-UNIMOD:21,17-UNIMOD:21,198-UNIMOD:21,310-UNIMOD:35,312-UNIMOD:21,286-UNIMOD:21,30-UNIMOD:35,368-UNIMOD:21,207-UNIMOD:21	0.18	43.0	17	5	2
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	287-UNIMOD:21,295-UNIMOD:21,439-UNIMOD:21,444-UNIMOD:21,548-UNIMOD:21,443-UNIMOD:21,595-UNIMOD:21	0.09	42.0	8	4	2
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	2221-UNIMOD:4,2223-UNIMOD:21,2231-UNIMOD:21,1129-UNIMOD:4,1131-UNIMOD:21,1139-UNIMOD:21,1923-UNIMOD:21,1143-UNIMOD:21,1801-UNIMOD:21,2342-UNIMOD:4,2344-UNIMOD:21,2352-UNIMOD:21,1980-UNIMOD:21,1981-UNIMOD:4,1991-UNIMOD:21	0.03	41.0	9	6	4
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	214-UNIMOD:21,138-UNIMOD:35,202-UNIMOD:21	0.18	41.0	10	4	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	442-UNIMOD:21,67-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,78-UNIMOD:21	0.10	41.0	5	2	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	122-UNIMOD:21	0.04	41.0	6	3	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	743-UNIMOD:21,758-UNIMOD:4,751-UNIMOD:21,755-UNIMOD:21	0.04	40.0	8	1	0
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	232-UNIMOD:21,241-UNIMOD:21	0.04	40.0	4	1	0
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	41-UNIMOD:21,46-UNIMOD:21	0.19	39.0	2	1	0
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	103-UNIMOD:21,106-UNIMOD:4	0.03	39.0	2	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	235-UNIMOD:35	0.12	39.0	9	2	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	47-UNIMOD:21	0.18	39.0	8	3	2
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	405-UNIMOD:21,418-UNIMOD:21,401-UNIMOD:21,172-UNIMOD:21,135-UNIMOD:21,331-UNIMOD:21,332-UNIMOD:21,411-UNIMOD:21	0.17	39.0	10	4	2
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	147-UNIMOD:21	0.10	38.0	2	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35,300-UNIMOD:21,305-UNIMOD:35,303-UNIMOD:21,106-UNIMOD:21	0.19	38.0	13	4	2
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	74-UNIMOD:21,76-UNIMOD:21	0.08	37.0	11	4	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	145-UNIMOD:21,139-UNIMOD:21,136-UNIMOD:21,299-UNIMOD:35,303-UNIMOD:21	0.14	37.0	14	4	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	691-UNIMOD:21,695-UNIMOD:21,712-UNIMOD:21,716-UNIMOD:4,435-UNIMOD:21,1715-UNIMOD:21,714-UNIMOD:21,1290-UNIMOD:35,1296-UNIMOD:4,1297-UNIMOD:21,494-UNIMOD:21,501-UNIMOD:21,504-UNIMOD:21,601-UNIMOD:21,1029-UNIMOD:21,1031-UNIMOD:21,979-UNIMOD:21,1138-UNIMOD:21,1714-UNIMOD:21	0.11	37.0	24	11	5
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	51-UNIMOD:21,54-UNIMOD:21,53-UNIMOD:21	0.05	37.0	5	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	31-UNIMOD:21,152-UNIMOD:21,153-UNIMOD:4,96-UNIMOD:21	0.19	37.0	5	3	1
PRT	sp|P62310|LSM3_HUMAN	U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,10-UNIMOD:21	0.22	37.0	1	1	1
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	356-UNIMOD:21	0.06	36.0	1	1	1
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	157-UNIMOD:21	0.09	36.0	2	2	2
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	67-UNIMOD:21,60-UNIMOD:21,104-UNIMOD:21	0.10	36.0	5	3	2
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	438-UNIMOD:21,177-UNIMOD:21	0.07	36.0	3	2	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	117-UNIMOD:21,79-UNIMOD:4,83-UNIMOD:21,210-UNIMOD:21,213-UNIMOD:21,215-UNIMOD:21,113-UNIMOD:21,249-UNIMOD:21,255-UNIMOD:4,120-UNIMOD:35,58-UNIMOD:21,251-UNIMOD:21,254-UNIMOD:21	0.34	36.0	15	6	3
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	222-UNIMOD:21,225-UNIMOD:21	0.04	36.0	3	2	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	241-UNIMOD:4,243-UNIMOD:21,295-UNIMOD:21,135-UNIMOD:21,286-UNIMOD:35	0.11	36.0	6	3	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	612-UNIMOD:21,616-UNIMOD:21	0.03	36.0	4	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	641-UNIMOD:21,668-UNIMOD:21	0.04	36.0	3	2	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	629-UNIMOD:21,637-UNIMOD:21	0.03	36.0	4	1	0
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	36.0	null	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21,64-UNIMOD:21,70-UNIMOD:21,450-UNIMOD:21,12-UNIMOD:21	0.07	36.0	17	3	1
PRT	sp|O00418|EF2K_HUMAN	Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,18-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,15-UNIMOD:21	0.07	36.0	3	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	2410-UNIMOD:21	0.00	35.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	389-UNIMOD:21,65-UNIMOD:21	0.08	35.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	643-UNIMOD:21,85-UNIMOD:21,91-UNIMOD:21,637-UNIMOD:21,62-UNIMOD:21,69-UNIMOD:21,65-UNIMOD:21,534-UNIMOD:21,460-UNIMOD:21	0.16	35.0	19	9	5
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	158-UNIMOD:21,145-UNIMOD:28	0.11	35.0	3	2	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	156-UNIMOD:21,160-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,139-UNIMOD:4,8-UNIMOD:21	0.25	35.0	10	3	1
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	144-UNIMOD:21,147-UNIMOD:21,355-UNIMOD:21	0.10	35.0	3	2	1
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	62-UNIMOD:21	0.05	35.0	2	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	38-UNIMOD:21	0.15	35.0	13	2	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	237-UNIMOD:4	0.10	35.0	2	1	0
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	183-UNIMOD:21,188-UNIMOD:21,197-UNIMOD:21	0.06	35.0	3	1	0
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	259-UNIMOD:21,193-UNIMOD:35,198-UNIMOD:21,199-UNIMOD:21,225-UNIMOD:21	0.20	35.0	10	4	2
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	278-UNIMOD:35,280-UNIMOD:21,507-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21,282-UNIMOD:21,358-UNIMOD:21,506-UNIMOD:35,514-UNIMOD:35	0.08	34.0	11	4	1
PRT	sp|P32004|L1CAM_HUMAN	Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1248-UNIMOD:21,312-UNIMOD:4,320-UNIMOD:21	0.03	34.0	4	2	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	210-UNIMOD:21,211-UNIMOD:21,241-UNIMOD:21,246-UNIMOD:21,247-UNIMOD:4,151-UNIMOD:21,152-UNIMOD:4,154-UNIMOD:21,156-UNIMOD:4	0.16	34.0	9	3	2
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	79-UNIMOD:21,64-UNIMOD:21,51-UNIMOD:21,76-UNIMOD:21	0.46	34.0	14	7	4
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	14-UNIMOD:21,211-UNIMOD:21	0.10	34.0	5	2	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	488-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21	0.05	34.0	5	2	0
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	298-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	607-UNIMOD:21,402-UNIMOD:21,599-UNIMOD:21,296-UNIMOD:21,404-UNIMOD:21	0.09	34.0	9	4	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	34-UNIMOD:21,37-UNIMOD:21	0.11	34.0	4	2	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35	0.05	34.0	4	1	0
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21,104-UNIMOD:21,192-UNIMOD:21,201-UNIMOD:21	0.29	34.0	7	3	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	2272-UNIMOD:21,1043-UNIMOD:21,440-UNIMOD:21,1320-UNIMOD:21,1329-UNIMOD:21,2347-UNIMOD:21,2102-UNIMOD:21,2104-UNIMOD:21,1003-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,424-UNIMOD:21,2329-UNIMOD:21,2335-UNIMOD:21,1042-UNIMOD:21	0.06	33.0	12	9	6
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	583-UNIMOD:21,586-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	190-UNIMOD:21,193-UNIMOD:21	0.05	33.0	6	2	0
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	242-UNIMOD:21,249-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	319-UNIMOD:21,18-UNIMOD:21,322-UNIMOD:21	0.14	33.0	7	4	2
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	10-UNIMOD:21	0.09	33.0	2	1	0
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	113-UNIMOD:4,115-UNIMOD:21	0.13	33.0	1	1	1
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	8-UNIMOD:21	0.10	33.0	4	2	0
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	370-UNIMOD:21	0.07	33.0	3	2	1
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,12-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4,8-UNIMOD:21	0.15	33.0	4	1	0
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	0.07	33.0	3	1	0
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	87-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	286-UNIMOD:21,285-UNIMOD:21	0.07	32.0	6	2	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	32.0	3	1	0
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	241-UNIMOD:4,242-UNIMOD:21,234-UNIMOD:21,243-UNIMOD:21,240-UNIMOD:21	0.06	32.0	3	1	0
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	221-UNIMOD:21,267-UNIMOD:21,308-UNIMOD:21,333-UNIMOD:4,319-UNIMOD:21	0.14	32.0	6	3	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	2083-UNIMOD:21,569-UNIMOD:21,107-UNIMOD:4,115-UNIMOD:21,2054-UNIMOD:21	0.03	32.0	5	4	3
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	174-UNIMOD:21,179-UNIMOD:21,56-UNIMOD:21	0.15	32.0	3	2	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	663-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	88-UNIMOD:21	0.06	32.0	2	1	0
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	289-UNIMOD:21,366-UNIMOD:21,367-UNIMOD:21,295-UNIMOD:35,298-UNIMOD:21,119-UNIMOD:21,306-UNIMOD:35,77-UNIMOD:21,281-UNIMOD:28	0.17	32.0	8	4	2
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	273-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	165-UNIMOD:21,164-UNIMOD:21	0.10	32.0	4	2	0
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	251-UNIMOD:21,320-UNIMOD:21,326-UNIMOD:21,327-UNIMOD:35,325-UNIMOD:21	0.16	32.0	10	5	3
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	2319-UNIMOD:21,2327-UNIMOD:21,2370-UNIMOD:21,2378-UNIMOD:4,1533-UNIMOD:21,2033-UNIMOD:21,1453-UNIMOD:4,1459-UNIMOD:21,1946-UNIMOD:21,1453-UNIMOD:385	0.05	32.0	12	7	5
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	335-UNIMOD:21,332-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	253-UNIMOD:4,254-UNIMOD:21,209-UNIMOD:21	0.05	32.0	2	2	2
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	2-UNIMOD:1,13-UNIMOD:21,10-UNIMOD:35,27-UNIMOD:21	0.03	32.0	7	4	2
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	159-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	142-UNIMOD:21	0.10	31.0	2	1	0
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	575-UNIMOD:21,210-UNIMOD:21,216-UNIMOD:4,574-UNIMOD:21	0.07	31.0	8	4	2
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:21	0.18	31.0	2	2	2
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	226-UNIMOD:21,229-UNIMOD:21	0.03	31.0	3	2	1
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	139-UNIMOD:21,142-UNIMOD:21	0.10	31.0	5	2	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	145-UNIMOD:21	0.14	31.0	6	3	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	779-UNIMOD:21,778-UNIMOD:21	0.01	31.0	3	1	0
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	152-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	270-UNIMOD:4,272-UNIMOD:21,274-UNIMOD:4,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.15	31.0	8	2	1
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,14-UNIMOD:21	0.16	31.0	2	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	65-UNIMOD:21,89-UNIMOD:21	0.17	30.0	5	4	3
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	128-UNIMOD:21,138-UNIMOD:4,51-UNIMOD:21,53-UNIMOD:21	0.09	30.0	3	2	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	426-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	234-UNIMOD:21,104-UNIMOD:4,125-UNIMOD:21,237-UNIMOD:21	0.23	30.0	13	4	1
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	56-UNIMOD:21	0.06	30.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	3	2	1
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	30.0	null	285-UNIMOD:21,286-UNIMOD:21,1395-UNIMOD:21,1399-UNIMOD:4,1407-UNIMOD:4,283-UNIMOD:21,248-UNIMOD:21,265-UNIMOD:4,642-UNIMOD:21,1390-UNIMOD:21	0.05	30.0	17	5	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	133-UNIMOD:21,137-UNIMOD:21	0.11	30.0	2	1	0
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	985-UNIMOD:4,989-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	41-UNIMOD:21,4564-UNIMOD:21,4100-UNIMOD:21,5099-UNIMOD:21,511-UNIMOD:21,3426-UNIMOD:21,93-UNIMOD:21,5763-UNIMOD:21,177-UNIMOD:21,3417-UNIMOD:35,3716-UNIMOD:21	0.03	30.0	17	11	6
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	791-UNIMOD:21	0.02	30.0	3	1	0
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	272-UNIMOD:21,274-UNIMOD:4,277-UNIMOD:4	0.04	30.0	2	1	0
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	638-UNIMOD:21,680-UNIMOD:21,394-UNIMOD:21,324-UNIMOD:21,401-UNIMOD:21,213-UNIMOD:35,227-UNIMOD:21	0.14	30.0	13	5	2
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	246-UNIMOD:21,251-UNIMOD:21,237-UNIMOD:21,242-UNIMOD:4,278-UNIMOD:21	0.11	30.0	5	3	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	202-UNIMOD:21,37-UNIMOD:21,41-UNIMOD:21	0.08	30.0	12	3	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	58-UNIMOD:21,65-UNIMOD:21,28-UNIMOD:21	0.21	30.0	4	2	0
PRT	sp|P48960|CD97_HUMAN	CD97 antigen OS=Homo sapiens OX=9606 GN=CD97 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	44-UNIMOD:4,61-UNIMOD:21,62-UNIMOD:4,68-UNIMOD:4,70-UNIMOD:21,59-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21,35-UNIMOD:21,551-UNIMOD:21	0.08	30.0	14	4	3
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	62-UNIMOD:21,88-UNIMOD:21	0.07	30.0	5	2	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	30.0	3	1	0
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	453-UNIMOD:21,609-UNIMOD:21,416-UNIMOD:21,859-UNIMOD:21,462-UNIMOD:21	0.08	29.0	7	5	4
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	443-UNIMOD:21,434-UNIMOD:35,437-UNIMOD:21,120-UNIMOD:21,456-UNIMOD:21	0.14	29.0	13	4	2
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	199-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|P55327|TPD52_HUMAN	Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	171-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1183-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	37-UNIMOD:21,32-UNIMOD:21,139-UNIMOD:21,149-UNIMOD:21	0.09	29.0	4	2	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	104-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	363-UNIMOD:21,367-UNIMOD:21,368-UNIMOD:21	0.04	29.0	5	1	0
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	861-UNIMOD:21,859-UNIMOD:21	0.05	29.0	5	2	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	116-UNIMOD:21,134-UNIMOD:4	0.18	29.0	2	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	94-UNIMOD:21,361-UNIMOD:21,48-UNIMOD:21,334-UNIMOD:21,56-UNIMOD:21,73-UNIMOD:21,82-UNIMOD:21	0.31	29.0	13	8	4
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	720-UNIMOD:21,723-UNIMOD:21,727-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	27-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.06	29.0	5	3	2
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	33-UNIMOD:21,36-UNIMOD:35	0.05	29.0	3	1	0
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	2169-UNIMOD:4,2172-UNIMOD:21,2176-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	394-UNIMOD:21,415-UNIMOD:21	0.07	29.0	3	2	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.08	29.0	3	1	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	49-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	722-UNIMOD:21,725-UNIMOD:21	0.04	29.0	3	2	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	1-UNIMOD:1,14-UNIMOD:21,2-UNIMOD:1,1-UNIMOD:35,2-UNIMOD:21	0.09	29.0	8	2	0
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	182-UNIMOD:21	0.15	29.0	2	1	0
PRT	sp|A1KXE4|F168B_HUMAN	Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35	0.10	29.0	3	1	0
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,12-UNIMOD:21	0.14	29.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	335-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	687-UNIMOD:21,691-UNIMOD:21	0.06	28.0	3	3	3
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	495-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	76-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	452-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	346-UNIMOD:21	0.03	28.0	7	2	0
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	181-UNIMOD:21,171-UNIMOD:4	0.05	28.0	3	2	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	862-UNIMOD:21,864-UNIMOD:21,865-UNIMOD:21,673-UNIMOD:21,675-UNIMOD:4,1319-UNIMOD:21	0.03	28.0	5	3	2
PRT	sp|P17813|EGLN_HUMAN	Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	516-UNIMOD:4,521-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	268-UNIMOD:35,275-UNIMOD:21,274-UNIMOD:21,232-UNIMOD:21	0.10	28.0	5	3	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	144-UNIMOD:21,149-UNIMOD:21	0.14	28.0	2	1	0
PRT	sp|Q9Y6I3|EPN1_HUMAN	Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	454-UNIMOD:21,460-UNIMOD:21,447-UNIMOD:21,462-UNIMOD:21	0.04	28.0	4	2	1
PRT	sp|O75496|GEMI_HUMAN	Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	64-UNIMOD:21	0.12	28.0	1	1	1
PRT	sp|Q9BVK6|TMED9_HUMAN	Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	80-UNIMOD:21,72-UNIMOD:28,85-UNIMOD:35	0.11	28.0	8	1	0
PRT	sp|O95197|RTN3_HUMAN	Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	246-UNIMOD:21,227-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	317-UNIMOD:21,505-UNIMOD:21	0.08	28.0	6	4	3
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	25-UNIMOD:21,38-UNIMOD:21,16-UNIMOD:21	0.26	28.0	21	5	2
PRT	sp|Q96DB5|RMD1_HUMAN	Regulator of microtubule dynamics protein 1 OS=Homo sapiens OX=9606 GN=RMDN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	308-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	910-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	231-UNIMOD:21,277-UNIMOD:21	0.19	28.0	2	2	2
PRT	sp|Q9Y5Y0|FLVC1_HUMAN	Feline leukemia virus subgroup C receptor-related protein 1 OS=Homo sapiens OX=9606 GN=FLVCR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	61-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	226-UNIMOD:21,722-UNIMOD:21,708-UNIMOD:28	0.05	28.0	4	2	0
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	309-UNIMOD:4,320-UNIMOD:21,323-UNIMOD:21,232-UNIMOD:21,234-UNIMOD:4	0.03	28.0	3	2	1
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,11-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	112-UNIMOD:21,101-UNIMOD:21	0.06	27.0	3	2	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	257-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	66-UNIMOD:21,37-UNIMOD:21,551-UNIMOD:21,633-UNIMOD:21,631-UNIMOD:21,41-UNIMOD:21,45-UNIMOD:21,38-UNIMOD:21	0.13	27.0	9	6	4
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	161-UNIMOD:4,32-UNIMOD:21	0.27	27.0	4	4	4
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	199-UNIMOD:21,200-UNIMOD:21	0.11	27.0	2	1	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	9-UNIMOD:21,7-UNIMOD:21	0.17	27.0	5	2	0
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	6-UNIMOD:21,368-UNIMOD:21,338-UNIMOD:21	0.13	27.0	3	3	3
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	11-UNIMOD:4,22-UNIMOD:21,25-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	475-UNIMOD:21,480-UNIMOD:35	0.03	27.0	2	1	0
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	286-UNIMOD:21,259-UNIMOD:21	0.06	27.0	5	3	2
PRT	sp|Q9NZT2|OGFR_HUMAN	Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	403-UNIMOD:21,315-UNIMOD:21,484-UNIMOD:21,378-UNIMOD:21,674-UNIMOD:21	0.17	27.0	5	5	5
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	201-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	294-UNIMOD:21,304-UNIMOD:21,301-UNIMOD:21,303-UNIMOD:21,296-UNIMOD:21	0.06	27.0	6	1	0
PRT	sp|Q92879|CELF1_HUMAN	CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	168-UNIMOD:35,177-UNIMOD:4,178-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	143-UNIMOD:21,146-UNIMOD:21,311-UNIMOD:21,308-UNIMOD:21	0.05	27.0	6	2	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	223-UNIMOD:21,227-UNIMOD:21,129-UNIMOD:21,142-UNIMOD:21,211-UNIMOD:21,326-UNIMOD:21	0.06	27.0	5	5	5
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	108-UNIMOD:4,118-UNIMOD:21	0.04	27.0	4	2	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	344-UNIMOD:21,382-UNIMOD:35,387-UNIMOD:21,395-UNIMOD:21,370-UNIMOD:21	0.13	27.0	7	4	2
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	320-UNIMOD:21,162-UNIMOD:21,164-UNIMOD:4,168-UNIMOD:21,303-UNIMOD:21	0.16	27.0	6	4	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	212-UNIMOD:21,205-UNIMOD:21,87-UNIMOD:21,94-UNIMOD:21	0.06	27.0	6	4	2
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	297-UNIMOD:21,300-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	172-UNIMOD:21,166-UNIMOD:21,164-UNIMOD:35	0.03	27.0	10	1	0
PRT	sp|Q9NVS9|PNPO_HUMAN	Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	241-UNIMOD:21,247-UNIMOD:21	0.10	27.0	1	1	1
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	426-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	666-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	111-UNIMOD:21,594-UNIMOD:21	0.03	27.0	5	2	0
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	445-UNIMOD:21,450-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	33-UNIMOD:21,38-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	104-UNIMOD:21	0.16	27.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	9-UNIMOD:21,26-UNIMOD:21,15-UNIMOD:21	0.06	27.0	3	2	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	680-UNIMOD:4,688-UNIMOD:21,692-UNIMOD:4,737-UNIMOD:21,744-UNIMOD:4,547-UNIMOD:21,898-UNIMOD:21,883-UNIMOD:21	0.06	27.0	9	6	3
PRT	sp|P50542|PEX5_HUMAN	Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	317-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	1-UNIMOD:1,14-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	211-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q86TS9|RM52_HUMAN	39S ribosomal protein L52, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	118-UNIMOD:21	0.10	26.0	4	1	0
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	35-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	504-UNIMOD:4,509-UNIMOD:21	0.02	26.0	3	1	0
PRT	sp|O00115|DNS2A_HUMAN	Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	70-UNIMOD:21	0.04	26.0	4	1	0
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	856-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	96-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	455-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	158-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	163-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	492-UNIMOD:21,534-UNIMOD:21,537-UNIMOD:21,442-UNIMOD:4,444-UNIMOD:21,532-UNIMOD:21	0.09	26.0	6	3	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1267-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	64-UNIMOD:21,17-UNIMOD:21,79-UNIMOD:21	0.57	26.0	5	3	2
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	160-UNIMOD:21	0.08	26.0	2	1	0
PRT	sp|Q9ULH7|MRTFB_HUMAN	Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	921-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1299-UNIMOD:21,1302-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	90-UNIMOD:21,128-UNIMOD:21,187-UNIMOD:21	0.17	26.0	5	3	2
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	30-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	290-UNIMOD:21,297-UNIMOD:4,303-UNIMOD:21,258-UNIMOD:21,221-UNIMOD:21,110-UNIMOD:21,108-UNIMOD:21,350-UNIMOD:21,293-UNIMOD:21	0.16	26.0	8	5	3
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	143-UNIMOD:21,147-UNIMOD:21,270-UNIMOD:21,276-UNIMOD:21	0.15	26.0	3	2	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	468-UNIMOD:21,412-UNIMOD:4,462-UNIMOD:21,467-UNIMOD:21	0.08	26.0	7	4	3
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	745-UNIMOD:21,747-UNIMOD:4,756-UNIMOD:21,743-UNIMOD:28,395-UNIMOD:21	0.04	26.0	3	2	1
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	120-UNIMOD:21,135-UNIMOD:21,122-UNIMOD:21,134-UNIMOD:21	0.05	26.0	4	3	2
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	303-UNIMOD:21,308-UNIMOD:21,179-UNIMOD:21,182-UNIMOD:21,259-UNIMOD:21,267-UNIMOD:21,270-UNIMOD:21,344-UNIMOD:21,274-UNIMOD:21	0.15	26.0	11	5	1
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	308-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	2-UNIMOD:1,16-UNIMOD:21,255-UNIMOD:35	0.14	26.0	4	2	0
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	229-UNIMOD:4,237-UNIMOD:21,239-UNIMOD:21,243-UNIMOD:21	0.13	26.0	3	1	0
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	115-UNIMOD:21,119-UNIMOD:21	0.08	25.0	2	2	2
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	576-UNIMOD:4,584-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	370-UNIMOD:21,410-UNIMOD:21,408-UNIMOD:21	0.09	25.0	7	5	3
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	400-UNIMOD:21,575-UNIMOD:21	0.06	25.0	3	2	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	104-UNIMOD:21,232-UNIMOD:4,234-UNIMOD:21	0.10	25.0	5	3	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	40-UNIMOD:21,33-UNIMOD:35,41-UNIMOD:21,94-UNIMOD:21,165-UNIMOD:21	0.20	25.0	11	4	2
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	972-UNIMOD:4,974-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q86W56|PARG_HUMAN	Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	137-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	863-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	623-UNIMOD:21,1023-UNIMOD:21,1027-UNIMOD:4,1034-UNIMOD:21,612-UNIMOD:21,618-UNIMOD:21,1028-UNIMOD:21	0.03	25.0	9	3	0
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	149-UNIMOD:21,153-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	363-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q9C0E8|LNP_HUMAN	Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	179-UNIMOD:21,194-UNIMOD:21	0.06	25.0	4	1	0
PRT	sp|O14908|GIPC1_HUMAN	PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	258-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	198-UNIMOD:21,1231-UNIMOD:21,197-UNIMOD:35,1117-UNIMOD:21	0.03	25.0	11	4	2
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	210-UNIMOD:21,215-UNIMOD:4	0.01	25.0	2	1	0
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	129-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	229-UNIMOD:21	0.02	25.0	5	2	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	221-UNIMOD:21,220-UNIMOD:21,242-UNIMOD:21	0.18	25.0	8	3	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	186-UNIMOD:35,193-UNIMOD:21,190-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1112-UNIMOD:21,1057-UNIMOD:21,1064-UNIMOD:21,1065-UNIMOD:4,334-UNIMOD:21,338-UNIMOD:21,614-UNIMOD:21,619-UNIMOD:21,1059-UNIMOD:21,1461-UNIMOD:21,678-UNIMOD:4,681-UNIMOD:4,687-UNIMOD:21	0.06	25.0	7	6	5
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	52-UNIMOD:21,42-UNIMOD:21,185-UNIMOD:21	0.18	25.0	5	3	2
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	133-UNIMOD:21,137-UNIMOD:21,132-UNIMOD:21	0.04	25.0	4	1	0
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	9-UNIMOD:21	0.15	25.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	2155-UNIMOD:21,363-UNIMOD:21	0.01	25.0	3	2	1
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	8-UNIMOD:4,12-UNIMOD:21,17-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	412-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q7Z5J4|RAI1_HUMAN	Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	683-UNIMOD:21,696-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	70-UNIMOD:21,76-UNIMOD:21,87-UNIMOD:21	0.12	24.0	5	2	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	427-UNIMOD:4,431-UNIMOD:21,308-UNIMOD:21,307-UNIMOD:21,310-UNIMOD:21	0.07	24.0	6	3	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	173-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	626-UNIMOD:21,621-UNIMOD:21,620-UNIMOD:21	0.03	24.0	7	1	0
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	460-UNIMOD:21,463-UNIMOD:21	0.03	24.0	7	1	0
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	567-UNIMOD:21,110-UNIMOD:21,113-UNIMOD:21,306-UNIMOD:21,120-UNIMOD:21,126-UNIMOD:21,109-UNIMOD:21,183-UNIMOD:21,187-UNIMOD:21	0.11	24.0	9	5	2
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	460-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	9-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	106-UNIMOD:21,108-UNIMOD:4,302-UNIMOD:21,85-UNIMOD:21,83-UNIMOD:21	0.10	24.0	5	3	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1094-UNIMOD:21,1288-UNIMOD:21,1290-UNIMOD:21,1088-UNIMOD:35	0.03	24.0	4	2	1
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	97-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	24.0	null	226-UNIMOD:21,159-UNIMOD:21	0.09	24.0	2	2	2
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	313-UNIMOD:21,269-UNIMOD:21,283-UNIMOD:4	0.15	24.0	2	2	2
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	120-UNIMOD:21	0.06	24.0	2	1	0
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	432-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	232-UNIMOD:21,172-UNIMOD:21,176-UNIMOD:21	0.10	24.0	2	2	2
PRT	sp|Q9BVS4|RIOK2_HUMAN	Serine/threonine-protein kinase RIO2 OS=Homo sapiens OX=9606 GN=RIOK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	543-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	650-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	7-UNIMOD:21	0.18	24.0	2	2	2
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	112-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	552-UNIMOD:21,223-UNIMOD:21,235-UNIMOD:4,177-UNIMOD:21	0.03	24.0	4	3	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	643-UNIMOD:21,645-UNIMOD:4,552-UNIMOD:21,169-UNIMOD:21	0.07	24.0	5	4	3
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	97-UNIMOD:21,100-UNIMOD:4	0.08	24.0	2	1	0
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	219-UNIMOD:21	0.05	24.0	6	3	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1203-UNIMOD:21,1211-UNIMOD:21,1208-UNIMOD:21	0.02	24.0	5	1	0
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	159-UNIMOD:21,161-UNIMOD:4,57-UNIMOD:21,65-UNIMOD:4,160-UNIMOD:21	0.09	24.0	4	2	1
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	52-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	142-UNIMOD:21,148-UNIMOD:21,143-UNIMOD:21	0.06	24.0	2	1	0
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	22-UNIMOD:21,7-UNIMOD:28,20-UNIMOD:21	0.02	24.0	5	1	0
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	51-UNIMOD:21,44-UNIMOD:21	0.08	24.0	4	1	0
PRT	sp|Q9UBV2|SE1L1_HUMAN	Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	96-UNIMOD:21	0.03	24.0	3	1	0
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,15-UNIMOD:21,22-UNIMOD:4,9-UNIMOD:21,73-UNIMOD:4,75-UNIMOD:21,76-UNIMOD:21	0.30	24.0	4	2	0
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1	0.18	24.0	2	2	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,14-UNIMOD:21,761-UNIMOD:21,765-UNIMOD:21,757-UNIMOD:35	0.04	24.0	3	2	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	598-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	234-UNIMOD:21,232-UNIMOD:21,388-UNIMOD:21	0.11	23.0	4	3	2
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	81-UNIMOD:21,216-UNIMOD:21,284-UNIMOD:21,283-UNIMOD:35	0.09	23.0	5	3	2
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	989-UNIMOD:21,1000-UNIMOD:21,1013-UNIMOD:21,1011-UNIMOD:21	0.03	23.0	3	3	3
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	999-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	161-UNIMOD:21,163-UNIMOD:4,167-UNIMOD:21	0.05	23.0	3	3	3
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	160-UNIMOD:21	0.07	23.0	4	2	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	428-UNIMOD:21,472-UNIMOD:21,425-UNIMOD:35	0.09	23.0	4	2	0
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	189-UNIMOD:21,193-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	474-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	36-UNIMOD:21,9-UNIMOD:21,39-UNIMOD:21,37-UNIMOD:21	0.08	23.0	5	2	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	234-UNIMOD:4,835-UNIMOD:21,233-UNIMOD:21	0.03	23.0	4	2	0
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	172-UNIMOD:21,174-UNIMOD:21	0.10	23.0	2	1	0
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	792-UNIMOD:21,1974-UNIMOD:21,2105-UNIMOD:21,776-UNIMOD:35,779-UNIMOD:21	0.02	23.0	4	4	4
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	118-UNIMOD:21,427-UNIMOD:21,432-UNIMOD:21	0.05	23.0	3	2	1
PRT	sp|O75381|PEX14_HUMAN	Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	262-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	47-UNIMOD:21	0.10	23.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	36-UNIMOD:21,53-UNIMOD:21,39-UNIMOD:21	0.43	23.0	6	3	2
PRT	sp|O15439|MRP4_HUMAN	Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	646-UNIMOD:21	0.01	23.0	3	2	1
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	35-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	221-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	184-UNIMOD:21,189-UNIMOD:21	0.06	23.0	3	1	0
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	23.0	null	830-UNIMOD:4,837-UNIMOD:4,838-UNIMOD:21,842-UNIMOD:4,848-UNIMOD:4,1060-UNIMOD:4,1067-UNIMOD:4,1068-UNIMOD:21,1072-UNIMOD:4	0.02	23.0	3	2	1
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	430-UNIMOD:21,436-UNIMOD:21,437-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	827-UNIMOD:21,831-UNIMOD:21,2198-UNIMOD:21,2202-UNIMOD:4,207-UNIMOD:21,212-UNIMOD:4	0.02	23.0	5	3	2
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	244-UNIMOD:21,249-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	117-UNIMOD:21,131-UNIMOD:4,99-UNIMOD:4,104-UNIMOD:4,115-UNIMOD:21	0.09	23.0	3	2	1
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	647-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	47-UNIMOD:21,221-UNIMOD:21	0.15	23.0	4	2	1
PRT	sp|Q7Z434-4|MAVS_HUMAN	Isoform 4 of Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	11-UNIMOD:21,24-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	81-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	385-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1721-UNIMOD:21,1727-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q53H80|AKIR2_HUMAN	Akirin-2 OS=Homo sapiens OX=9606 GN=AKIRIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	18-UNIMOD:21,21-UNIMOD:21	0.08	23.0	2	1	0
PRT	sp|O95071|UBR5_HUMAN	E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	110-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	487-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	235-UNIMOD:21,238-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1012-UNIMOD:4,1014-UNIMOD:21,98-UNIMOD:21	0.04	23.0	3	2	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	2-UNIMOD:1,6-UNIMOD:21,9-UNIMOD:21	0.16	23.0	2	2	2
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	1-UNIMOD:1,9-UNIMOD:21,1-UNIMOD:35	0.04	23.0	3	1	0
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	224-UNIMOD:21	0.06	23.0	2	1	0
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,8-UNIMOD:21,15-UNIMOD:4	0.07	23.0	2	1	0
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	233-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	65-UNIMOD:21,68-UNIMOD:21,63-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	82-UNIMOD:21,80-UNIMOD:28,83-UNIMOD:21,174-UNIMOD:21,184-UNIMOD:21	0.14	22.0	7	2	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	795-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	85-UNIMOD:21,19-UNIMOD:21,20-UNIMOD:35,21-UNIMOD:21	0.11	22.0	4	3	2
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	303-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	265-UNIMOD:21,281-UNIMOD:21	0.07	22.0	3	2	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	87-UNIMOD:21,98-UNIMOD:21,101-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	56-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	490-UNIMOD:4,493-UNIMOD:21,715-UNIMOD:4,718-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1505-UNIMOD:21,2501-UNIMOD:4,2503-UNIMOD:21	0.01	22.0	3	2	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	540-UNIMOD:4,546-UNIMOD:21,551-UNIMOD:21,560-UNIMOD:21,565-UNIMOD:21,542-UNIMOD:21,458-UNIMOD:21,554-UNIMOD:21	0.07	22.0	5	3	2
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	104-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	66-UNIMOD:21,163-UNIMOD:21	0.09	22.0	5	4	3
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	721-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	249-UNIMOD:21,613-UNIMOD:21,615-UNIMOD:21,903-UNIMOD:21	0.05	22.0	3	3	3
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	248-UNIMOD:21,253-UNIMOD:21,243-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|Q15629|TRAM1_HUMAN	Translocating chain-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=TRAM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	365-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	317-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	643-UNIMOD:4,658-UNIMOD:21,1237-UNIMOD:21,643-UNIMOD:385	0.02	22.0	4	2	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	16-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2042-UNIMOD:21,2045-UNIMOD:21,2041-UNIMOD:21,2044-UNIMOD:21	0.01	22.0	3	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2805-UNIMOD:21,2628-UNIMOD:21,1894-UNIMOD:21,1144-UNIMOD:21,1890-UNIMOD:21,1760-UNIMOD:21,2810-UNIMOD:21	0.03	22.0	7	5	3
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	57-UNIMOD:21	0.12	22.0	3	1	0
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	118-UNIMOD:4,124-UNIMOD:21,644-UNIMOD:21,811-UNIMOD:4,813-UNIMOD:21,818-UNIMOD:21	0.04	22.0	4	3	2
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	286-UNIMOD:21,287-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	103-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	333-UNIMOD:21	0.03	22.0	3	1	0
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	111-UNIMOD:21,120-UNIMOD:4,107-UNIMOD:28	0.03	22.0	4	1	0
PRT	sp|Q96T76|MMS19_HUMAN	MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1027-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	128-UNIMOD:21,127-UNIMOD:21	0.09	22.0	2	1	0
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	34-UNIMOD:21,30-UNIMOD:21	0.03	22.0	4	1	0
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	55-UNIMOD:21,60-UNIMOD:4,67-UNIMOD:4,438-UNIMOD:21	0.06	22.0	2	2	2
PRT	sp|P51148|RAB5C_HUMAN	Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	124-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q15155|NOMO1_HUMAN	Nodal modulator 1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	825-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	114-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	253-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	321-UNIMOD:4,329-UNIMOD:21,331-UNIMOD:4,448-UNIMOD:4,458-UNIMOD:21,136-UNIMOD:4,138-UNIMOD:21	0.11	22.0	3	3	3
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	314-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	328-UNIMOD:35,330-UNIMOD:21,168-UNIMOD:21	0.11	22.0	3	2	1
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	88-UNIMOD:21,277-UNIMOD:21	0.10	22.0	2	2	2
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	248-UNIMOD:21	0.10	22.0	2	1	0
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	461-UNIMOD:21,473-UNIMOD:21,462-UNIMOD:21	0.05	22.0	3	1	0
PRT	sp|Q13409-2|DC1I2_HUMAN	Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	66-UNIMOD:21,81-UNIMOD:21,73-UNIMOD:21,80-UNIMOD:35,84-UNIMOD:21,83-UNIMOD:21	0.04	22.0	3	1	0
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	2-UNIMOD:1,8-UNIMOD:21,302-UNIMOD:21,80-UNIMOD:21,82-UNIMOD:21	0.09	22.0	6	3	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	157-UNIMOD:21,159-UNIMOD:4	0.03	21.0	2	1	0
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	94-UNIMOD:21,93-UNIMOD:21,87-UNIMOD:21,90-UNIMOD:21	0.06	21.0	6	2	0
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	146-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	441-UNIMOD:4,445-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	53-UNIMOD:4,154-UNIMOD:21	0.13	21.0	2	2	2
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	488-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1290-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	412-UNIMOD:4,417-UNIMOD:21,420-UNIMOD:21,90-UNIMOD:21,91-UNIMOD:4	0.06	21.0	3	3	3
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	460-UNIMOD:21,456-UNIMOD:4	0.03	21.0	2	2	2
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	226-UNIMOD:21,276-UNIMOD:21,292-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	460-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1414-UNIMOD:21,395-UNIMOD:4,398-UNIMOD:4,400-UNIMOD:4,405-UNIMOD:21,410-UNIMOD:4	0.03	21.0	2	2	2
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1757-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	154-UNIMOD:21	0.03	21.0	3	1	0
PRT	sp|Q9BUL5|PHF23_HUMAN	PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	126-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	436-UNIMOD:21,439-UNIMOD:4,420-UNIMOD:21,428-UNIMOD:21,416-UNIMOD:21,422-UNIMOD:21	0.04	21.0	4	2	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	211-UNIMOD:4,216-UNIMOD:21	0.04	21.0	3	2	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	21.0	2	2	2
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	293-UNIMOD:21	0.05	21.0	3	2	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	384-UNIMOD:21,382-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	105-UNIMOD:4,34-UNIMOD:21,35-UNIMOD:21	0.08	21.0	7	3	2
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	692-UNIMOD:21,181-UNIMOD:21	0.06	21.0	2	2	2
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	296-UNIMOD:35,301-UNIMOD:21,299-UNIMOD:21	0.01	21.0	4	1	0
PRT	sp|Q6UW78|UQCC3_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	92-UNIMOD:21,81-UNIMOD:35	0.17	21.0	2	1	0
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	422-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	87-UNIMOD:4,96-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	19-UNIMOD:21,23-UNIMOD:21,20-UNIMOD:21	0.03	21.0	4	2	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	559-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	559-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	95-UNIMOD:21,99-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	17-UNIMOD:21	0.21	21.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	583-UNIMOD:21	0.09	21.0	3	3	3
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	516-UNIMOD:21,513-UNIMOD:21,518-UNIMOD:21	0.04	21.0	4	2	1
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	209-UNIMOD:21,219-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	60-UNIMOD:21,64-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	35-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	890-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:21	0.08	21.0	2	1	0
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	563-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	325-UNIMOD:21,563-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	256-UNIMOD:4,258-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.13	21.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	26-UNIMOD:21,30-UNIMOD:21,370-UNIMOD:21	0.05	21.0	3	2	1
PRT	sp|Q9BZH6|WDR11_HUMAN	WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=WDR11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1216-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	85-UNIMOD:21	0.11	21.0	2	1	0
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	352-UNIMOD:21,364-UNIMOD:35	0.05	21.0	2	1	0
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	462-UNIMOD:21,469-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|O15400|STX7_HUMAN	Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,4-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,24-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q93015-2|NAA80_HUMAN	Isoform 2 of N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	1-UNIMOD:1,7-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	566-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1117-UNIMOD:21,964-UNIMOD:21	0.04	20.0	3	2	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	null	30-UNIMOD:21,28-UNIMOD:21	0.08	20.0	2	1	0
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	69-UNIMOD:21	0.09	20.0	2	1	0
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	394-UNIMOD:21,398-UNIMOD:21	0.04	20.0	2	2	2
PRT	sp|Q8NEZ2|VP37A_HUMAN	Vacuolar protein sorting-associated protein 37A OS=Homo sapiens OX=9606 GN=VPS37A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	129-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	244-UNIMOD:21,240-UNIMOD:21	0.03	20.0	3	1	0
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	50-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	263-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2728-UNIMOD:21,1294-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|Q9UM00|TMCO1_HUMAN	Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	235-UNIMOD:21,224-UNIMOD:28	0.06	20.0	4	1	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1268-UNIMOD:21,399-UNIMOD:21,1264-UNIMOD:21,1255-UNIMOD:21	0.04	20.0	7	3	1
PRT	sp|P18827|SDC1_HUMAN	Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	233-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	738-UNIMOD:21,734-UNIMOD:21	0.02	20.0	3	1	0
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	272-UNIMOD:4,273-UNIMOD:21,407-UNIMOD:21,378-UNIMOD:21	0.04	20.0	3	3	3
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1038-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	245-UNIMOD:21,247-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	174-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	206-UNIMOD:4,207-UNIMOD:21,90-UNIMOD:21,88-UNIMOD:35	0.14	20.0	4	2	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2032-UNIMOD:21,2029-UNIMOD:21,1261-UNIMOD:21	0.01	20.0	3	2	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	385-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q86X55|CARM1_HUMAN	Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	463-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O60831|PRAF2_HUMAN	PRA1 family protein 2 OS=Homo sapiens OX=9606 GN=PRAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	19-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	237-UNIMOD:21	0.07	20.0	2	1	0
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	65-UNIMOD:21,71-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	147-UNIMOD:4,151-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	399-UNIMOD:21,401-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|Q96KP4|CNDP2_HUMAN	Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	439-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	315-UNIMOD:21,322-UNIMOD:21	0.02	20.0	3	1	0
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	188-UNIMOD:21,194-UNIMOD:21	0.04	20.0	6	1	0
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	123-UNIMOD:21	0.07	20.0	1	1	1
PRT	sp|P08651|NFIC_HUMAN	Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	323-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	275-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	169-UNIMOD:21	0.11	20.0	2	1	0
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	285-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	149-UNIMOD:21	0.08	20.0	2	1	0
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2054-UNIMOD:21,2058-UNIMOD:21,939-UNIMOD:21,946-UNIMOD:21	0.02	20.0	2	2	2
PRT	sp|O60664|PLIN3_HUMAN	Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	91-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	46-UNIMOD:21,186-UNIMOD:21	0.07	19.0	2	2	2
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	568-UNIMOD:21,573-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	138-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	2	2	2
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	93-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1314-UNIMOD:21,1316-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	27-UNIMOD:21	0.07	19.0	2	1	0
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	170-UNIMOD:4,178-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	181-UNIMOD:21,186-UNIMOD:21,167-UNIMOD:28	0.04	19.0	3	1	0
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	178-UNIMOD:21,181-UNIMOD:21	0.00	19.0	4	1	0
PRT	sp|Q86TM6|SYVN1_HUMAN	E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	613-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2047-UNIMOD:21	0.00	19.0	2	2	2
PRT	sp|Q6VMQ6|MCAF1_HUMAN	Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	109-UNIMOD:4,113-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	71-UNIMOD:35,77-UNIMOD:21,81-UNIMOD:21	0.08	19.0	3	1	0
PRT	sp|P07711|CATL1_HUMAN	Cathepsin L1 OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	322-UNIMOD:4,326-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	774-UNIMOD:21,517-UNIMOD:21,521-UNIMOD:21,526-UNIMOD:21	0.04	19.0	4	3	2
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	203-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	19.0	null	534-UNIMOD:21,435-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	444-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	69-UNIMOD:21,71-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	121-UNIMOD:4,128-UNIMOD:4,129-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	147-UNIMOD:21	0.13	19.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	107-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	789-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	179-UNIMOD:35,189-UNIMOD:21,194-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1079-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|O60333|KIF1B_HUMAN	Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	647-UNIMOD:21,654-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	315-UNIMOD:21,322-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	138-UNIMOD:21	0.10	19.0	2	1	0
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	177-UNIMOD:21,44-UNIMOD:21,47-UNIMOD:4	0.18	19.0	3	2	1
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	104-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q01201|RELB_HUMAN	Transcription factor RelB OS=Homo sapiens OX=9606 GN=RELB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	573-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	292-UNIMOD:4,304-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P54750|PDE1A_HUMAN	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	480-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	456-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1430-UNIMOD:21,509-UNIMOD:21,513-UNIMOD:4,1114-UNIMOD:21	0.03	19.0	3	3	3
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	89-UNIMOD:21	0.17	19.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q8IXK0|PHC2_HUMAN	Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	740-UNIMOD:4,751-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	294-UNIMOD:21,301-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	481-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	89-UNIMOD:21,92-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	49-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	955-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	13-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1256-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	819-UNIMOD:21,823-UNIMOD:21,822-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|O14910|LIN7A_HUMAN	Protein lin-7 homolog A OS=Homo sapiens OX=9606 GN=LIN7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	130-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P40763|STAT3_HUMAN	Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	687-UNIMOD:4,701-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1915-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	317-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|Q96BD0|SO4A1_HUMAN	Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	40-UNIMOD:21,37-UNIMOD:21,34-UNIMOD:21	0.02	18.0	4	1	0
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	294-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	731-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q8N357|S35F6_HUMAN	Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	363-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P49069|CAMLG_HUMAN	Calcium signal-modulating cyclophilin ligand OS=Homo sapiens OX=9606 GN=CAMLG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	140-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	29-UNIMOD:21,32-UNIMOD:21,46-UNIMOD:21,76-UNIMOD:21,80-UNIMOD:4	0.15	18.0	3	2	1
PRT	sp|Q5R3I4|TTC38_HUMAN	Tetratricopeptide repeat protein 38 OS=Homo sapiens OX=9606 GN=TTC38 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	452-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	194-UNIMOD:21,40-UNIMOD:21	0.19	18.0	2	2	2
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	109-UNIMOD:21,112-UNIMOD:4	0.03	18.0	2	1	0
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	619-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	1149-UNIMOD:21,842-UNIMOD:4,843-UNIMOD:21,853-UNIMOD:21,844-UNIMOD:21,841-UNIMOD:35	0.02	18.0	4	2	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	62-UNIMOD:4,65-UNIMOD:21,60-UNIMOD:35	0.11	18.0	2	1	0
PRT	sp|Q96HC4|PDLI5_HUMAN	PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	111-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P04920|B3A2_HUMAN	Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	115-UNIMOD:21,173-UNIMOD:21,120-UNIMOD:21,113-UNIMOD:21	0.04	18.0	5	2	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	538-UNIMOD:21,822-UNIMOD:21,779-UNIMOD:4,780-UNIMOD:21	0.10	18.0	4	3	2
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	523-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	213-UNIMOD:21,217-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	498-UNIMOD:21,786-UNIMOD:21	0.02	18.0	2	2	2
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	18.0	3	2	1
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	719-UNIMOD:21,635-UNIMOD:21,641-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|O00161|SNP23_HUMAN	Synaptosomal-associated protein 23 OS=Homo sapiens OX=9606 GN=SNAP23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	110-UNIMOD:21,112-UNIMOD:4	0.09	18.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	22-UNIMOD:21	0.06	18.0	2	1	0
PRT	sp|Q9NVA1|UQCC1_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens OX=9606 GN=UQCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	294-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.18	18.0	2	1	0
PRT	sp|Q9HDC9|APMAP_HUMAN	Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	190-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	669-UNIMOD:4,670-UNIMOD:21,681-UNIMOD:21,262-UNIMOD:21	0.03	18.0	3	2	1
PRT	sp|O60499|STX10_HUMAN	Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	108-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	102-UNIMOD:21,225-UNIMOD:21	0.26	18.0	4	2	0
PRT	sp|Q96Q45|TM237_HUMAN	Transmembrane protein 237 OS=Homo sapiens OX=9606 GN=TMEM237 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	47-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.13	18.0	1	1	1
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	257-UNIMOD:21,361-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	309-UNIMOD:4,344-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q96KB5|TOPK_HUMAN	Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	22-UNIMOD:4,23-UNIMOD:21,32-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|A6NKF1|SAC31_HUMAN	SAC3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SAC3D1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	402-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	390-UNIMOD:21,662-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	18.0	null	36-UNIMOD:385,36-UNIMOD:4,38-UNIMOD:21	0.06	18.0	3	1	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,10-UNIMOD:21,8-UNIMOD:21	0.14	18.0	3	1	0
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,9-UNIMOD:21	0.19	18.0	1	1	1
PRT	sp|Q9Y6Y0|NS1BP_HUMAN	Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	270-UNIMOD:21,274-UNIMOD:4,284-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	302-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q9HCH0|NCK5L_HUMAN	Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	763-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	305-UNIMOD:21,311-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	106-UNIMOD:21,108-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	119-UNIMOD:21	0.09	17.0	2	1	0
PRT	sp|Q2M2I8|AAK1_HUMAN	AP2-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=AAK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	624-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	46-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|O75947|ATP5H_HUMAN	ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	39-UNIMOD:21,100-UNIMOD:21,101-UNIMOD:4	0.16	17.0	2	2	2
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	754-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	809-UNIMOD:21,557-UNIMOD:21,562-UNIMOD:21	0.06	17.0	4	3	2
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	55-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	461-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	616-UNIMOD:21,613-UNIMOD:35,586-UNIMOD:21	0.05	17.0	3	2	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	70-UNIMOD:21	0.10	17.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	144-UNIMOD:21	0.09	17.0	1	1	1
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	62-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	78-UNIMOD:21	0.17	17.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	137-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	255-UNIMOD:21,688-UNIMOD:21	0.04	17.0	3	2	1
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	465-UNIMOD:21,11-UNIMOD:21,17-UNIMOD:21	0.05	17.0	2	2	2
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	38-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	73-UNIMOD:21,36-UNIMOD:21,45-UNIMOD:21	0.13	17.0	2	2	2
PRT	sp|Q8TAP8|PPR35_HUMAN	Protein phosphatase 1 regulatory subunit 35 OS=Homo sapiens OX=9606 GN=PPP1R35 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	45-UNIMOD:21,52-UNIMOD:21	0.09	17.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	900-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	369-UNIMOD:4,387-UNIMOD:21,388-UNIMOD:4,591-UNIMOD:4,593-UNIMOD:21,779-UNIMOD:21	0.08	17.0	3	3	3
PRT	sp|O43242|PSMD3_HUMAN	26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PSMD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	430-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q8WUD4|CCD12_HUMAN	Coiled-coil domain-containing protein 12 OS=Homo sapiens OX=9606 GN=CCDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	152-UNIMOD:21	0.11	17.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	186-UNIMOD:21	0.03	17.0	2	1	0
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	192-UNIMOD:21	0.05	17.0	2	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	128-UNIMOD:21,140-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P84095|RHOG_HUMAN	Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	44-UNIMOD:21,138-UNIMOD:21	0.20	17.0	2	2	2
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	617-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	191-UNIMOD:21,198-UNIMOD:21,100-UNIMOD:21	0.07	17.0	3	3	3
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	106-UNIMOD:21	0.02	17.0	2	2	2
PRT	sp|Q9Y281|COF2_HUMAN	Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,3-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|Q8N1Q1|CAH13_HUMAN	Carbonic anhydrase 13 OS=Homo sapiens OX=9606 GN=CA13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	30-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q05397|FAK1_HUMAN	Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	910-UNIMOD:21,914-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	654-UNIMOD:4,656-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O00429-2|DNM1L_HUMAN	Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	574-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	173-UNIMOD:4,181-UNIMOD:21	0.16	16.0	2	2	2
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:35,264-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.08	16.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	413-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	270-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	433-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	426-UNIMOD:4,434-UNIMOD:21,71-UNIMOD:21	0.03	16.0	2	2	2
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	248-UNIMOD:21	0.07	16.0	3	2	1
PRT	sp|P42892|ECE1_HUMAN	Endothelin-converting enzyme 1 OS=Homo sapiens OX=9606 GN=ECE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	733-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	52-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	150-UNIMOD:21,21-UNIMOD:21	0.11	16.0	2	2	2
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	246-UNIMOD:21,249-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	238-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	22-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q99081|HTF4_HUMAN	Transcription factor 12 OS=Homo sapiens OX=9606 GN=TCF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	67-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q16875|F263_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	467-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	149-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1277-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	203-UNIMOD:4,210-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	201-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P05997|CO5A2_HUMAN	Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1284-UNIMOD:21,1277-UNIMOD:21	0.01	16.0	2	1	0
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	92-UNIMOD:21,103-UNIMOD:21	0.02	16.0	2	1	0
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	630-UNIMOD:21,2-UNIMOD:1,11-UNIMOD:21	0.09	16.0	2	2	2
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	549-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q9P270|SLAI2_HUMAN	SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	147-UNIMOD:21,152-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	341-UNIMOD:21,344-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1670-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	4521-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	62-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	239-UNIMOD:21,241-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1697-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	115-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q6XQN6|PNCB_HUMAN	Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	533-UNIMOD:4,537-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	209-UNIMOD:4,226-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q5TDH0|DDI2_HUMAN	Protein DDI1 homolog 2 OS=Homo sapiens OX=9606 GN=DDI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	104-UNIMOD:21,106-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	411-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	2249-UNIMOD:4,2260-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q9BQP7|MGME1_HUMAN	Mitochondrial genome maintenance exonuclease 1 OS=Homo sapiens OX=9606 GN=MGME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	68-UNIMOD:21,79-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	654-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	75-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:4,9-UNIMOD:21	0.18	16.0	2	2	2
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,12-UNIMOD:21	0.01	16.0	2	1	0
PRT	sp|Q9NSI2|F207A_HUMAN	Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	34-UNIMOD:21,39-UNIMOD:21	0.11	16.0	1	1	1
PRT	sp|Q05209|PTN12_HUMAN	Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	573-UNIMOD:21,578-UNIMOD:21,588-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P41162|ETV3_HUMAN	ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	16.0	null	409-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	221-UNIMOD:21,226-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|A0FGR8|ESYT2_HUMAN	Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	693-UNIMOD:21,705-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	48-UNIMOD:21,54-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	70-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	293-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	13-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	687-UNIMOD:21,683-UNIMOD:35	0.02	15.0	2	1	0
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	15.0	null	496-UNIMOD:4,498-UNIMOD:4,504-UNIMOD:21,502-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q08357|S20A2_HUMAN	Sodium-dependent phosphate transporter 2 OS=Homo sapiens OX=9606 GN=SLC20A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	268-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P46019|KPB2_HUMAN	Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1046-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9ULL5|PRR12_HUMAN	Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	865-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	362-UNIMOD:35,369-UNIMOD:21,220-UNIMOD:21,249-UNIMOD:21	0.09	15.0	3	3	3
PRT	sp|P78310|CXAR_HUMAN	Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	332-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|O95628|CNOT4_HUMAN	CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	430-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	346-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	404-UNIMOD:35	0.03	15.0	1	1	1
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	212-UNIMOD:21,26-UNIMOD:21	0.14	15.0	2	2	2
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	341-UNIMOD:21,344-UNIMOD:21	0.07	15.0	2	1	0
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	107-UNIMOD:21,110-UNIMOD:21	0.11	15.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	240-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	926-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	214-UNIMOD:21,227-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q6ZW49|PAXI1_HUMAN	PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	235-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q02218|ODO1_HUMAN	2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	95-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	133-UNIMOD:21	0.22	15.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	359-UNIMOD:4,361-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	119-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	11-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	350-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	155-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|O14979|HNRDL_HUMAN	Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	241-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q14012|KCC1A_HUMAN	Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	354-UNIMOD:4,355-UNIMOD:4,363-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1027-UNIMOD:21	0.01	15.0	2	2	2
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	215-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q96QU8|XPO6_HUMAN	Exportin-6 OS=Homo sapiens OX=9606 GN=XPO6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	204-UNIMOD:21,214-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,7-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	151-UNIMOD:21	0.13	15.0	1	1	1
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,9-UNIMOD:21,24-UNIMOD:4	0.06	15.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1469-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q9H7E9|CH033_HUMAN	UPF0488 protein C8orf33 OS=Homo sapiens OX=9606 GN=C8orf33 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,19-UNIMOD:21,21-UNIMOD:4	0.10	15.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	275-UNIMOD:35,281-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|P10586|PTPRF_HUMAN	Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1000-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1492-UNIMOD:21	0.02	15.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	90-UNIMOD:21	0.12	15.0	1	1	1
PRT	sp|O75398|DEAF1_HUMAN	Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	501-UNIMOD:27,504-UNIMOD:4,507-UNIMOD:4,513-UNIMOD:21,515-UNIMOD:4,518-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|Q9NXH9|TRM1_HUMAN	tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	614-UNIMOD:4,620-UNIMOD:4,621-UNIMOD:4,628-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	376-UNIMOD:21,381-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1021-UNIMOD:21,1032-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O14929|HAT1_HUMAN	Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	361-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	139-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|O43678|NDUA2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Homo sapiens OX=9606 GN=NDUFA2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	96-UNIMOD:21	0.11	14.0	1	1	1
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	43-UNIMOD:21	0.09	14.0	1	1	1
PRT	sp|Q9NS87|KIF15_HUMAN	Kinesin-like protein KIF15 OS=Homo sapiens OX=9606 GN=KIF15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1141-UNIMOD:21,1144-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	153-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	321-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q14684|RRP1B_HUMAN	Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	14.0	null	706-UNIMOD:21	0.02	14.0	3	1	0
PRT	sp|P49407|ARRB1_HUMAN	Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	412-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q9NSK0|KLC4_HUMAN	Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	460-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	394-UNIMOD:21,396-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	715-UNIMOD:21	0.02	14.0	2	1	0
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	345-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	141-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	332-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	475-UNIMOD:21,483-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9UHY1|NRBP_HUMAN	Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	525-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	732-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9H2J7|S6A15_HUMAN	Sodium-dependent neutral amino acid transporter B(0)AT2 OS=Homo sapiens OX=9606 GN=SLC6A15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	701-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	327-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	173-UNIMOD:4,182-UNIMOD:21,194-UNIMOD:4	0.10	14.0	1	1	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	293-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q66K74|MAP1S_HUMAN	Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	759-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	266-UNIMOD:21,272-UNIMOD:21,269-UNIMOD:21	0.04	14.0	2	2	2
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	321-UNIMOD:21	0.07	14.0	1	1	1
PRT	sp|O95359|TACC2_HUMAN	Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	2317-UNIMOD:21,2321-UNIMOD:21,2238-UNIMOD:21,2256-UNIMOD:21	0.02	14.0	2	2	2
PRT	sp|Q9Y450|HBS1L_HUMAN	HBS1-like protein OS=Homo sapiens OX=9606 GN=HBS1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	231-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	87-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P63173|RL38_HUMAN	60S ribosomal protein L38 OS=Homo sapiens OX=9606 GN=RPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	14-UNIMOD:21	0.11	14.0	1	1	1
PRT	sp|Q96PU5|NED4L_HUMAN	E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	449-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9UJX2|CDC23_HUMAN	Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	596-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	49-UNIMOD:21,44-UNIMOD:21	0.09	14.0	2	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q8N6H7|ARFG2_HUMAN	ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=ARFGAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	331-UNIMOD:21,334-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	89-UNIMOD:21	0.14	14.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	null	204-UNIMOD:21,211-UNIMOD:21,216-UNIMOD:21	0.10	14.0	1	1	1
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	159-UNIMOD:4,160-UNIMOD:21	0.07	14.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	2222-UNIMOD:21,2226-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	353-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	311-UNIMOD:21,317-UNIMOD:21,326-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q86YP4|P66A_HUMAN	Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	100-UNIMOD:21,114-UNIMOD:21,113-UNIMOD:21	0.03	14.0	2	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	43-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q00587|BORG5_HUMAN	Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	106-UNIMOD:21,113-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	433-UNIMOD:21,435-UNIMOD:21	0.02	14.0	2	1	0
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	627-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1-UNIMOD:1,3-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q15004|PAF15_HUMAN	PCNA-associated factor OS=Homo sapiens OX=9606 GN=PCLAF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	54-UNIMOD:4,58-UNIMOD:21	0.14	14.0	1	1	1
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	453-UNIMOD:4,466-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	237-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q8N8S7|ENAH_HUMAN	Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	481-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	307-UNIMOD:21,309-UNIMOD:4,311-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	62-UNIMOD:4,64-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q92526|TCPW_HUMAN	T-complex protein 1 subunit zeta-2 OS=Homo sapiens OX=9606 GN=CCT6B PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	49-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	62-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	77-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	227-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	409-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	256-UNIMOD:4,258-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.03	13.0	1	1	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	76-UNIMOD:21	0.12	13.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	359-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	97-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	61-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	793-UNIMOD:21,495-UNIMOD:21,505-UNIMOD:21	0.02	13.0	4	2	1
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	668-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	110-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	118-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	268-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	55-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	179-UNIMOD:21,190-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|P35556|FBN2_HUMAN	Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1776-UNIMOD:4,1779-UNIMOD:4,1781-UNIMOD:21,1784-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	490-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1722-UNIMOD:21,3822-UNIMOD:21	0.01	13.0	2	2	2
PRT	sp|O60353|FZD6_HUMAN	Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	615-UNIMOD:4,620-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	136-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	457-UNIMOD:4,462-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	47-UNIMOD:21	0.13	13.0	1	1	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	57-UNIMOD:21,74-UNIMOD:4,76-UNIMOD:4,86-UNIMOD:4	0.11	13.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	220-UNIMOD:21	0.03	13.0	2	1	0
PRT	sp|P49116|NR2C2_HUMAN	Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	219-UNIMOD:21,224-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	780-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	508-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	623-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9BQ52|RNZ2_HUMAN	Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	736-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	1
PRT	sp|Q9UI09|NDUAC_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 OS=Homo sapiens OX=9606 GN=NDUFA12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	141-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	186-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1881-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	39-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	267-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	65-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P49903|SPS1_HUMAN	Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	387-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	425-UNIMOD:21,428-UNIMOD:21,440-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|Q03164|KMT2A_HUMAN	Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	3028-UNIMOD:21,3038-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q9NX14|NDUBB_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	53-UNIMOD:21	0.16	13.0	1	1	1
PRT	sp|Q16537|2A5E_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,7-UNIMOD:21	0.04	13.0	2	2	2
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	1-UNIMOD:1,4-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O14579|COPE_HUMAN	Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	307-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	423-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	155-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q9H4X1|RGCC_HUMAN	Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	97-UNIMOD:21,107-UNIMOD:21	0.15	13.0	1	1	1
PRT	sp|P31629|ZEP2_HUMAN	Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	947-UNIMOD:35,964-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|A0A0B4J2F2|SIK1B_HUMAN	Probable serine/threonine-protein kinase SIK1B OS=Homo sapiens OX=9606 GN=SIK1B PE=3 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	626-UNIMOD:21,634-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O75674|TM1L1_HUMAN	TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	323-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q969G6|RIFK_HUMAN	Riboflavin kinase OS=Homo sapiens OX=9606 GN=RFK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	77-UNIMOD:21,78-UNIMOD:35	0.08	13.0	1	1	1
PRT	sp|Q92854-2|SEM4D_HUMAN	Isoform 2 of Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	677-UNIMOD:4,678-UNIMOD:21,682-UNIMOD:21	0.02	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	52.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3510.5	39.64662	3	2508.0724	2508.0760	M	R	2	32
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	2	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3518.4	39.84813	3	2508.0724	2508.0760	M	R	2	32
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	3	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3508.3	39.58802	4	2508.0751	2508.0760	M	R	2	32
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	4	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3305.6	34.35313	3	2994.251771	2994.261530	K	A	106	138
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	5	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4530.2	61.13065	4	3720.685294	3720.684901	K	G	621	655
PSM	AAAVAAAGAGEPQSPDELLPK	6	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4079.2	54.0404	3	2083.9784	2083.9822	M	G	2	23
PSM	DNLTLWTSDTQGDEAEAGEGGEN	7	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=1.1.3846.2	48.27493	3	2407.981871	2407.988786	R	-	223	246
PSM	LGAGGGSPEKSPSAQELK	8	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2858.4	22.79033	3	1791.842771	1791.840409	R	E	13	31
PSM	AAAVAAAGAGEPQSPDELLPK	9	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4069.3	53.81633	3	2083.9784	2083.9822	M	G	2	23
PSM	VPPAPVPCPPPSPGPSAVPSSPK	10	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3380.3	36.28673	3	2378.070671	2378.078288	K	S	366	389
PSM	VPPAPVPCPPPSPGPSAVPSSPK	11	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	36.49597	3	2378.070671	2378.078288	K	S	366	389
PSM	LVQDVANNTNEEAGDGTTTATVLAR	12	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3337.6	35.17837	3	2639.203571	2639.207584	K	S	97	122
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	13	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2786.3	20.97385	4	3024.360094	3024.356099	K	S	145	174
PSM	DATNVGDEGGFAPNILENK	14	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3697.3	44.47913	3	1959.915971	1959.917400	K	E	203	222
PSM	IADPEHDHTGFLTEYVATR	15	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3525.5	40.03188	3	2330.957771	2330.961009	R	W	190	209
PSM	ILATPPQEDAPSVDIANIR	16	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3927.3	50.34172	3	2178.994271	2178.996332	K	M	284	303
PSM	AAAVAAAGAGEPQSPDELLPK	17	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4058.3	53.59712	3	2084.9822	2083.9822	M	G	2	23
PSM	IACRSPQPDPVGTPTIFKPQSK	18	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3382.3	36.3344	4	2583.192894	2583.195777	K	R	2219	2241
PSM	TPSPKEEDEEPESPPEK	19	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2767.3	20.4944	3	2003.826071	2003.824878	K	K	202	219
PSM	LGGSPTSLGTWGSWIGPDHDK	20	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4022.2	52.7273	3	2246.996771	2246.999763	K	F	439	460
PSM	KYEQGFITDPVVLSPK	21	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3655.2	43.39375	3	1899.937871	1899.938332	K	D	109	125
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	22	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3208.6	31.84663	4	3093.278494	3093.277137	R	-	738	768
PSM	SSSPAPADIAQTVQEDLR	23	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4013.3	52.48853	3	1963.888571	1963.888816	K	T	230	248
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	24	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3115.3	29.40697	4	2612.320894	2612.322435	R	Q	24	52
PSM	VPPAPVPCPPPSPGPSAVPSSPK	25	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3397.5	36.70375	3	2378.070671	2378.078288	K	S	366	389
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	26	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3763.4	46.18863	4	2963.268494	2963.274343	R	T	88	114
PSM	DNLTLWTSDMQGDGEEQNK	27	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3767.4	46.28605	3	2179.928171	2179.932792	R	E	226	245
PSM	DNLTLWTSENQGDEGDAGEGEN	28	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3780.4	46.6178	3	2349.941171	2349.946922	R	-	225	247
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	29	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3700.4	44.55795	4	3385.512894	3385.515651	K	A	399	429
PSM	KYEQGFITDPVVLSPKDR	30	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	39.03707	4	2171.066094	2171.066387	K	V	109	127
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	31	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3847.2	48.29903	4	3465.477294	3465.481982	K	A	399	429
PSM	CIPALDSLTPANEDQK	32	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3540.4	40.40043	3	1850.808671	1850.812146	R	I	447	463
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	33	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3604.6	42.0727	3	2988.153071	2988.155727	K	E	144	170
PSM	DDDIAALVVDNGSGMCK	34	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4365.3	58.94083	3	1900.7609	1900.7579	M	A	2	19
PSM	DDDIAALVVDNGSGMCK	35	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4124.2	54.88238	3	1916.7509	1916.7528	M	A	2	19
PSM	GEPAAAAAPEAGASPVEK	36	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2887.4	23.53447	3	1701.760871	1701.761096	K	E	88	106
PSM	RADLNQGIGEPQSPSRR	37	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2842.3	22.37307	3	1959.931871	1959.927602	R	V	62	79
PSM	NGSLDSPGKQDTEEDEEEDEK	38	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2777.3	20.75613	3	2429.922671	2429.923149	K	D	134	155
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	39	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3297.5	34.1473	3	2994.251771	2994.261530	K	A	106	138
PSM	WLDDLLASPPPSGGGAR	40	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4467.2	60.11797	3	1867.788071	1867.790696	R	R	684	701
PSM	DATNVGDEGGFAPNILENK	41	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3694.2	44.3996	3	1959.915971	1959.917400	K	E	203	222
PSM	LDNVPHTPSSYIETLPK	42	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3644.5	43.10337	3	1989.941171	1989.944874	R	A	45	62
PSM	FSGWYDADLSPAGHEEAK	43	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3595.4	41.83075	3	2058.834371	2058.836052	R	R	22	40
PSM	ADDVDQQQTTNTVEEPLDLIR	44	sp|P62310|LSM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4571.2	61.73813	3	2521.1170	2521.1216	M	L	2	23
PSM	SSGSPYGGGYGSGGGSGGYGSR	45	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2974.5	25.78762	3	1989.744971	1989.749028	R	R	355	377
PSM	KAEAGAGSATEFQFR	46	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3206.2	31.78097	3	1648.724171	1648.724651	K	G	150	165
PSM	IRYESLTDPSKLDSGK	47	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3226.3	32.3001	3	1887.897071	1887.897924	K	E	54	70
PSM	DGARPDVTESESGSPEYR	48	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2916.3	24.28488	3	2030.819471	2030.821859	K	Q	425	443
PSM	VTNGAFTGEISPGMIK	49	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3718.2	45.00048	3	1700.781671	1700.784474	K	D	107	123
PSM	ISLPGQMAGTPITPLK	50	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	50.00383	3	1782.838271	1782.839226	K	D	213	229
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	51	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4182.2	55.92765	4	3681.634094	3681.639334	K	K	213	250
PSM	WLDDLLASPPPSGGGAR	52	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4478.2	60.32236	3	1867.788071	1867.790696	R	R	684	701
PSM	NSDVLQSPLDSAARDEL	53	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3833.2	47.93957	3	1908.843071	1908.846617	K	-	606	623
PSM	TPEELDDSDFETEDFDVR	54	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3907.5	49.84437	3	2237.846771	2237.852550	R	S	634	652
PSM	IADPEHDHTGFLTEYVATR	55	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3534.4	40.2461	3	2330.957771	2330.961009	R	W	190	209
PSM	DYEIESQNPLASPTNTLLGSAK	56	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4083.3	54.14465	3	2427.119171	2427.120667	K	E	618	640
PSM	DDDIAALVVDNGSGMCK	57	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4110.2	54.66483	3	1916.7509	1916.7528	M	A	2	19
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	58	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3864.2	48.74187	4	2749.2244	2749.2301	-	Y	1	25
PSM	ADEDLIFRLEGVDGGQSPR	59	sp|O00418|EF2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.4569.2	61.6871	3	2194.9853	2194.9891	M	A	2	21
PSM	SDEFSLADALPEHSPAK	60	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3957.2	51.10492	3	1935.8312	1934.8292	M	T	2	19
PSM	GKEDEGEEAASPMLQIQR	61	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3247.4	32.8466	3	2066.895071	2066.898001	K	D	2400	2418
PSM	SGKYDLDFKSPDDPSR	62	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3181.3	31.13153	3	1905.813671	1905.814588	R	Y	254	270
PSM	GNSRPGTPSAEGGSTSSTLR	63	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2758.3	20.28103	3	1997.882471	1997.880377	R	A	383	403
PSM	LYGSAGPPPTGEEDTAEKDEL	64	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3396.4	36.67458	3	2254.944671	2254.951870	K	-	634	655
PSM	VPPAPVPCPPPSPGPSAVPSSPK	65	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3405.4	36.90733	3	2378.070671	2378.078288	K	S	366	389
PSM	ELAQRQEEEAAQQGPVVVSPASDYK	66	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3241.2	32.68405	4	2808.292894	2808.296734	K	D	140	165
PSM	KYEQGFITDPVVLSPK	67	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3647.2	43.17198	3	1899.937871	1899.938332	K	D	109	125
PSM	LGGSAVISLEGKPL	68	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4030.3	52.91723	2	1499.699047	1499.703779	K	-	153	167
PSM	TPSSDVLVFDYTK	69	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3880.2	49.14508	2	1550.688847	1550.690557	K	H	144	157
PSM	WLDDLLASPPPSGGGAR	70	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4426.2	59.7107	3	1867.788071	1867.790696	R	R	684	701
PSM	LDGLVETPTGYIESLPR	71	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4275.2	57.85478	3	1938.932771	1938.933975	R	V	56	73
PSM	AAPEASSPPASPLQHLLPGK	72	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3781.2	46.63563	3	2126.976971	2126.980288	K	A	686	706
PSM	DNLTLWTSDMQGDGEEQNK	73	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3759.4	46.0775	3	2179.928171	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	74	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3783.2	46.68442	3	2192.871071	2192.873028	R	-	228	248
PSM	DNLTLWTSDSAGEECDAAEGAEN	75	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3880.3	49.14842	3	2453.974271	2453.976507	R	-	223	246
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	76	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4201.2	56.3286	3	2540.086871	2540.089049	K	S	180	204
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	77	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3604.4	42.06603	3	2573.994671	2573.998594	R	G	239	267
PSM	DMESPTKLDVTLAK	78	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3277.3	33.62045	3	1642.747571	1642.752506	K	D	277	291
PSM	NGSLDSPGKQDTEEDEEEDEK	79	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2806.2	21.4825	3	2429.924171	2429.923149	K	D	134	155
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	80	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3289.6	33.94372	3	2994.251771	2994.261530	K	A	106	138
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	81	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2778.4	20.78175	4	3024.360094	3024.356099	K	S	145	174
PSM	EAAGGNDSSGATSPINPAVALE	82	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3742.2	45.62715	3	2106.906071	2106.910674	K	-	1236	1258
PSM	GALQNIIPASTGAAK	83	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3489.4	39.09598	2	1490.746247	1490.749409	R	A	201	216
PSM	DMESPTKLDVTLAK	84	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3456.2	38.22532	3	1626.757871	1626.757591	K	D	277	291
PSM	NQLTSNPENTVFDAK	85	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3488.2	39.06307	3	1756.766771	1756.766910	K	R	82	97
PSM	VLLPEYGGTKVVLDDK	86	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	42.05937	3	1824.927371	1824.927433	K	D	71	87
PSM	NQYDNDVTVWSPQGR	87	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3494.2	39.21972	3	1857.767471	1857.768307	R	I	4	19
PSM	WLDDLLASPPPSGGGAR	88	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4494.2	60.52623	3	1867.788071	1867.790696	R	R	684	701
PSM	DSGPLPTPPGVSLLGEPPK	89	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4154.2	55.4778	3	1936.952471	1936.954711	K	D	482	501
PSM	LDNVPHTPSSYIETLPK	90	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3652.5	43.31244	3	1989.941171	1989.944874	R	A	45	62
PSM	AAPEASSPPASPLQHLLPGK	91	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3773.2	46.43633	3	2126.976971	2126.980288	K	A	686	706
PSM	DGYADIVDVLNSPLEGPDQK	92	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4523.2	60.9521	3	2223.989171	2223.993675	K	S	287	307
PSM	ADLLLSTQPGREEGSPLELER	93	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3708.2	44.74788	3	2389.148471	2389.152635	K	L	593	614
PSM	GGPGSAVSPYPTFNPSSDVAALHK	94	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3800.4	47.08637	3	2515.080971	2515.082187	K	A	30	54
PSM	EEEIAALVIDNGSGMCK	95	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5148.2	66.54083	3	1956.8150	1956.8205	M	A	2	19
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	96	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3974.2	51.52457	3	2829.1930	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	97	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3840.6	48.13297	3	2749.2235	2749.2301	-	Y	1	25
PSM	MDSAGQDINLNSPNK	98	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3197.2	31.54648	3	1740.7004	1740.7021	-	G	1	16
PSM	AAAVAAAGAGEPQSPDELLPK	99	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4050.3	53.3853	3	2083.9784	2083.9822	M	G	2	23
PSM	TPAAAAAMNLASPR	100	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3267.5	33.36598	2	1420.646847	1420.653400	R	T	2261	2275
PSM	SGKYDLDFKSPDDPSR	101	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3188.2	31.31108	4	1905.818094	1905.814588	R	Y	254	270
PSM	DGLNQTTIPVSPPSTTKPSR	102	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3295.4	34.09285	3	2175.051071	2175.057278	K	A	573	593
PSM	LYGSAGPPPTGEEDTAEKDEL	103	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3404.5	36.88488	3	2254.944671	2254.951870	K	-	634	655
PSM	PAEKPAETPVATSPTATDSTSGDSSR	104	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2795.5	21.20547	3	2719.126871	2719.126296	K	S	148	174
PSM	KIFVGGLSPDTPEEK	105	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3511.2	39.66228	3	1775.772671	1775.778400	K	I	183	198
PSM	ILTPLVSLDTPGK	106	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4562.2	61.62167	2	1512.719647	1512.724180	K	A	240	253
PSM	DLADELALVDVIEDK	107	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.5040.2	65.81847	2	1656.843447	1656.845798	K	L	43	58
PSM	SLSTSGESLYHVLGLDK	108	sp|Q9H3Z4|DNJC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4235.2	57.07858	3	1884.887771	1884.887025	R	N	8	25
PSM	DTQSPSTCSEGLLGWSQK	109	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3803.2	47.15727	3	2059.855871	2059.855802	K	D	709	727
PSM	DNLTLWTSDQQDDDGGEGNN	110	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3793.3	46.90902	3	2192.871071	2192.873028	R	-	228	248
PSM	SGEEDFESLASQFSDCSSAK	111	sp|Q13526|PIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	16-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.4065.2	53.73062	3	2259.850571	2259.851504	K	A	98	118
PSM	GFGDLKSPAGLQVLNDYLADK	112	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4468.2	60.14378	3	2300.1071	2300.1085	M	S	2	23
PSM	DLYANTVLSGGTTMYPGIADR	113	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3890.2	49.41935	3	2310.020471	2310.023930	K	M	292	313
PSM	EGEEAGPGDPLLEAVPKTGDEK	114	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3507.5	39.56863	3	2317.032971	2317.036268	K	D	353	375
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	115	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3509.5	39.62077	4	2833.346094	2833.352672	K	S	362	389
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	116	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3709.6	44.7858	4	3385.512894	3385.515651	K	A	399	429
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	117	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	18-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4529.3	61.10515	4	3720.685294	3720.684901	K	G	621	655
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	118	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,11-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3680.2	44.03508	4	2882.1852	2882.1622	M	D	2	29
PSM	MEAAGSPAATETGK	119	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2715.4	19.43803	2	1457.5739	1457.5740	-	Y	1	15
PSM	GAGAGHPGAGGAQPPDSPAGVR	120	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2798.5	21.28285	3	1962.871271	1962.869752	R	T	71	93
PSM	GGNFGGRSSGPYGGGGQYFAK	121	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3269.5	33.41827	3	2099.882471	2099.885068	K	P	278	299
PSM	SSGPYGGGGQYFAK	122	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3251.5	32.9544	2	1454.584647	1454.586761	R	P	285	299
PSM	PCSEETPAISPSK	123	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2856.5	22.73558	2	1481.6123	1481.6104	M	R	2	15
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	124	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	21-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3320.3	34.72962	4	2991.323694	2991.328110	R	V	221	251
PSM	VAAETQSPSLFGSTK	125	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3292.5	34.01873	2	1601.730247	1601.733819	K	L	215	230
PSM	GEPAAAAAPEAGASPVEK	126	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2895.5	23.74387	3	1701.760871	1701.761096	K	E	88	106
PSM	ADSGPTQPPLSLSPAPETK	127	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3383.4	36.35822	3	1971.916271	1971.919054	R	R	2071	2090
PSM	AIGSASEGAQSSLQEVYHK	128	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3332.5	35.04555	3	2040.912671	2040.915365	R	S	169	188
PSM	NGVIQHTGAAAEEFNDDTD	129	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3228.5	32.357	3	2082.813971	2082.816773	R	-	646	665
PSM	EFQDAGEQVVSSPADVAEK	130	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3337.3	35.16837	3	2084.890871	2084.893961	K	A	77	96
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	131	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	33.67912	4	2898.280894	2898.290225	K	L	281	308
PSM	QEEEAAQQGPVVVSPASDYK	132	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3202.2	31.67677	3	2210.972471	2210.973274	R	D	145	165
PSM	TVGTPIASVPGSTNTGTVPGSEK	133	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3286.6	33.86498	3	2236.055771	2236.062423	R	D	270	293
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	134	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3216.4	32.04882	4	3093.278494	3093.277137	R	-	738	768
PSM	VEEQEPELTSTPNFVVEVIKNDDGKK	135	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3926.2	50.31535	4	3023.436894	3023.437644	K	A	155	181
PSM	DVAEAKPELSLLGDGDH	136	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3540.3	40.3971	3	1764.851771	1764.853008	R	-	232	249
PSM	NQYDNDVTVWSPQGR	137	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3478.3	38.80415	3	1857.767471	1857.768307	R	I	4	19
PSM	SYELPDGQVITIGNER	138	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4018.2	52.62327	3	1869.851771	1869.850974	K	F	241	257
PSM	DTMSDQALEALSASLGTR	139	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4246.2	57.30647	3	1944.848471	1944.849988	K	Q	284	302
PSM	FNEEHIPDSPFVVPVASPSGDAR	140	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3873.2	48.96408	4	2626.111294	2626.114215	K	R	2311	2334
PSM	GSLESPATDVFGSTEEGEK	141	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3671.3	43.80317	3	2018.833271	2018.835777	K	R	331	350
PSM	STAALSGEAASCSPIIMPYK	142	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	42.9112	3	2132.949671	2132.952345	K	A	242	262
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	143	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3661.4	43.5443	4	2835.270094	2835.274618	R	T	350	376
PSM	DDDIAALVVDNGSGMCK	144	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4153.2	55.45185	2	1820.7889	1820.7915	M	A	2	19
PSM	EEEIAALVIDNGSGMCK	145	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5119.2	66.33704	3	1956.8150	1956.8205	M	A	2	19
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	146	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2854.6	22.68735	4	3087.2992	3087.2954	K	S	145	174
PSM	ASGVAVSDGVIK	147	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3515.4	39.77078	2	1223.5764	1223.5794	M	V	2	14
PSM	AESSESFTMASSPAQR	148	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3430.5	37.55878	2	1806.7115	1806.7126	M	R	2	18
PSM	MEAAGSPAATETGK	149	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3032.2	27.26717	2	1441.5785	1441.5791	-	Y	1	15
PSM	SSTPLPTISSSAENTR	150	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3175.3	30.97447	3	1726.775771	1726.777475	R	Q	158	174
PSM	AQAAAPASVPAQAPK	151	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2863.2	22.90608	3	1456.711271	1456.707544	K	R	135	150
PSM	SGSSSPDSEITELK	152	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3276.6	33.60448	2	1515.626647	1515.634164	R	F	571	585
PSM	ADLNQGIGEPQSPSRR	153	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2930.2	24.64132	3	1803.827471	1803.826490	R	V	63	79
PSM	IRYESLTDPSKLDSGK	154	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3218.2	32.0941	3	1887.897071	1887.897924	K	E	54	70
PSM	EVNVSPCPTQPCQLSK	155	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3111.4	29.30545	3	1922.824871	1922.826750	K	G	36	52
PSM	GPSTPKSPGASNFSTLPK	156	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3240.5	32.66796	3	1931.843471	1931.843126	R	I	223	241
PSM	NIGRDTPTSAGPNSFNK	157	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3013.5	26.78707	3	1934.789471	1934.792487	K	G	134	151
PSM	TPEELDDSDFETEDFDVR	158	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3899.3	49.63713	3	2237.846771	2237.852550	R	S	634	652
PSM	DDGLFSGDPNWFPK	159	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4593.2	62.03082	2	1673.669647	1673.676304	R	K	140	154
PSM	VLLPEYGGTKVVLDDK	160	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3613.2	42.28145	3	1824.927371	1824.927433	K	D	71	87
PSM	WLDDLLASPPPSGGGAR	161	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4448.2	59.91625	3	1867.788071	1867.790696	R	R	684	701
PSM	HSGGFLSSPADFSQENK	162	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3456.4	38.23198	3	1886.781671	1886.783623	R	A	772	789
PSM	LDGLVETPTGYIESLPR	163	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4266.2	57.63873	3	1938.932771	1938.933975	R	V	56	73
PSM	FDRGYISPYFINTSK	164	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3833.3	47.94957	3	1966.821971	1966.826747	K	G	219	234
PSM	AAPEASSPPASPLQHLLPGK	165	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3616.4	42.36655	3	2047.013471	2047.013957	K	A	686	706
PSM	DALGDSLQVPVSPSSTTSSR	166	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3594.4	41.80478	3	2082.943571	2082.947059	R	C	141	161
PSM	DNLTLWTSDQQDDDGGEGNN	167	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3810.3	47.3426	3	2192.868971	2192.873028	R	-	228	248
PSM	DGYADIVDVLNSPLEGPDQK	168	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4511.3	60.73841	3	2223.989171	2223.993675	K	S	287	307
PSM	DLYANTVLSGGTTMYPGIADR	169	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4071.2	53.86858	3	2294.026571	2294.029015	K	M	292	313
PSM	AIVDALPPPCESACTVPTDVDK	170	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3618.4	42.41872	3	2434.076771	2434.079730	R	W	261	283
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	171	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3508.2	39.58468	5	2833.354618	2833.352672	K	S	362	389
PSM	EEEIAALVIDNGSGMCK	172	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4675.2	62.81479	3	1972.8113	1972.8154	M	A	2	19
PSM	MDSAGQDINLNSPNK	173	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3506.6	39.54618	2	1724.7044	1724.7072	-	G	1	16
PSM	AGAGSAAVSGAGTPVAGPTGR	174	sp|O95295|SNAPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3122.3	29.59005	3	1832.8412	1832.8413	M	D	2	23
PSM	SCINLPTVLPGSPSK	175	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4096.2	54.3734	3	1690.7989	1690.7996	M	T	2	17
PSM	VPPAPVPCPPPSPGPSAVPSSPK	176	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3385.2	36.39268	4	2378.072494	2378.078288	K	S	366	389
PSM	RTEGVGPGVPGEVEMVK	177	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3308.3	34.41818	3	1819.848971	1819.853951	R	G	16	33
PSM	TPSPKEEDEEPESPPEK	178	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2767.4	20.50107	3	2003.826071	2003.824878	K	K	202	219
PSM	TFDQLTPEESK	179	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3097.3	28.93575	2	1373.572847	1373.575193	K	E	60	71
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	180	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3276.5	33.60115	4	2957.315694	2957.325316	K	E	117	144
PSM	PCSEETPAISPSK	181	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2848.6	22.53317	2	1481.6123	1481.6104	M	R	2	15
PSM	VPSPLEGSEGDGDTD	182	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3257.5	33.11102	2	1553.572647	1553.577043	K	-	413	428
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	183	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3246.5	32.82447	4	3173.238894	3173.243468	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	184	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3254.5	33.03245	4	3173.238894	3173.243468	R	-	738	768
PSM	TPKTPKGPSSVEDIK	185	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2863.4	22.91275	3	1662.826571	1662.822968	K	A	234	249
PSM	GQAAVQQLQAEGLSPR	186	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3307.3	34.3932	3	1731.826571	1731.830513	R	F	43	59
PSM	ADLNQGIGEPQSPSRR	187	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2922.4	24.4408	3	1803.827471	1803.826490	R	V	63	79
PSM	DKPHVNVGTIGHVDHGK	188	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2846.2	22.46863	4	1808.930494	1808.928179	R	T	54	71
PSM	SAESPTSPVTSETGSTFK	189	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3218.3	32.09743	3	1891.806371	1891.808834	K	K	280	298
PSM	IGRIEDVTPIPSDSTR	190	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3274.5	33.54887	3	1914.842171	1914.848939	K	R	126	142
PSM	PAETPVATSPTATDSTSGDSSR	191	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2855.6	22.71308	3	2213.934671	2213.932531	K	S	152	174
PSM	IADPEHDHTGFLTEYVATR	192	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3416.2	37.18787	4	2250.992494	2250.994678	R	W	190	209
PSM	SQSPAASDCSSSSSSASLPSSGR	193	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2828.6	22.04602	3	2278.903271	2278.900914	R	S	171	194
PSM	HTPNTSDNEGSDTEVCGPNSPSK	194	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.2716.2	19.463	3	2508.969071	2508.970056	K	R	970	993
PSM	DDGVFVQEVTQNSPAAR	195	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3519.5	39.87772	3	1911.835271	1911.836387	R	T	29	46
PSM	DSGFTIVSPLDI	196	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5489.2	69.32784	2	1342.600047	1342.605765	K	-	784	796
PSM	GALQNIIPASTGAAK	197	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3497.4	39.30497	2	1490.746247	1490.749409	R	A	201	216
PSM	SACGNCYLGDAFR	198	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3608.4	42.16445	2	1569.570647	1569.574164	K	C	272	285
PSM	QSKPVTTPEEIAQVATISANGDK	199	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3563.6	41.00975	3	2463.186371	2463.189415	K	E	158	181
PSM	DISSDAFTALDPLGDK	200	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4386.2	59.254	2	1743.760447	1743.760428	K	E	631	647
PSM	SESVPPVTDWAWYK	201	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4345.2	58.62903	3	1823.721371	1823.720885	K	I	244	258
PSM	CIPALDSLTPANEDQK	202	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3548.2	40.60302	3	1850.808671	1850.812146	R	I	447	463
PSM	NQYDNDVTVWSPQGR	203	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3486.2	39.01088	3	1857.767471	1857.768307	R	I	4	19
PSM	GADFLVTEVENGGSLGSK	204	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3901.3	49.68313	3	1858.830371	1858.834990	K	K	189	207
PSM	WLDDLLASPPPSGGGAR	205	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4404.2	59.50593	3	1867.788071	1867.790696	R	R	684	701
PSM	DRSSFYVNGLTLGGQK	206	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3764.2	46.21475	3	1900.810271	1900.812160	K	C	55	71
PSM	GFGDLKSPAGLQVLNDYLADK	207	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4479.2	60.34922	3	2300.1071	2300.1085	M	S	2	23
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	208	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,18-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4254.2	57.44463	4	3537.369694	3537.370051	R	V	44	74
PSM	DDDIAALVVDNGSGMCK	209	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4390.2	59.35497	3	1900.7609	1900.7579	M	A	2	19
PSM	EEEIAALVIDNGSGMCK	210	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4655.2	62.60858	3	1972.8113	1972.8154	M	A	2	19
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	211	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2939.4	24.87852	5	3566.431618	3565.448950	K	D	124	155
PSM	MEGPLSVFGDR	212	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4160.2	55.59712	2	1344.5395	1344.5416	-	S	1	12
PSM	MEGPLSVFGDR	213	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4866.2	64.58065	2	1328.5427	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	214	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4895.2	64.7833	2	1328.5413	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	215	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4170.2	55.80022	2	1344.5395	1344.5416	-	S	1	12
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	216	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3966.2	51.31527	3	2829.1930	2829.1964	-	Y	1	25
PSM	NVSSFPDDATSPLQENR	217	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3404.3	36.87822	3	1956.828071	1955.826216	R	N	52	69
PSM	CNTPTYCDLGK	218	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3311.5	34.50178	2	1449.5253	1449.5300	M	A	2	13
PSM	SPAVATSTAAPPPPSSPLPSK	219	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3089.2	28.72727	4	2039.000094	2038.997638	K	S	439	460
PSM	MDATANDVPSPYEVR	220	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3323.3	34.80728	3	1743.713471	1743.717517	K	G	434	449
PSM	NGNGGPGPYVGQAGTATLPR	221	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3287.3	33.88122	3	1962.891971	1962.894904	K	N	185	205
PSM	SAESPTSPVTSETGSTFKK	222	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3050.5	27.72355	3	2019.903971	2019.903797	K	F	280	299
PSM	KLEDVKNSPTFK	223	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2847.3	22.49723	3	1484.730671	1484.727611	K	S	164	176
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	224	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3395.5	36.65183	4	3291.348494	3291.357615	R	S	1160	1192
PSM	KPAAAAAPGTAEKLSPK	225	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2749.5	20.06697	3	1686.872771	1686.870587	K	A	23	40
PSM	HTGPNSPDTANDGFVR	226	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2942.3	24.95068	3	1763.727371	1763.726442	K	L	99	115
PSM	RADLNQGIGEPQSPSR	227	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2914.5	24.23642	3	1803.824771	1803.826490	R	R	62	78
PSM	NVSSFPDDATSPLQENR	228	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3396.3	36.67125	3	1955.823971	1955.826216	R	N	52	69
PSM	GHTDTEGRPPSPPPTSTPEK	229	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2744.2	19.94363	4	2166.966894	2166.958293	R	C	353	373
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	230	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3075.5	28.37392	5	3112.509118	3112.507789	R	S	847	876
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	231	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3421.4	37.32542	4	3459.423694	3459.429735	K	L	104	135
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	232	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3084.6	28.6115	4	3492.326494	3492.326786	K	A	111	145
PSM	QLFHPEQLITGKEDAANNYAR	233	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3519.4	39.87438	4	2494.160494	2494.164203	R	G	85	106
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	234	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3428.3	37.50108	5	3265.401118	3265.402471	K	-	708	738
PSM	EVYELLDSPGK	235	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3517.3	39.81863	2	1328.587047	1328.590115	K	V	20	31
PSM	EVYELLDSPGK	236	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3525.4	40.02855	2	1328.587047	1328.590115	K	V	20	31
PSM	DVNSSSPVMLAFK	237	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3809.4	47.3195	2	1473.653847	1473.657483	K	S	28	41
PSM	GNPTVEVDLFTSK	238	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3726.3	45.21173	2	1485.672247	1485.675241	R	G	16	29
PSM	GYISPYFINTSK	239	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3957.4	51.11158	2	1548.628447	1548.630279	R	G	222	234
PSM	GYISPYFINTSK	240	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3949.4	50.90307	2	1548.628447	1548.630279	R	G	222	234
PSM	VGIDTPDIDIHGPEGK	241	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3422.2	37.34512	3	1741.789871	1741.792396	K	L	4560	4576
PSM	DISSDAFTALDPLGDK	242	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4373.2	59.0526	2	1743.760447	1743.760428	K	E	631	647
PSM	CVWSPLASPSTSILK	243	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4470.2	60.18425	3	1804.786271	1804.787191	R	R	2169	2184
PSM	VSHVSTGGGASLELLEGK	244	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3474.2	38.69557	3	1819.868771	1819.871709	K	V	389	407
PSM	NQLTSNPENTVFDAK	245	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3460.3	38.33249	3	1836.732071	1836.733241	K	R	82	97
PSM	DNLTLWTSDQQDEEAGEGN	246	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3810.2	47.33927	3	2120.871371	2120.877051	R	-	228	247
PSM	AAPEASSPPASPLQHLLPGK	247	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3765.2	46.22718	3	2126.976971	2126.980288	K	A	686	706
PSM	VPADTEVVCAPPTAYIDFAR	248	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4033.3	52.96663	3	2271.024971	2271.028287	K	Q	71	91
PSM	IADPEHDHTGFLTEYVATR	249	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3517.5	39.8253	3	2330.957771	2330.961009	R	W	190	209
PSM	VEEQEPELTSTPNFVVEVIK	250	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4193.2	56.15793	3	2366.126171	2366.129440	K	N	155	175
PSM	APLNIPGTPVLEDFPQNDDEK	251	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4037.2	53.06228	3	2388.085271	2388.088638	K	E	42	63
PSM	EVSSLEGSPPPCLGQEEAVCTK	252	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3457.6	38.2645	3	2453.041271	2453.049158	K	I	1388	1410
PSM	QSKPVTTPEEIAQVATISANGDK	253	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3471.2	38.6171	3	2463.184271	2463.189415	K	E	158	181
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	254	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3506.2	39.53285	5	2833.354618	2833.352672	K	S	362	389
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	255	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3785.2	46.7356	3	2881.086971	2881.094982	K	T	701	725
PSM	GYISPYFINTSK	256	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3822.2	47.65002	2	1469.663447	1468.663948	R	G	222	234
PSM	DDDIAALVVDNGSGMCK	257	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4351.2	58.71505	3	1900.7609	1900.7579	M	A	2	19
PSM	MEGPLSVFGDR	258	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4851.3	64.37302	2	1328.5421	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	259	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4919.2	64.99267	2	1328.5413	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	260	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4196.2	56.21847	2	1344.5395	1344.5416	-	S	1	12
PSM	AAPEASSPPASPLQHLLPGK	261	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3791.3	46.86082	3	2127.978971	2126.980288	K	A	686	706
PSM	MTEWETAAPAVAETPDIK	262	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4243.2	57.22922	3	2080.9051	2080.9059	-	L	1	19
PSM	APLATGEDDDDEVPDLVENFDEASKNEAN	263	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4385.2	59.21786	4	3198.302494	3198.303789	K	-	178	207
PSM	MNPVYSPGSSGVPYANAK	264	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3779.2	46.58653	3	1959.8429	1959.8433	-	G	1	19
PSM	AAQGVGPGPGSAAPPGLEAAR	265	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3510.3	39.63995	3	1951.9103	1951.9148	M	Q	2	23
PSM	AASPPASASDLIEQQQK	266	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3327.2	34.90775	3	1819.831871	1819.835324	R	R	333	350
PSM	DSAQNSVIIVDK	267	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3088.4	28.70845	2	1287.663047	1287.667045	K	N	194	206
PSM	HARPPDPPASAPPDSSSNSASQDTK	268	sp|Q15642|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2712.3	19.36327	4	2596.121694	2596.119103	R	E	486	511
PSM	TFDQLTPDESK	269	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3084.5	28.60817	2	1359.556247	1359.559543	K	E	71	82
PSM	ESDFSDTLSPSK	270	sp|Q14BN4|SLMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3149.3	30.29565	2	1391.548247	1391.549372	K	E	444	456
PSM	KLEDVKNSPTFK	271	sp|P55327|TPD52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2855.2	22.69975	3	1484.730671	1484.727611	K	S	164	176
PSM	GEATVSFDDPPSAK	272	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3185.3	31.23603	2	1499.614447	1499.618120	K	A	335	349
PSM	AIEINPDSAQPYK	273	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3296.5	34.12178	2	1524.678847	1524.686140	R	W	174	187
PSM	WLKSPTTPIDPEK	274	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3372.4	36.08529	3	1670.735471	1670.735807	K	Q	859	872
PSM	GNCVSLLSPSPEGDPR	275	sp|P17813|EGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	36.95257	3	1763.754071	1763.754965	K	F	514	530
PSM	ERAMSTTSISSPQPGK	276	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2655.2	18.36828	3	1771.779671	1771.781180	K	L	265	281
PSM	GHASAPYFGKEEPSVAPSSTGK	277	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3053.2	27.79123	4	2283.024494	2283.020893	K	T	131	153
PSM	GSLAEAVGSPPPAATPTPTPPTR	278	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3367.5	35.95853	3	2331.048971	2331.054910	R	K	446	469
PSM	HRNDHLTSTTSSPGVIVPESSENK	279	sp|O75496|GEMI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2977.4	25.86288	4	2671.221694	2671.223903	K	N	53	77
PSM	DSGFTIVSPLDI	280	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5513.2	69.5492	2	1342.600047	1342.605765	K	-	784	796
PSM	DSGFTIVSPLDI	281	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5459.2	69.12525	2	1342.600047	1342.605765	K	-	784	796
PSM	EGLELLKTAIGK	282	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3582.2	41.48682	2	1350.712047	1350.715984	K	A	222	234
PSM	LDIDSPPITAR	283	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3502.3	39.43198	2	1356.568847	1356.572764	R	N	33	44
PSM	EAAGGNDSSGATSPINPAVALE	284	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3736.4	45.47613	3	2106.906071	2106.910674	K	-	1236	1258
PSM	QREEYQPATPGLGMFVEVKDPEDK	285	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3717.4	44.98085	4	2842.288094	2842.288477	K	V	72	96
PSM	YISPDQLADLYK	286	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3971.2	51.4463	2	1504.683447	1504.685078	R	S	270	282
PSM	DSPESPFEVIIDK	287	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4062.2	53.67128	2	1554.680447	1554.685472	K	A	242	255
PSM	GNPTVEVDLFTSK	288	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3889.2	49.39282	2	1565.636647	1565.641572	R	G	16	29
PSM	SLTNDWEDHLAVK	289	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3630.2	42.72533	3	1606.699871	1606.702853	K	H	315	328
PSM	RASGQAFELILSPR	290	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3685.2	44.16597	3	1623.811571	1623.813407	K	S	14	28
PSM	SYELPDGQVITIGNER	291	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3815.2	47.46788	3	1789.884371	1789.884643	K	F	241	257
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	292	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4165.2	55.70653	4	3681.634094	3681.639334	K	K	213	250
PSM	DGKTLNDELEIIEGMK	293	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4181.2	55.90158	3	1883.855171	1883.858761	K	F	203	219
PSM	QIQTEAAQLLTSFSEKN	294	sp|Q96DB5|RMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3948.2	50.88295	3	1986.927071	1986.929953	K	-	298	315
PSM	SSSPAPADIAQTVQEDLR	295	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3751.2	45.8616	3	2043.851471	2043.855147	K	T	230	248
PSM	STETSDFENIESPLNER	296	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3624.2	42.57003	3	2046.838871	2046.841925	K	D	899	916
PSM	DRYMSPMEAQEFGILDK	297	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3885.2	49.27514	3	2108.892071	2108.894829	R	V	227	244
PSM	KGEQTSSGTLSAFASYFNSK	298	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4000.2	52.18637	3	2188.964171	2188.967795	R	V	670	690
PSM	DLYANTVLSGGTTMYPGIADR	299	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4081.3	54.08627	3	2294.026571	2294.029015	K	M	292	313
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	300	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3605.2	42.0846	4	2573.996894	2573.998594	R	G	239	267
PSM	DSLAAASGVLGGPQTPLAPEEETQAR	301	sp|Q9Y5Y0|FLVC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3766.2	46.25338	4	2644.231694	2644.238156	R	L	55	81
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	302	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3653.2	43.32843	4	2835.270094	2835.274618	R	T	350	376
PSM	QREEYQPATPGLGMFVEVKDPEDK	303	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3725.2	45.18192	4	2842.288094	2842.288477	K	V	72	96
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	304	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3545.5	40.53448	4	3199.390894	3199.394275	K	N	213	241
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	305	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:4,16-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4244.2	57.24483	4	3537.369694	3537.370051	R	V	44	74
PSM	AAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSER	306	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4219.2	56.70273	5	4986.1791	4986.1822	M	L	2	48
PSM	SCEGQNPELLPKTPISPLK	307	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3594.6	41.81145	3	2267.026571	2267.031003	K	T	308	327
PSM	AASEAAVVSSPSLK	308	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3386.3	36.42338	2	1437.6715	1437.6747	M	T	2	16
PSM	SDEFSLADALPEHSPAK	309	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3949.2	50.8964	3	1934.8307	1934.8294	M	T	2	19
PSM	RNSLTGEEGQLAR	310	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2968.2	25.62065	3	1509.694271	1509.693685	R	V	110	123
PSM	GGNFGGRSSGPYGGGGQYFAK	311	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3272.2	33.48683	4	2099.884094	2099.885068	K	P	278	299
PSM	GGRGDVGSADIQDLEK	312	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3190.2	31.36345	3	1695.749171	1695.746509	K	W	250	266
PSM	NQVALNPQNTVFDAK	313	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3399.2	36.74517	3	1737.805871	1737.808715	K	R	57	72
PSM	HTGPNSPDTANDGFVR	314	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2934.3	24.74885	3	1763.727371	1763.726442	K	L	99	115
PSM	VPPAPVPCPPPSPGPSAVPSSPK	315	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3413.2	37.10873	4	2378.072494	2378.078288	K	S	366	389
PSM	KITIADCGQLE	316	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3187.3	31.28855	2	1246.619447	1246.622738	K	-	155	166
PSM	EALQDVEDENQ	317	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3055.5	27.85323	2	1288.539247	1288.541905	K	-	245	256
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	318	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3106.4	29.17467	5	3290.595118	3290.597273	K	E	178	210
PSM	GVQVETISPGDGR	319	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3077.5	28.42607	2	1393.6209	1393.6233	M	T	2	15
PSM	SESPKEPEQLRK	320	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2703.3	19.15712	3	1506.708671	1506.707938	K	L	4	16
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	321	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3110.5	29.28257	4	3088.156094	3088.156036	R	A	10	40
PSM	AAHSEGNTTAGLDMR	322	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.2671.2	18.5427	3	1625.653571	1625.650500	R	E	467	482
PSM	MDATANDVPSPYEVR	323	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3320.6	34.73962	2	1743.711847	1743.717517	K	G	434	449
PSM	MDATANDVPSPYEVR	324	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3227.2	32.32185	3	1759.709171	1759.712432	K	G	434	449
PSM	MDATANDVPSPYEVR	325	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3219.2	32.11957	3	1759.709171	1759.712432	K	G	434	449
PSM	TDSVIIADQTPTPTR	326	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3240.2	32.65797	3	1773.756971	1773.758727	R	F	42	57
PSM	DAPTSPASVASSSSTPSSK	327	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2901.4	23.89592	3	1842.802571	1842.788433	K	T	282	301
PSM	EQPPTEPGPQSASEVEK	328	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2935.4	24.77797	3	1888.807871	1888.809169	R	I	393	410
PSM	EAENQGLDISSPGMSGHR	329	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3113.3	29.35393	3	1963.807871	1963.809520	K	Q	191	209
PSM	VKLESPTVSTLTPSSPGK	330	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3326.3	34.88503	3	1986.926171	1986.931606	R	L	290	308
PSM	AMHQAQTMEGCSSPMVVK	331	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:35,11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2953.3	25.23753	3	2086.832171	2086.834555	K	F	167	185
PSM	AIGSASEGAQSSLQEVYHK	332	sp|P28066|PSA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3417.4	37.22097	3	2120.882171	2120.881696	R	S	169	188
PSM	TVEVAEGEAVRTPQSVTAK	333	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3139.3	30.03475	3	2130.958571	2130.959947	R	Q	132	151
PSM	KLSSWDQAETPGHTPSLR	334	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3242.2	32.71033	4	2168.931294	2168.929315	K	W	214	232
PSM	YRDVAECGPQQELDLNSPR	335	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3325.5	34.86593	3	2325.999071	2326.004926	K	N	102	121
PSM	SQDATFSPGSEQAEKSPGPIVSR	336	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3162.5	30.64093	3	2454.106271	2454.106414	R	T	329	352
PSM	PAEKPAETPVATSPTATDSTSGDSSR	337	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2786.4	20.98052	3	2719.126871	2719.126296	K	S	148	174
PSM	SADTLWGIQK	338	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3626.2	42.62185	2	1197.541447	1197.543105	K	E	319	329
PSM	SADTLWGIQK	339	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3618.2	42.41205	2	1197.541447	1197.543105	K	E	319	329
PSM	SADTLWDIQK	340	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3697.2	44.4758	2	1255.544447	1255.548584	K	D	320	330
PSM	DAGQISGLNVLR	341	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3726.2	45.2084	2	1321.635447	1321.639131	K	V	207	219
PSM	TLTPISAAYAR	342	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3460.4	38.33582	2	1322.564647	1322.567285	K	A	295	306
PSM	IMNTFSVVPSPK	343	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3635.3	42.85966	2	1398.659847	1398.661840	R	V	163	175
PSM	GLPTGDSPLGPMTHRGEEDWLYER	344	sp|Q9NVS9|PNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3874.2	49.00302	4	2872.195694	2872.192876	R	L	235	259
PSM	EINAREESLVEELSPASEK	345	sp|Q9BXK5|B2L13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3492.3	39.17082	3	2209.014971	2209.015139	K	K	413	432
PSM	IMNTFSVVPSPK	346	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3763.3	46.18196	2	1478.625247	1478.628171	R	V	163	175
PSM	GYISPYFINTSK	347	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3967.2	51.32833	2	1548.628447	1548.630279	R	G	222	234
PSM	IFVGGLSPDTPEEK	348	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3494.5	39.22972	2	1567.712447	1567.717106	K	I	184	198
PSM	DDGLFSGDPNWFPK	349	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4612.2	62.23015	2	1673.669647	1673.676304	R	K	140	154
PSM	VTNGAFTGEISPGMIK	350	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	44.79715	3	1700.781671	1700.784474	K	D	107	123
PSM	DVTNFTVGGFAPMSPR	351	sp|O00267|SPT5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4053.2	53.46027	3	1774.772171	1774.774972	R	I	653	669
PSM	GPPQSPVFEGVYNNSR	352	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3462.2	38.38145	3	1826.798771	1826.798879	K	M	107	123
PSM	FDRGYISPYFINTSK	353	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3719.2	45.0265	3	1886.859971	1886.860416	K	G	219	234
PSM	AEELSPAALSPSLEPIR	354	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3939.2	50.65128	3	1938.870971	1938.874092	R	C	441	458
PSM	GLSLVDKENTPPALSGTR	355	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3447.3	37.99257	3	2013.915071	2013.917353	K	V	24	42
PSM	KEESEESDDDMGFGLFD	356	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4271.2	57.7499	3	2028.712271	2028.718364	K	-	98	115
PSM	DQLIYNLLKEEQTPQNK	357	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3937.2	50.59903	3	2153.037971	2153.040566	K	I	6	23
PSM	ATESGAQSAPLPMEGVDISPK	358	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3648.4	43.20481	3	2163.972671	2163.975917	K	Q	8	29
PSM	DNLTLWTSDQQDDDGGEGNN	359	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3818.4	47.55217	3	2192.868971	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	360	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3529.2	40.11852	3	2195.924471	2195.927707	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	361	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3521.6	39.93324	3	2195.924471	2195.927707	R	E	226	245
PSM	VPADTEVVCAPPTAYIDFAR	362	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4042.4	53.18395	3	2271.024971	2271.028287	K	Q	71	91
PSM	GFFICDQPYEPVSPYSCK	363	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3988.3	51.88262	3	2272.919171	2272.921045	R	E	676	694
PSM	VEEQEPELTSTPNFVVEVIK	364	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4183.2	55.95365	3	2366.126171	2366.129440	K	N	155	175
PSM	DNLTLWTSDTQGDEAEAGEGGEN	365	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3871.2	48.9246	3	2407.981871	2407.988786	R	-	223	246
PSM	DYEIESQNPLASPTNTLLGSAK	366	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4095.2	54.3474	3	2427.119171	2427.120667	K	E	618	640
PSM	DSGSDEDFLMEDDDDSDYGSSK	367	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3621.4	42.49805	3	2427.862871	2427.865619	K	K	129	151
PSM	AIVDALPPPCESACTVPTDVDK	368	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3626.5	42.63185	3	2434.076771	2434.079730	R	W	261	283
PSM	DAEAHPWLSDYDDLTSATYDK	369	sp|P50542|PEX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3940.5	50.68785	3	2492.001971	2492.005696	R	G	302	323
PSM	CIPALDSLTPANEDQK	370	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4528.2	61.06952	3	1833.7826	1833.7851	R	I	447	463
PSM	SAESPTSPVTSETGSTFK	371	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3419.3	37.26987	3	1972.777871	1971.775165	K	K	280	298
PSM	MDSAGQDINLNSPNK	372	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3498.5	39.33435	2	1724.7044	1724.7072	-	G	1	16
PSM	AAAVAAAGAGEPQSPDELLPK	373	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4089.3	54.23998	3	2083.9784	2083.9822	M	G	2	23
PSM	TEWETAAPAVAETPDIK	374	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3912.2	49.96433	3	1949.8642	1949.8654	M	L	2	19
PSM	MEDLVQDGVASPATPGTGK	375	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3986.2	51.82742	3	1993.8689	1993.8699	-	S	1	20
PSM	TFDQLTPDESK	376	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3092.6	28.81593	2	1359.556247	1359.559543	K	E	71	82
PSM	SSDEENGPPSSPDLDR	377	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2918.6	24.34362	3	1781.681771	1780.678883	R	I	202	218
PSM	SCINLPTVLPGSPSK	378	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4084.2	54.17062	3	1690.7989	1690.7996	M	T	2	17
PSM	TPKTPKGPSSVEDIK	379	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2855.4	22.70642	3	1662.826571	1662.822968	K	A	234	249
PSM	GHTDTEGRPPSPPPTSTPEK	380	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2709.2	19.27827	4	2246.928494	2246.924624	R	C	353	373
PSM	GASLKSPLPSQ	381	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3066.3	28.13188	2	1163.558047	1163.558755	K	-	113	124
PSM	SADGSAPAGEGEGVTLQR	382	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3058.4	27.92773	3	1780.764671	1780.762887	K	N	31	49
PSM	RADLNQGIGEPQSPSR	383	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2906.3	24.02242	3	1803.824771	1803.826490	R	R	62	78
PSM	STGCDFAVSPK	384	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3060.3	27.97632	2	1247.486847	1247.489355	K	L	501	512
PSM	ALINSPEGAVGR	385	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3248.4	32.87242	2	1262.597447	1262.602017	R	S	66	78
PSM	SSPNPFVGSPPK	386	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3181.4	31.13487	2	1292.577647	1292.580219	K	G	393	405
PSM	GVQVETISPGDGR	387	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3069.4	28.21425	2	1393.6209	1393.6233	M	T	2	15
PSM	NAEAVLQSPGLSGK	388	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3209.5	31.8698	2	1449.683847	1449.686475	R	V	849	863
PSM	AEAGAGSATEFQFR	389	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3412.5	37.0931	2	1520.625447	1520.629688	K	G	151	165
PSM	ELSDQATASPIVAR	390	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3096.6	28.91955	2	1536.713647	1536.718503	K	T	88	102
PSM	ELQAAGKSPEDLER	391	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2963.3	25.49387	3	1621.732271	1621.734881	K	L	448	462
PSM	APGTPHSHTKPYVR	392	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2527.2	17.34713	4	1626.771694	1626.766791	K	S	155	169
PSM	ALSRQEMQEVQSSR	393	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2683.2	18.7495	3	1743.762371	1743.761113	K	S	187	201
PSM	KPAAAAAPGTAEKLSPK	394	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2768.4	20.5201	3	1766.834171	1766.836918	K	A	23	40
PSM	NIGRDTPTSAGPNSFNK	395	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2968.3	25.62398	3	1854.821771	1854.826156	K	G	134	151
PSM	RLYPAVDEQETPLPR	396	sp|Q96S59|RANB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3276.3	33.59448	3	1862.885171	1862.892779	K	S	153	168
PSM	TSVQTEDDQLIAGQSAR	397	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3179.3	31.07927	3	1897.841471	1897.841866	R	A	654	671
PSM	NIGRDTPTSAGPNSFNK	398	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3005.5	26.5835	3	1934.789471	1934.792487	K	G	134	151
PSM	VTAEADSSSPTGILATSESK	399	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3326.4	34.88837	3	2029.904171	2029.909277	K	S	486	506
PSM	IACKSPPPESVDTPTSTK	400	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2819.5	21.80988	3	2073.870371	2073.873106	K	Q	1127	1145
PSM	NQKPSQVNGAPGSPTEPAGQK	401	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2696.3	18.98238	3	2170.998671	2171.000826	K	Q	1255	1276
PSM	GSLAEAVGSPPPAATPTPTPPTR	402	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3375.5	36.16345	3	2331.048971	2331.054910	R	K	446	469
PSM	NGSLDSPGKQDTEEDEEEDEK	403	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2814.5	21.6846	3	2429.924171	2429.923149	K	D	134	155
PSM	PAEKPAETPVATSPTATDSTSGDSSR	404	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2834.6	22.20112	3	2639.163071	2639.159965	K	S	148	174
PSM	QEMQEVQSSRSGRGGNFGFGDSR	405	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3227.4	32.32852	4	2675.058894	2675.058508	R	G	191	214
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	406	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3361.5	35.8012	4	2853.388894	2853.390968	K	K	62	95
PSM	AEEYEFLTPVEEAPK	407	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3744.3	45.68243	3	1830.792671	1830.796479	R	G	153	168
PSM	SGEISLPIKEEPSPISK	408	sp|Q9ULH7|MRTFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3466.2	38.48605	3	1889.936171	1889.938726	K	M	909	926
PSM	GFDPTASPFCQ	409	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3702.2	44.60081	2	1305.469647	1305.473705	K	-	1293	1304
PSM	DAGQISGLNVLR	410	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3718.4	45.00715	2	1321.635447	1321.639131	K	V	207	219
PSM	VWSPLVTEEGK	411	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3628.4	42.68045	2	1323.608247	1323.611184	K	R	88	99
PSM	EAAGGNDSSGATSPINPAVALE	412	sp|P32004|L1CAM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3728.3	45.26397	3	2106.906071	2106.910674	K	-	1236	1258
PSM	ISEEQQQLQQALAPAQASSNSSTPTR	413	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3556.4	40.81956	4	2849.316094	2849.319260	K	M	9	35
PSM	ILATPPQEDAPSVDIANIR	414	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3935.2	50.54988	3	2178.994271	2178.996332	K	M	284	303
PSM	SSVSRVPCNVEGISPELEK	415	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3468.6	38.552	3	2245.966871	2245.969131	K	V	290	309
PSM	ILTPLVSLDTPGK	416	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4550.2	61.41095	2	1512.719647	1512.724180	K	A	240	253
PSM	TKEVYELLDSPGK	417	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3436.2	37.70127	3	1557.729671	1557.732756	K	V	18	31
PSM	RASGQAFELILSPR	418	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3677.2	43.95687	3	1623.811571	1623.813407	K	S	14	28
PSM	SESVPPVTDWAWYK	419	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4138.3	55.18563	3	1743.753971	1743.754554	K	I	244	258
PSM	RIDFIPVSPAPSPTR	420	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	46.35828	3	1811.832371	1811.837252	K	G	136	151
PSM	SESVPPVTDWAWYK	421	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4360.2	58.83158	3	1823.721371	1823.720885	K	I	244	258
PSM	NPDDITQEEYGEFYK	422	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3543.3	40.47528	3	1846.792271	1846.789740	R	S	292	307
PSM	FDRGYISPYFINTSK	423	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3711.3	44.8253	3	1886.859971	1886.860416	K	G	219	234
PSM	LDNVPHTPSSYIETLPK	424	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3636.6	42.89577	3	1989.941171	1989.944874	R	A	45	62
PSM	QFTPCQLLADHANSPNKK	425	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3448.3	38.01925	4	2227.945694	2227.948671	K	F	743	761
PSM	GRLTPSPDIIVLSDNEASSPR	426	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3776.3	46.5162	3	2383.077371	2383.082187	R	S	117	138
PSM	DNLTLWTSDTQGDEAEAGEGGEN	427	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3887.2	49.34047	3	2407.983071	2407.988786	R	-	223	246
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	428	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3541.4	40.4264	4	2756.196894	2756.199676	K	E	296	321
PSM	VEIIANDQGNRTTPSYVAFTDTER	429	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3602.5	42.01773	3	2776.271771	2776.270519	K	L	26	50
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	430	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	27-UNIMOD:21	ms_run[1]:scan=1.1.4211.3	56.51406	4	3274.356494	3274.357556	R	N	282	311
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	431	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3436.5	37.71127	4	3562.484094	3562.491898	K	V	60	92
PSM	MEGPLSVFGDR	432	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4831.2	64.16977	2	1328.5421	1328.5467	-	S	1	12
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	433	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3518.2	39.84146	4	2508.0751	2508.0760	M	R	2	32
PSM	SSIGTGYDLSASTFSPDGR	434	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.3972.2	51.45912	3	2038.8521	2038.8516	M	V	2	21
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	435	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3562.5	40.98048	4	3464.570494	3464.574823	K	E	218	249
PSM	WLKSPTTPIDPEK	436	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3364.2	35.86948	3	1670.735471	1670.735807	K	Q	859	872
PSM	VLLPEYGGTK	437	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3381.2	36.29722	2	1155.555447	1155.557692	K	V	71	81
PSM	VGIDTPDIDIHGPEGK	438	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3414.3	37.13895	3	1741.789871	1741.792396	K	L	4560	4576
PSM	RIDFTPVSPAPSPTR	439	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3407.3	36.9559	3	1799.797871	1799.800867	K	G	108	123
PSM	GEAAAERPGEAAVASSPSK	440	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2720.4	19.54463	3	1863.835571	1863.836387	K	A	12	31
PSM	LDIDSPPITAR	441	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3387.2	36.44075	2	1276.600647	1276.606433	R	N	33	44
PSM	EALQDVEDENQ	442	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3047.4	27.6425	2	1288.539247	1288.541905	K	-	245	256
PSM	NGNGGPGPYVGQAGTATLPR	443	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3279.4	33.67579	3	1962.891971	1962.894904	K	N	185	205
PSM	DQIVDLTVGNNK	444	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3328.2	34.93362	2	1314.673447	1314.677945	K	T	213	225
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	445	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3109.4	29.25307	4	2779.098894	2779.094999	K	M	571	596
PSM	EGLELPEDEEEK	446	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3241.4	32.69072	2	1415.629047	1415.630385	K	K	412	424
PSM	EVDEQMLNVQNK	447	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3146.5	30.22373	2	1445.678647	1445.682044	K	N	325	337
PSM	NAEAVLQSPGLSGK	448	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3201.4	31.65713	2	1449.683847	1449.686475	R	V	849	863
PSM	VPSPLEGSEGDGDTD	449	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3249.5	32.90245	2	1553.572647	1553.577043	K	-	413	428
PSM	ALSSDSILSPAPDAR	450	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3400.4	36.77815	2	1578.724047	1578.729068	R	A	392	407
PSM	LTFDSSFSPNTGKK	451	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3325.3	34.85927	3	1607.718971	1607.723254	K	N	97	111
PSM	GRTVIIEQSWGSPK	452	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3311.3	34.49512	3	1636.793171	1636.797422	K	V	59	73
PSM	IDEMPEAAVKSTANK	453	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3024.2	27.06225	3	1682.755871	1682.758653	R	Y	30	45
PSM	ENVNATENCISAVGK	454	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3111.6	29.31212	2	1684.708647	1684.712766	K	I	964	979
PSM	IDEMPEAAVKSTANK	455	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2874.5	23.20102	3	1698.754571	1698.753568	R	Y	30	45
PSM	NLDIERPTYTNLNR	456	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3266.2	33.33043	3	1717.870271	1717.874747	R	L	216	230
PSM	LENVSQLSLDKSPTEK	457	sp|Q86W56|PARG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3254.2	33.02245	3	1866.892271	1866.897590	K	S	126	142
PSM	LENVSQLSLDKSPTEK	458	sp|Q86W56|PARG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3246.2	32.81447	3	1866.892271	1866.897590	K	S	126	142
PSM	VLDTSSLTQSAPASPTNK	459	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3209.4	31.86647	3	1895.887871	1895.887753	R	G	850	868
PSM	DSENLASPSEYPENGER	460	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3164.4	30.69002	3	1972.767071	1972.768760	R	F	617	634
PSM	VKLESPTVSTLTPSSPGK	461	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3315.5	34.60633	3	2066.888171	2066.897937	R	L	290	308
PSM	EFQDAGEQVVSSPADVAEK	462	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3329.3	34.9627	3	2084.890871	2084.893961	K	A	77	96
PSM	SAESPTSPVTSETGSTFKK	463	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3215.5	32.02585	3	2099.865971	2099.870128	K	F	280	299
PSM	SAESPTSPVTSETGSTFKK	464	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3223.4	32.2284	3	2099.867771	2099.870128	K	F	280	299
PSM	NSLDASRPAGLSPTLTPGER	465	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3348.4	35.45803	3	2197.977071	2197.976994	K	Q	138	158
PSM	TAAKGEAAAERPGEAAVASSPSK	466	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2698.2	19.0323	4	2235.058494	2235.053256	K	A	8	31
PSM	YGVQADRVDKSAVGFDYQGK	467	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3268.2	33.38198	4	2282.033694	2282.036877	K	T	162	182
PSM	EASRPPEEPSAPSPTLPAQFK	468	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3413.5	37.11873	3	2315.079371	2315.083493	R	Q	351	372
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	469	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3418.6	37.25375	3	2619.208271	2619.213536	R	D	175	200
PSM	VDIDTPDIDIHGPEGK	470	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3435.2	37.67577	3	1799.794271	1799.797876	K	L	4096	4112
PSM	SRGPATVEDLPSAFEEK	471	sp|O14908|GIPC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3542.2	40.44593	3	1911.855971	1911.861539	R	A	247	264
PSM	DSPSVWAAVPGK	472	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3566.3	41.07812	2	1292.575847	1292.580219	K	T	27	39
PSM	DITEEIMSGAR	473	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3714.4	44.90398	2	1300.535647	1300.537033	K	T	191	202
PSM	SILSPGGSCGPIK	474	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3426.3	37.45088	2	1351.615647	1351.620704	R	V	207	220
PSM	SILSPGGSCGPIK	475	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3434.3	37.65362	2	1351.615647	1351.620704	R	V	207	220
PSM	DVEDFLSPLLGK	476	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.5505.2	69.46318	2	1411.656247	1411.663614	K	T	123	135
PSM	NLEQILNGGESPK	477	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3725.3	45.18525	2	1477.677447	1477.681389	K	Q	219	232
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	478	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3511.5	39.67228	4	2989.537694	2989.541321	K	G	202	228
PSM	MLAESDESGDEESVSQTDKTELQNTLR	479	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3434.5	37.66028	4	3107.308094	3107.312580	K	T	186	213
PSM	DMSPLSETEMALGK	480	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4025.2	52.8052	2	1587.651647	1587.656162	K	D	505	519
PSM	QQEPVTSTSLVFGK	481	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3540.2	40.39377	3	1599.752771	1599.754554	K	K	1107	1121
PSM	RASGQAFELILSPR	482	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3669.2	43.74683	3	1623.811571	1623.813407	K	S	14	28
PSM	SPAGLQVLNDYLADK	483	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4234.2	57.03933	3	1682.789771	1682.791668	K	S	8	23
PSM	NRPTSISWDGLDSGK	484	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3472.2	38.64328	3	1711.751471	1711.756680	K	L	48	63
PSM	TWTTPEVTSPPPSPR	485	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3451.4	38.10135	3	1811.753471	1811.753248	R	T	125	140
PSM	AQSPGAVEEILDRENK	486	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3532.2	40.19073	3	1834.838471	1834.846223	R	R	7	23
PSM	NSDVLQSPLDSAARDEL	487	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3825.2	47.72887	3	1908.843071	1908.846617	K	-	606	623
PSM	TDGFAEAIHSPQVAGVPR	488	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3464.3	38.43678	3	1930.890971	1930.893842	R	F	2146	2164
PSM	PEIVDTCSLASPASVCR	489	sp|P09960|LKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3502.2	39.42865	3	1940.8319	1940.8368	M	T	2	19
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	490	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3713.4	44.87853	5	3385.513118	3385.515651	K	A	399	429
PSM	AAPEASSPPASPLQHLLPGK	491	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3607.3	42.13675	3	2047.013471	2047.013957	K	A	686	706
PSM	AAPEASSPPASPLQHLLPGK	492	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3757.3	46.02183	3	2126.976971	2126.980288	K	A	686	706
PSM	DLLLTSSYLSDSGSTGEHTK	493	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3723.4	45.13712	3	2189.970371	2189.972940	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	494	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3802.3	47.13417	3	2192.868971	2192.873028	R	-	228	248
PSM	SSVSRVPCNVEGISPELEK	495	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3460.5	38.33915	3	2245.966871	2245.969131	K	V	290	309
PSM	SGSSSPDSEITELKFPSINHD	496	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3857.3	48.54939	3	2325.992171	2326.000217	R	-	571	592
PSM	FVEWLQNAEEESESEGEEN	497	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4076.2	53.96217	3	2333.887271	2333.884913	K	-	401	420
PSM	DNLTLWTSENQGDEGDAGEGEN	498	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3790.5	46.8435	3	2349.941171	2349.946922	R	-	225	247
PSM	GRLTPSPDIIVLSDNEASSPR	499	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3782.2	46.66015	4	2383.081694	2383.082187	R	S	117	138
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	500	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3505.2	39.50687	5	2833.354618	2833.352672	K	S	362	389
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	501	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3507.2	39.55863	5	2833.354618	2833.352672	K	S	362	389
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	502	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	39.24588	5	2989.540618	2989.541321	K	G	202	228
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	503	sp|Q9NQC3|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4522.2	60.92655	4	3430.616494	3430.618616	R	G	58	92
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	504	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4552.2	61.46181	4	3720.685294	3720.684901	K	G	621	655
PSM	PAEKPAETPVATSPTATDSTSGDSSR	505	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2826.4	21.98755	4	2639.160894	2639.159965	K	S	148	174
PSM	MEGPLSVFGDR	506	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4185.2	55.99578	2	1344.5395	1344.5416	-	S	1	12
PSM	TEWETAAPAVAETPDIK	507	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3904.2	49.76878	3	1949.8642	1949.8654	M	L	2	19
PSM	CNTPTYCDLGK	508	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3319.4	34.70727	2	1449.5253	1449.5300	M	A	2	13
PSM	DFSPGLFEDPSVAFATPDPKK	509	sp|Q7Z5J4|RAI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4397.3	59.43872	3	2424.026171	2424.032777	K	T	681	702
PSM	SWHDVQVSSAYVK	510	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3316.2	34.62252	3	1584.693071	1584.697374	R	T	96	109
PSM	KVEEEGSPGDPDHEASTQGR	511	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2619.2	18.08837	4	2203.897694	2203.901900	R	T	309	329
PSM	GDLGIEIPAEK	512	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3414.2	37.13562	2	1140.600047	1140.602654	R	V	295	306
PSM	HAQDSDPRSPTLGIARTPMK	513	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3035.2	27.3404	4	2337.032894	2337.033797	K	T	60	80
PSM	STGCDFAVSPK	514	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3052.3	27.76853	2	1247.486847	1247.489355	K	L	501	512
PSM	HARPPDPPASAPPDSSSNSASQDTK	515	sp|Q15642|CIP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2702.4	19.13208	4	2596.121694	2596.119103	R	E	486	511
PSM	NSLDCEIVSAK	516	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3172.4	30.8996	2	1314.552647	1314.552684	K	S	423	434
PSM	NLSPGAVESDVR	517	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3344.4	35.35377	2	1322.583447	1322.586761	K	G	171	183
PSM	NGLAAELGPASPR	518	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3281.3	33.7244	2	1331.616247	1331.623480	R	R	91	104
PSM	SHSPSSPDPDTPSPVGDSR	519	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2794.2	21.18028	3	2000.811671	2000.811294	R	A	616	635
PSM	TPKGPSSVEDIK	520	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2907.4	24.05145	2	1336.623847	1336.627563	K	A	237	249
PSM	TPAAAAAMNLASPR	521	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3259.5	33.16382	2	1420.646847	1420.653400	R	T	2261	2275
PSM	NGEVVHTPETSV	522	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3027.4	27.14755	2	1427.534847	1427.537107	K	-	454	466
PSM	GEATVSFDDPPSAK	523	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3177.3	31.02678	2	1499.614447	1499.618120	K	A	335	349
PSM	HGGPGPGGPEPELSPITEGSEAR	524	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3296.6	34.12512	3	2307.008471	2307.016870	R	A	554	577
PSM	DEILPTTPISEQK	525	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3416.5	37.19787	2	1549.723447	1549.727671	K	G	215	228
PSM	NSNSPPSPSSMNQR	526	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2805.3	21.45773	2	1581.622647	1581.624285	R	R	454	468
PSM	GRTVIIEQSWGSPK	527	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3303.2	34.28983	3	1636.793171	1636.797422	K	V	59	73
PSM	IDEMPEAAVKSTANK	528	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3016.2	26.85473	3	1682.755871	1682.758653	R	Y	30	45
PSM	LVQDVANNTNEEAGDGTTTATVLAR	529	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3302.5	34.27463	3	2559.235571	2559.241253	K	S	97	122
PSM	PENVAPRSGATAGAAGGR	530	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2663.2	18.47398	3	1717.7885	1717.7892	M	G	2	20
PSM	TDSVIIADQTPTPTR	531	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3248.2	32.86575	3	1773.756971	1773.758727	R	F	42	57
PSM	MDATANDVPSPYEVR	532	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3418.2	37.24042	3	1823.680871	1823.683848	K	G	434	449
PSM	TSSVSNPQDSVGSPCSR	533	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2829.6	22.0719	3	1843.742171	1843.740772	K	V	94	111
PSM	KTDPSSLGATSASFNFGK	534	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3416.3	37.1912	3	1893.844871	1893.850974	K	K	258	276
PSM	SGKYDLDFKSPDDPSR	535	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3189.3	31.34058	3	1905.813671	1905.814588	R	Y	254	270
PSM	SERPPTILMTEEPSSPK	536	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3322.3	34.78131	3	1977.908771	1977.911860	K	G	1080	1097
PSM	SVSTPSEAGSQDSGDGAVGSR	537	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2793.2	21.14197	3	2029.821371	2029.822587	K	T	92	113
PSM	NHSDSSTSESEVSSVSPLK	538	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2963.5	25.50053	3	2055.861071	2055.863389	K	N	211	230
PSM	KQEETAVLEEDSADWEK	539	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3307.5	34.39987	3	2085.872771	2085.877977	K	E	302	319
PSM	NGSLDSPGKQDTEEDEEEDEK	540	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2759.3	20.3157	3	2349.953171	2349.956818	K	D	134	155
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	541	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3064.3	28.08055	5	2769.243118	2769.239553	K	V	100	125
PSM	SQPEPSPVLSQLSQR	542	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3441.2	37.83225	3	1731.816371	1731.819280	K	Q	427	442
PSM	NSVTPDMMEEMYKK	543	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	38.32915	3	1781.703371	1781.707546	K	A	229	243
PSM	SSLEAASFWGE	544	sp|Q9BVS4|RIOK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4288.2	57.98932	2	1262.482247	1262.485650	K	-	542	553
PSM	SASDLSEDLFK	545	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3782.3	46.66348	2	1290.535247	1290.538079	K	V	650	661
PSM	TAFQEALDAAGDK	546	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3478.5	38.81082	2	1335.626647	1335.630660	K	L	9	22
PSM	LDIDSPPITAR	547	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3510.4	39.64328	2	1356.568847	1356.572764	R	N	33	44
PSM	DNALLSAIEESR	548	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4163.2	55.66438	2	1396.620847	1396.623540	K	K	107	119
PSM	IMNTFSVVPSPK	549	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3643.3	43.07013	2	1398.659847	1398.661840	R	V	163	175
PSM	TVIIEQSWGSPK	550	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3503.4	39.4613	2	1423.671447	1423.674847	R	V	61	73
PSM	YHTSQSGDEMTSLSEYVSR	551	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3508.5	39.59468	3	2255.910971	2255.904208	R	M	457	476
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	552	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3822.3	47.65335	4	3013.337294	3013.339266	K	V	8	36
PSM	DWALSSAAAVMEER	553	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4100.2	54.44775	3	1614.674771	1614.674924	K	K	547	561
PSM	LTESPCALVASQYGWSGNMER	554	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3967.3	51.335	3	2435.028071	2435.028697	R	I	640	661
PSM	IFVGGLSPDTPEEK	555	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3675.5	43.91413	2	1647.678647	1647.683437	K	I	184	198
PSM	GVLFGVPGAFTPGCSK	556	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4067.2	53.75385	3	1672.767971	1672.768430	K	T	87	103
PSM	GVLFGVPGAFTPGCSK	557	sp|P30044|PRDX5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4077.2	53.98823	3	1672.767971	1672.768430	K	T	87	103
PSM	SPAGLQVLNDYLADK	558	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4239.2	57.16268	2	1682.789647	1682.791668	K	S	8	23
PSM	APNTPDILEIEFKK	559	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3746.3	45.73487	3	1693.831271	1693.832805	K	G	216	230
PSM	ISLPGQMAGTPITPLK	560	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3905.2	49.78527	3	1782.838271	1782.839226	K	D	213	229
PSM	MYFPDVEFDIKSPK	561	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3983.2	51.75932	3	1794.790271	1794.793976	K	F	5088	5102
PSM	DRSSFYVNGLTLGGQK	562	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3641.2	43.01412	3	1820.842571	1820.845829	K	C	55	71
PSM	WLDDLLASPPPSGGGAR	563	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4388.2	59.3046	3	1867.790471	1867.790696	R	R	684	701
PSM	VSSGYVPPPVATPFSSK	564	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3571.3	41.20917	3	1878.823271	1878.820599	R	S	168	185
PSM	KYEQGFITDPVVLSPK	565	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3639.2	42.96187	3	1899.937871	1899.938332	K	D	109	125
PSM	VGINYQPPTVVPGGDLAK	566	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3695.3	44.42855	3	1903.944971	1903.944480	K	V	353	371
PSM	SATSSSPGSPLHSLETSL	567	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4289.2	58.0162	3	1916.777171	1916.780585	K	-	1203	1221
PSM	DLKPSNLLLNTTCDLK	568	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3669.3	43.7535	3	1923.936071	1923.937681	R	I	149	165
PSM	SSTPPGESYFGVSSLQLK	569	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3976.3	51.56688	3	1962.895571	1962.897590	K	G	1041	1059
PSM	NSDVLQSPLDSAARDEL	570	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3998.2	52.13655	3	1988.811671	1988.812948	K	-	606	623
PSM	DRDVTFSPATIENELIK	571	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4253.2	57.43143	3	2026.961771	2026.961253	K	F	46	63
PSM	DNLTLWTSDQQDDDGGEGNN	572	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3834.4	47.96932	3	2192.868971	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	573	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3842.3	48.1784	3	2192.868971	2192.873028	R	-	228	248
PSM	YLLSQSSPAPLTAAEEELR	574	sp|Q12792|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4363.2	58.87993	3	2233.990571	2233.990912	K	Q	137	156
PSM	QQPPEPEWIGDGESTSPSDK	575	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3475.5	38.73203	3	2262.925271	2262.931803	K	V	7	27
PSM	DTPENNPDTPFDFTPENYK	576	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3853.3	48.44635	3	2319.914171	2319.920904	R	R	43	62
PSM	DYEIESQNPLASPTNTLLGSAK	577	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4214.2	56.58183	3	2507.084771	2507.086998	K	E	618	640
PSM	SQEGESVTEDISFLESPNPENK	578	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3959.3	51.16025	3	2515.062071	2515.063940	K	D	81	103
PSM	SQEGESVTEDISFLESPNPENK	579	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3951.4	50.9554	3	2515.062071	2515.063940	K	D	81	103
PSM	FNEEHIPDSPFVVPVASPSGDAR	580	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3865.2	48.75533	4	2626.111294	2626.114215	K	R	2311	2334
PSM	GYISPYFINTSK	581	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3814.3	47.44528	2	1469.663447	1468.663948	R	G	222	234
PSM	TIGGGDDSFNTFFSETGAGK	582	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4036.2	53.03525	3	2086.850471	2086.852096	K	H	41	61
PSM	MDATANDVPSPYEVR	583	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3328.5	34.94361	2	1743.711847	1743.717517	K	G	434	449
PSM	MEGPLSVFGDR	584	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4161.2	55.62298	2	1344.5395	1344.5416	-	S	1	12
PSM	AAAVAAAGAGEPQSPDELLPK	585	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4042.3	53.18062	3	2083.9784	2083.9822	M	G	2	23
PSM	PFSAPKPQTSPSPK	586	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2893.4	23.68908	3	1547.739071	1547.738510	K	R	299	313
PSM	ADDLDFETGDAGASATFPMQCSALRK	587	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.4097.2	54.39928	3	2895.2053	2895.2087	M	N	2	28
PSM	GPPQSPVFEGVYNNSR	588	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3470.3	38.59447	3	1827.799271	1826.798879	K	M	107	123
PSM	ADQLTEEQIAEFK	589	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3850.2	48.36873	2	1562.7362	1562.7462	M	E	2	15
PSM	ASGADSKGDDLSTAILK	590	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3517.2	39.8153	3	1769.8069	1769.8079	M	Q	2	19
PSM	MEAAGSPAATETGK	591	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3024.5	27.07225	2	1441.5785	1441.5791	-	Y	1	15
PSM	QREEYQPATPGLGMFVEVKDPEDK	592	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3915.5	50.05255	4	2825.2568	2825.2614	K	V	72	96
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	593	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4631.2	62.37553	3	2620.049471	2620.055380	K	S	180	204
PSM	THSVNGITEEADPTIYSGK	594	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3211.3	31.91527	3	2098.922471	2097.925596	K	V	582	601
PSM	CNTPTYCDLGK	595	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3303.4	34.2965	2	1449.5253	1449.5300	M	A	2	13
PSM	GGSGSHNWGTVKDELTESPK	596	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3186.3	31.26238	4	2164.950094	2164.942643	R	Y	217	237
PSM	VLLPEYGGTK	597	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3372.5	36.08862	2	1155.555447	1155.557692	K	V	71	81
PSM	GASLKSPLPSQ	598	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3074.2	28.33812	2	1163.558047	1163.558755	K	-	113	124
PSM	TDYNASVSVPDSSGPER	599	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3138.3	30.00833	3	1859.759471	1859.757467	R	I	70	87
PSM	ALINSPEGAVGR	600	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3257.2	33.10102	2	1262.597447	1262.602017	R	S	66	78
PSM	SVNGGPGSPDLAR	601	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2879.4	23.32702	2	1305.576047	1305.571445	R	H	982	995
PSM	GAGAGHPGAGGAQPPDSPAGVR	602	sp|Q13884|SNTB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2790.5	21.07568	3	1962.871271	1962.869752	R	T	71	93
PSM	DFAARSPSASITDEDSNV	603	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3419.2	37.26653	3	1960.802171	1960.805146	K	-	994	1012
PSM	VIGSGCNLDSAR	604	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3012.3	26.75498	2	1327.556047	1327.559166	R	F	158	170
PSM	NGEVVHTPETSV	605	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2986.4	26.09742	2	1347.567047	1347.570776	K	-	454	466
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	606	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3113.5	29.3606	4	2712.262094	2712.264371	K	T	139	165
PSM	MDSTANEVEAVK	607	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2941.5	24.93213	2	1372.558047	1372.558163	K	V	425	437
PSM	SPSGPVKSPPLSPVGTTPVK	608	sp|Q9BVC5|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3224.4	32.25365	3	2091.001871	2091.005440	K	L	182	202
PSM	NQIHVKSPPREGSQGELTPANSQSR	609	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2877.6	23.28182	4	2796.334494	2796.330434	R	M	462	487
PSM	GILAADESTGSIAK	610	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3201.3	31.6538	2	1411.658247	1411.659591	K	R	29	43
PSM	NGEVVHTPETSV	611	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3011.4	26.73283	2	1427.534847	1427.537107	K	-	454	466
PSM	DNPGVVTCLDEAR	612	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3273.5	33.5227	2	1444.657647	1444.661643	K	H	227	240
PSM	AQAAAPASVPAQAPK	613	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2855.5	22.70975	2	1456.707447	1456.707544	K	R	135	150
PSM	PCSEETPAISPSK	614	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2839.3	22.32815	2	1481.6123	1481.6104	M	R	2	15
PSM	AQQNNVEHKVETFSGVYK	615	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3203.6	31.71582	3	2236.954871	2236.955530	K	K	161	179
PSM	SARDHAISLSEPR	616	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2931.4	24.67422	3	1517.697071	1517.698771	R	M	792	805
PSM	SSSPVQVEEEPVR	617	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3014.5	26.81293	2	1521.665647	1521.671219	R	L	116	129
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	618	sp|O75381|PEX14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2910.6	24.13635	4	3200.389294	3200.389524	K	E	247	279
PSM	VAAETQSPSLFGSTK	619	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3284.6	33.81288	2	1601.730247	1601.733819	K	L	215	230
PSM	SQDATFSPGSEQAEKSPGPIVSR	620	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3154.6	30.4358	3	2454.106271	2454.106414	R	T	329	352
PSM	GRTVIIEQSWGSPK	621	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3295.2	34.08618	3	1636.793171	1636.797422	K	V	59	73
PSM	AQQATPGGAAPTIFSR	622	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3393.4	36.59642	2	1651.765047	1651.771936	K	I	43	59
PSM	KQPPVSPGTALVGSQK	623	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3022.2	27.01045	3	1672.849571	1672.854937	R	E	31	47
PSM	GEPAAAAAPEAGASPVEK	624	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2903.5	23.95145	3	1701.760871	1701.761096	K	E	88	106
PSM	QNSVQEQPGTACLSK	625	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2859.4	22.80967	3	1725.737771	1725.739315	K	F	223	238
PSM	SSTPLPTISSSAENTR	626	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	31.18007	3	1726.775771	1726.777475	R	Q	158	174
PSM	LKGEATVSFDDPPSAK	627	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3133.3	29.87805	3	1740.799871	1740.797147	K	A	333	349
PSM	TPKTPKGPSSVEDIK	628	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2927.2	24.56398	3	1742.785571	1742.789299	K	A	234	249
PSM	FSEGVLQSPSQDQEK	629	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3195.3	31.49753	3	1757.752271	1757.750926	R	L	428	443
PSM	IDEMPEAAVKSTANK	630	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3016.3	26.85807	3	1762.724171	1762.724984	R	Y	30	45
PSM	LPSAQTPNGTDYVASGK	631	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3102.3	29.06595	3	1784.793371	1784.798210	R	S	1960	1977
PSM	AVEHINKTIAPALVSK	632	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3154.4	30.42913	3	1849.910171	1849.910417	K	K	65	81
PSM	DNEESEQPPVPGTPTLR	633	sp|O15439|MRP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3259.3	33.15715	3	1944.843671	1944.846617	K	N	634	651
PSM	HRVIGSGCNLDSARFR	634	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3125.2	29.66532	4	2003.855294	2003.855045	K	Y	157	173
PSM	VKLESPTVSTLTPSSPGK	635	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3323.6	34.81728	3	2066.888171	2066.897937	R	L	290	308
PSM	SHSPSSPDPDTPSPVGDSR	636	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2835.3	22.2166	3	2080.778171	2080.777625	R	A	616	635
PSM	AKPSPAPPSTTTAPDASGPQK	637	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2775.4	20.70517	3	2084.977271	2084.977965	K	R	32	53
PSM	SAESPTSPVTSETGSTFKK	638	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3239.4	32.63835	3	2099.865971	2099.870128	K	F	280	299
PSM	SAESPTSPVTSETGSTFKK	639	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3231.4	32.43055	3	2099.865971	2099.870128	K	F	280	299
PSM	TPSPKEEDEEPESPPEKK	640	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2676.2	18.59297	4	2131.922094	2131.919841	K	T	202	220
PSM	HTGCCGDNDPIDVCEIGSK	641	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3182.5	31.16407	3	2132.853071	2132.856139	K	V	110	129
PSM	QAHDLSPAAESSSTFSFSGR	642	sp|O95425|SVIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3412.3	37.08643	3	2160.913571	2160.911342	R	D	216	236
PSM	GHTDTEGRPPSPPPTSTPEK	643	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2729.3	19.71552	4	2246.928894	2246.924624	R	C	353	373
PSM	ELEREESGAAESPALVTPDSEK	644	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3098.6	28.97183	3	2423.069171	2423.074110	K	S	173	195
PSM	ADTSQEICSPRLPISASHSSK	645	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3260.2	33.17983	4	2430.028894	2430.028771	K	T	1020	1041
PSM	NCQTVLAPCSPNPCENAAVCK	646	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3245.5	32.79805	3	2468.992571	2468.994638	K	E	829	850
PSM	ELEREESGAAESPALVTPDSEK	647	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3097.6	28.94575	3	2503.038671	2503.040441	K	S	173	195
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	648	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2994.5	26.30397	4	2968.357694	2968.358028	R	L	420	447
PSM	DLNVLTPTGF	649	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4469.2	60.169	2	1155.518647	1155.521307	R	-	296	306
PSM	DLNVLTPTGF	650	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4451.2	59.95553	2	1155.518647	1155.521307	R	-	296	306
PSM	GTPLISPLIK	651	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3900.3	49.6567	2	1197.578247	1197.581144	R	W	826	836
PSM	SADTLWDIQK	652	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3689.3	44.2742	2	1255.544447	1255.548584	K	D	320	330
PSM	LDIDSPPITAR	653	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3454.4	38.17968	2	1276.603447	1276.606433	R	N	33	44
PSM	SLNILTAFQK	654	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4606.2	62.1539	2	1293.573447	1293.577121	K	K	244	254
PSM	ADIDVSGPKVDIDTPDIDIHGPEGK	655	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3638.4	42.94193	4	2682.247694	2682.242573	K	L	4087	4112
PSM	SASYKYSEEANNLIEECEQAER	656	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3716.2	44.94865	4	2699.106894	2699.105821	K	L	115	137
PSM	LDIDSPPITAR	657	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3494.4	39.22638	2	1356.568847	1356.572764	R	N	33	44
PSM	GLGLSPDLVVCR	658	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3827.2	47.78098	2	1364.650447	1364.652338	R	C	206	218
PSM	NLSSPFIFHEK	659	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3605.4	42.09127	2	1397.635847	1397.638068	R	T	644	655
PSM	DINTFVGTPVEK	660	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3430.3	37.55212	2	1398.639247	1398.643213	K	L	1916	1928
PSM	WPDPEDLLTPR	661	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4027.2	52.83828	2	1417.625447	1417.627897	R	W	39	50
PSM	IILDLISESPIK	662	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4136.2	55.14022	2	1419.758847	1419.762600	K	G	208	220
PSM	TVIIEQSWGSPK	663	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3495.3	39.24922	2	1423.671447	1423.674847	R	V	61	73
PSM	PVQETQAPESPGENSEQALQTLSPR	664	sp|Q7Z434-4|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3495.4	39.25255	4	2852.2236	2852.2262	M	A	2	27
PSM	TVDNFVALATGEK	665	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3559.3	40.89525	2	1443.655847	1443.664677	K	G	72	85
PSM	CLELFSELAEDK	666	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3977.3	51.60298	2	1452.679247	1452.680647	K	E	412	424
PSM	NIEIDSPYEISR	667	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3516.5	39.79962	2	1514.664247	1514.665405	K	A	380	392
PSM	TQVLSPDSLFTAK	668	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4106.2	54.59718	2	1565.675847	1565.677958	K	F	1717	1730
PSM	ISMQDVDLSLGSPK	669	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3827.3	47.78432	2	1568.709647	1568.715726	K	L	500	514
PSM	RASGQAFELILSPR	670	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3693.2	44.37442	3	1623.811571	1623.813407	K	S	14	28
PSM	IFVGGLSPDTPEEK	671	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3667.4	43.70225	2	1647.678647	1647.683437	K	I	184	198
PSM	DDGLFSGDPNWFPK	672	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4576.2	61.82682	2	1673.669647	1673.676304	R	K	140	154
PSM	APNTPDILEIEFKK	673	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3754.2	45.94017	3	1693.831271	1693.832805	K	G	216	230
PSM	SSGSEGSSPNWLQALK	674	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3903.2	49.72915	3	1726.755671	1726.756345	K	L	1708	1724
PSM	NQLTSNPENTVFDAK	675	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3480.5	38.86347	2	1756.763047	1756.766910	K	R	82	97
PSM	AAALAAAVAQDPAASGAPSS	676	sp|Q8TAE8|G45IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3443.2	37.88428	3	1775.805971	1775.809109	R	-	203	223
PSM	RTLDFDPLLSPASPK	677	sp|Q53H80|AKIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4056.2	53.53847	3	1815.815171	1815.820934	K	R	9	24
PSM	TSDSPWFLSGSETLGR	678	sp|O95071|UBR5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4102.2	54.51098	3	1818.784871	1818.782560	R	L	107	123
PSM	GPPQSPVFEGVYNNSR	679	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3478.2	38.80082	3	1826.793671	1826.798879	K	M	107	123
PSM	DWILPSDYDHAEAEAR	680	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3651.2	43.27602	3	1886.839271	1886.843506	K	H	256	272
PSM	GFSEGLWEIENNPTVK	681	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3975.3	51.54408	3	1898.842571	1898.845160	K	A	81	97
PSM	EVDGLLTSEPMGSPVSSK	682	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3639.3	42.9652	3	1911.854771	1911.853676	K	T	582	600
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	683	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4088.3	54.2195	4	3836.406094	3836.405155	K	A	469	503
PSM	SAESPTSPVTSETGSTFK	684	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3427.2	37.47255	3	1971.774071	1971.775165	K	K	280	298
PSM	DMGAQYAAASPAWAAAQQR	685	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3547.4	40.58348	3	2042.862071	2042.866975	K	S	478	497
PSM	LHIIEVGTPPTGNQPFPK	686	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3807.3	47.26473	3	2103.977771	2103.979560	K	K	228	246
PSM	DNLTLWTSDMQGDGEEQNK	687	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3778.2	46.56199	3	2179.926371	2179.932792	R	E	226	245
PSM	EIFDSRGNPTVEVDLFTSK	688	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4206.3	56.45105	3	2312.990171	2312.996726	R	G	10	29
PSM	DTPENNPDTPFDFTPENYK	689	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3844.4	48.22933	3	2319.914171	2319.920904	R	R	43	62
PSM	TQDPAKAPNTPDILEIEFKK	690	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3603.2	42.0337	4	2334.151694	2334.150844	K	G	210	230
PSM	DYEEVGVDSVEGEGEEEGEEY	691	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3735.5	45.45347	3	2347.892171	2347.897571	K	-	431	452
PSM	ADLLLSTQPGREEGSPLELER	692	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3699.3	44.52968	3	2389.148471	2389.152635	K	L	593	614
PSM	AAVPSGASTGIYEALELRDNDK	693	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3979.2	51.64492	4	2436.060494	2436.061117	R	T	33	55
PSM	DNLTLWTSDSAGEECDAAEGAEN	694	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3888.2	49.35665	3	2453.974271	2453.976507	R	-	223	246
PSM	SSSSESEDEDVIPATQCLTPGIR	695	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3635.5	42.86633	3	2557.084571	2557.089109	R	T	996	1019
PSM	SSSSESEDEDVIPATQCLTPGIR	696	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3627.6	42.66132	3	2557.084571	2557.089109	R	T	996	1019
PSM	TQEDEEEISTSPGVSEFVSDAFDACNLNQEDLRK	697	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=1.1.4353.2	58.76072	4	3938.666894	3938.667733	K	E	259	293
PSM	DDDIAALVVDNGSGMCK	698	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4134.3	55.08797	3	1916.7509	1916.7528	M	A	2	19
PSM	SAESPTSPVTSETGSTFK	699	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3435.4	37.68243	3	1972.777271	1971.775165	K	K	280	298
PSM	NGSLDSPGKQDTEEDEEEDEKDK	700	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2824.6	21.94233	4	2674.027694	2673.045055	K	G	134	157
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	701	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2766.2	20.47565	4	3105.314494	3104.322430	K	S	145	174
PSM	ADLSLADALTEPSPDIEGEIKR	702	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4363.3	58.88993	3	2461.1596	2461.1620	M	D	2	24
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	703	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3848.5	48.32995	3	2749.2235	2749.2301	-	Y	1	25
PSM	LSPPYSSPQEFAQDVGR	704	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3727.4	45.24113	3	1957.863071	1956.861873	K	M	751	768
PSM	AESSESFTMASSPAQR	705	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3169.3	30.81765	3	1822.7087	1822.7076	M	R	2	18
PSM	SSIGTGYDLSASTFSPDGR	706	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.3980.4	51.67451	3	2038.8521	2038.8516	M	V	2	21
PSM	AFKDTGKTPVEPEVAIHR	707	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3336.2	35.13933	4	2196.0027	2196.0012	M	I	2	20
PSM	KYEMFAQTLQQSR	708	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3458.2	38.2774	3	1788.725171	1788.730738	R	G	754	767
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	709	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3677.5	43.96687	4	2882.1852	2882.1622	M	D	2	29
PSM	QQPPEPEWIGDGESTSPSDK	710	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.3805.2	47.20912	3	2245.9021	2245.9047	K	V	7	27
PSM	MNLLPNIESPVTRQEK	711	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4199.2	56.27643	3	1989.9539	1989.9590	-	M	1	17
PSM	DVQDSLTVSNEAQTAK	712	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3129.3	29.77272	3	1784.783171	1784.782954	K	E	211	227
PSM	SGPDVETPSAIQICR	713	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3642.2	43.04085	3	1750.7588	1750.7592	M	I	2	17
PSM	SAGLFQNPK	714	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3159.2	30.5525	2	1040.468647	1040.469212	R	Q	233	242
PSM	AGDLLEDSPK	715	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3066.2	28.12855	2	1123.480247	1123.479836	R	R	158	168
PSM	DLHQPSLSPASPHSQGFER	716	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3262.2	33.23062	4	2248.929294	2248.930378	K	G	58	77
PSM	QLSSGVSEIR	717	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3096.3	28.90955	2	1154.530847	1154.533268	R	H	80	90
PSM	TISPMVMDAK	718	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3293.3	34.03805	2	1171.499247	1171.501834	K	A	793	803
PSM	VPPAPVPCPPPSPGPSAVPSSPK	719	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3421.2	37.31875	4	2378.072494	2378.078288	K	S	366	389
PSM	DPNSPLYSVK	720	sp|Q9NUU7|DD19A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3188.3	31.31442	2	1198.525047	1198.527120	R	S	82	92
PSM	SNSPLPVPPSK	721	sp|Q13247|SRSF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2967.6	25.6082	2	1201.570247	1201.574405	R	A	301	312
PSM	LEGQGDVPTPK	722	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2915.3	24.2559	2	1219.547447	1219.548584	K	Q	257	268
PSM	EAESSPFVER	723	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2969.2	25.64725	2	1229.493447	1229.496549	K	L	548	558
PSM	DGNGYISAAELR	724	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3338.3	35.1942	2	1264.601247	1264.604780	K	H	96	108
PSM	SGKYDLDFKSPDDPSR	725	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3173.3	30.92248	3	1905.813671	1905.814588	R	Y	254	270
PSM	ELISNASDALDK	726	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3212.2	31.93798	2	1274.634447	1274.635411	R	I	103	115
PSM	LDIDSPPITAR	727	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3378.3	36.2324	2	1276.600647	1276.606433	R	N	33	44
PSM	NIGRDTPTSAGPNSFNK	728	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2997.4	26.37428	3	1934.789471	1934.792487	K	G	134	151
PSM	SSPNPFVGSPPK	729	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3173.4	30.92582	2	1292.577647	1292.580219	K	G	393	405
PSM	EDQTEYLEER	730	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3023.4	27.04307	2	1310.559447	1310.562640	K	R	166	176
PSM	NLSPGAVESDVR	731	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	35.5592	2	1322.583447	1322.586761	K	G	171	183
PSM	KQSKPVTTPEEIAQVATISANGDK	732	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3358.4	35.71983	4	2671.251294	2671.250709	K	E	157	181
PSM	TPKGPSSVEDIK	733	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2899.5	23.84702	2	1336.623847	1336.627563	K	A	237	249
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	734	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3245.2	32.78805	4	2717.305294	2717.307830	R	R	31	56
PSM	SHSPSSPDPDTPSPVGDSR	735	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2844.4	22.42558	3	2080.778171	2080.777625	R	A	616	635
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	736	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,18-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2781.3	20.8583	5	3503.289118	3503.284224	R	A	81	114
PSM	SMGTGDTPGLEVPSSPLRK	737	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3351.2	35.5295	3	2103.895271	2103.894904	R	A	381	400
PSM	DRVHHEPQLSDK	738	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2564.2	17.59455	3	1459.715771	1459.716790	K	V	26	38
PSM	SLYASSPGGVYATR	739	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3277.6	33.63045	2	1507.665047	1507.670825	R	S	51	65
PSM	LRECELSPGVNR	740	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2942.2	24.94735	3	1508.677271	1508.680678	R	D	487	499
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	741	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2756.3	20.23572	4	3024.360894	3024.356099	K	S	145	174
PSM	PAETPVATSPTATDSTSGDSSR	742	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2790.6	21.07902	3	2293.905371	2293.898862	K	S	152	174
PSM	YADEEIPRSPFK	743	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3285.2	33.82561	3	1530.673571	1530.675576	K	V	1497	1509
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	744	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21,21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3388.2	36.46487	4	3071.292894	3071.294441	R	V	221	251
PSM	DTCYSPKPSVYLSTPSSASK	745	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3396.5	36.67792	3	2333.945471	2333.952813	K	A	538	558
PSM	ESVPEFPLSPPKKK	746	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3300.2	34.21363	3	1661.840771	1661.842975	K	D	30	44
PSM	RITSPLMEPSSIEK	747	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	34.54393	3	1666.796171	1666.800124	K	I	53	67
PSM	HSGPNSADSANDGFVR	748	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2880.5	23.35628	3	1709.679071	1709.679492	K	L	99	115
PSM	NQTAEKEEFEHQQK	749	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2609.2	18.00657	4	1744.804094	1744.801642	K	E	584	598
PSM	ATEPPSPDAGELSLASR	750	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3359.2	35.73922	3	1776.792671	1776.793125	K	L	720	737
PSM	RADLNQGIGEPQSPSR	751	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2918.2	24.33028	4	1803.826894	1803.826490	R	R	62	78
PSM	RADLNQGIGEPQSPSR	752	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2910.2	24.12302	4	1803.826894	1803.826490	R	R	62	78
PSM	MLDAEDIVNTARPDEK	753	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	35.7165	3	1895.833871	1895.833609	K	A	240	256
PSM	ERSPALKSPLQSVVVR	754	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3339.4	35.22322	3	1924.947671	1924.953679	R	R	246	262
PSM	GINSSNVENQLQATQAAR	755	sp|P52292|IMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	35.32088	3	1979.893271	1979.906197	K	K	84	102
PSM	DGGRSSPGGQDEGGFMAQGK	756	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3000.4	26.45017	3	2016.801071	2016.799683	R	T	298	318
PSM	DGARPDVTESESGSPEYR	757	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2924.6	24.49957	3	2030.819471	2030.821859	K	Q	425	443
PSM	NQGGYGGSSSSSSYGSGRRF	758	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2966.4	25.57535	3	2076.825071	2076.828675	R	-	353	373
PSM	KGTENGVNGTLTSNVADSPR	759	sp|Q15629|TRAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2961.5	25.44848	3	2095.952171	2095.953542	K	N	348	368
PSM	NTNDANSCQIIIPQNQVNR	760	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3219.3	32.1229	3	2198.045471	2198.049828	K	K	310	329
PSM	CGNTIPDDDNQVVSLSPGSR	761	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3399.4	36.75183	3	2209.927571	2209.931092	R	Y	643	663
PSM	APVQPQQSPAAAPGGTDEKPSGK	762	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2721.4	19.56293	4	2297.070894	2297.068906	K	E	9	32
PSM	RGGSGSHNWGTVKDELTESPK	763	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3101.2	29.03682	4	2321.042494	2321.043754	K	Y	216	237
PSM	EHYPVSSPSSPSPPAQPGGVSR	764	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3077.6	28.4294	3	2378.993771	2378.993372	K	N	2036	2058
PSM	SISSPSVSSETMDKPVDLSTRK	765	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3208.4	31.83997	4	2430.136094	2430.134936	K	E	2802	2824
PSM	IVRGDQPAASGDSDDDEPPPLPR	766	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3131.2	29.82217	4	2483.100894	2483.096577	K	L	45	68
PSM	HSPNLSFEPNFCQDNPRSPTSSK	767	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3355.5	35.64438	4	2725.155294	2725.159194	K	E	107	130
PSM	HSPNLSFEPNFCQDNPRSPTSSK	768	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3363.3	35.84663	4	2725.155294	2725.159194	K	E	107	130
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	769	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3353.5	35.59185	4	2853.388894	2853.390968	K	K	62	95
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	770	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3078.6	28.45488	4	3112.506494	3112.507789	R	S	847	876
PSM	RASGQAFELILSPR	771	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3661.2	43.53763	3	1623.811571	1623.813407	K	S	14	28
PSM	STFVLDEFK	772	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3915.4	50.04922	2	1164.508047	1164.510408	K	R	286	295
PSM	LVLDSVKLEA	773	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3749.2	45.80985	2	1165.596047	1165.599557	R	-	99	109
PSM	ESAFEFLSSA	774	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4607.2	62.17875	2	1166.449847	1166.453287	K	-	325	335
PSM	VLPGVDALSNI	775	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4215.2	56.6078	2	1176.577647	1176.579156	K	-	407	418
PSM	QVPDSAATATAYLCGVK	776	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3638.3	42.9386	3	1830.820571	1830.822317	R	A	107	124
PSM	GEWFLLGSPGS	777	sp|Q96T76|MMS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5702.2	70.77317	2	1228.512447	1228.516556	R	-	1020	1031
PSM	NLEELNISSAQ	778	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3644.4	43.10003	2	1296.559247	1296.559877	K	-	120	131
PSM	LHIIEVGTPPTGNQPFPK	779	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3799.4	47.0607	3	2103.977771	2103.979560	K	K	228	246
PSM	ESVPEFPLSPPK	780	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3752.3	45.89137	2	1405.650647	1405.653049	K	K	30	42
PSM	TLTIVDTGIGMTK	781	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3660.3	43.51503	2	1428.688847	1428.693534	R	A	28	41
PSM	YHTSQSGDEMTSLSEYVSR	782	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3445.4	37.94361	3	2175.932771	2175.937877	R	M	457	476
PSM	DVSPDLSCADEISECYHK	783	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3496.4	39.2786	3	2203.841171	2203.843917	K	L	53	71
PSM	QASPNIVIALAGNK	784	sp|P51148|RAB5C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3749.6	45.82318	2	1474.753447	1474.754495	R	A	122	136
PSM	GASSPLITVFTDDK	785	sp|Q15155|NOMO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3944.2	50.78267	2	1529.699847	1529.701456	K	G	822	836
PSM	QVEEQSAAANEEVLFPFCR	786	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4155.2	55.49398	3	2302.990271	2302.992964	K	E	218	237
PSM	IQQALTSPLPMTPILEGSHR	787	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3898.5	49.61072	3	2348.094971	2348.100086	R	A	421	441
PSM	DMSPLSETEMALGK	788	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4017.2	52.58447	2	1587.651647	1587.656162	K	D	505	519
PSM	KKSPNELVDDLFK	789	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3638.2	42.93527	3	1611.792971	1611.790940	R	G	112	125
PSM	NREPLMPSPQFIK	790	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3552.2	40.70802	3	1635.791771	1635.784415	K	S	246	259
PSM	VSMPDVELNLKSPK	791	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3568.2	41.12703	3	1635.791771	1635.794311	K	V	3415	3429
PSM	KIFVGGLSPDTPEEK	792	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3519.2	39.86772	3	1775.772671	1775.778400	K	I	183	198
PSM	YAQDFGLVEEACFPYTGTDSPCK	793	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.4163.3	55.67439	3	2734.095671	2734.096837	K	M	310	333
PSM	DSLSPVLHPSDLILTR	794	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4020.3	52.66875	3	1841.928071	1841.928830	K	G	311	327
PSM	DMASPNWSILPEEER	795	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3892.3	49.4652	3	1868.762471	1868.765196	R	N	327	342
PSM	SESAPTLHPYSPLSPK	796	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3422.3	37.34845	3	1869.790271	1869.795113	R	G	100	116
PSM	SLSTSGESLYHVLGLDK	797	sp|Q9H3Z4|DNJC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4245.2	57.27062	3	1884.887771	1884.887025	R	N	8	25
PSM	TFEEDPAVGAIVLTGGDK	798	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3763.2	46.1753	3	1897.871471	1897.871041	K	A	75	93
PSM	GSLESPATDVFGSTEEGEK	799	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3663.4	43.597	3	2018.833271	2018.835777	K	R	331	350
PSM	DQLIYNLLKEEQTPQNK	800	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3929.3	50.4037	3	2153.037971	2153.040566	K	I	6	23
PSM	DNLTLWTSDQQDDDGGEGNN	801	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3826.4	47.76159	3	2192.868971	2192.873028	R	-	228	248
PSM	YHTSQSGDEMTSLSEYVSR	802	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3581.4	41.46848	3	2255.904071	2255.904208	R	M	457	476
PSM	GFFICDQPYEPVSPYSCK	803	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3980.5	51.67785	3	2272.919171	2272.921045	R	E	676	694
PSM	NALESYAFNMKSAVEDEGLK	804	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4040.3	53.13975	3	2295.011771	2295.013030	K	G	540	560
PSM	TQDPAKAPNTPDILEIEFKK	805	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3595.2	41.82409	4	2334.151694	2334.150844	K	G	210	230
PSM	IQQALTSPLPMTPILEGSHR	806	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3899.2	49.62713	4	2348.097294	2348.100086	R	A	421	441
PSM	DNLTLWTSENQGDEGDAGEGEN	807	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3799.5	47.06403	3	2349.941171	2349.946922	R	-	225	247
PSM	TLEAEFNSPSPPTPEPGEGPR	808	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3536.5	40.29917	3	2367.960971	2367.966154	K	K	525	546
PSM	DNLTLWTSDTQGDEAEAGEGGEN	809	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3863.5	48.71262	3	2407.981871	2407.988786	R	-	223	246
PSM	QSKPVTTPEEIAQVATISANGDK	810	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3463.4	38.41372	3	2463.184271	2463.189415	K	E	158	181
PSM	QSKPVTTPEEIAQVATISANGDK	811	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3507.6	39.57197	3	2543.147771	2543.155746	K	E	158	181
PSM	DNLTLWTADNAGEEGGEAPQEPQS	812	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4068.3	53.79072	3	2608.057871	2608.060251	R	-	225	249
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	813	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3472.5	38.65328	4	2654.188894	2654.189112	K	K	453	479
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	814	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.4906.2	64.8724	4	2952.321294	2952.330281	R	S	59	86
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	815	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3428.4	37.50442	5	3562.493118	3562.491898	K	V	60	92
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	816	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2953.4	25.2442	5	3566.429618	3565.448950	K	D	124	155
PSM	GGNFGGRSSGPYGGGGQYFAK	817	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3272.4	33.4935	3	2099.882471	2099.885068	K	P	278	299
PSM	SPAVATSTAAPPPPSSPLPSK	818	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3092.6	28.81593	3	2038.994771	2038.997638	K	S	439	460
PSM	ESVPEFPLSPPK	819	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3736.4	45.47613	2	1405.650647	1405.653049	K	K	30	42
PSM	IDEMPEAAVKSTANK	820	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2856.4	22.73225	3	1698.752771	1698.753568	R	Y	30	45
PSM	ATGANATPLDFPSK	821	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3572.5	41.24207	2	1510.6700	1510.6700	M	K	2	16
PSM	AAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSER	822	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4221.3	56.7368	6	4986.1875	4986.1822	M	L	2	48
PSM	ADDLDFETGDAGASATFPMQCSALRK	823	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.4107.2	54.62307	3	2895.2053	2895.2087	M	N	2	28
PSM	MDEPSPLAQPLELNQHSR	824	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3615.2	42.33352	3	2198.9620	2198.9662	-	F	1	19
PSM	AGAGSAAVSGAGTPVAGPTGR	825	sp|O95295|SNAPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3130.3	29.79945	3	1832.8412	1832.8413	M	D	2	23
PSM	SDEFSLADALPEHSPAK	826	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.3940.2	50.67785	3	1934.8307	1934.8294	M	T	2	19
PSM	RELHGQNPVVTPCNK	827	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2732.5	19.78757	4	1827.850094	1827.845118	K	Q	147	162
PSM	KYEEIDNAPEER	828	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2823.3	21.90968	3	1491.681671	1491.684152	K	A	91	103
PSM	FIHQQPQSSSPVYGSSAK	829	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2913.3	24.20395	4	2026.915694	2026.914971	R	T	76	94
PSM	DVNAAIATIK	830	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3259.2	33.15382	2	1014.571447	1014.570960	K	T	327	337
PSM	SSLGPVGLDK	831	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3208.2	31.8333	2	1051.492247	1051.495092	K	M	34	44
PSM	SGLTVPTSPK	832	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3036.2	27.36467	2	1065.510847	1065.510742	R	G	87	97
PSM	SPASPRVPPVPDYVAHPER	833	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3311.2	34.49178	4	2150.028094	2150.031004	R	W	143	162
PSM	ACKVDSPTVNTTLR	834	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2953.2	25.23087	3	1640.756471	1640.759322	K	S	440	454
PSM	PYQYPALTPEQKK	835	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3108.3	29.22345	3	1641.7805	1641.7799	M	E	2	15
PSM	DVVICPDASLEDAKK	836	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3232.2	32.44993	3	1658.816771	1658.818537	R	E	49	64
PSM	MSGFIYQGK	837	sp|Q15052|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3372.3	36.08195	2	1109.460247	1109.461683	R	I	487	496
PSM	DLHQPSLSPASPHSQGFER	838	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3270.3	33.43768	4	2248.929294	2248.930378	K	G	58	77
PSM	DNLTSATLPR	839	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3284.3	33.80288	2	1166.530047	1166.533268	K	N	302	312
PSM	VQEKPDSPGGSTQIQR	840	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2723.4	19.61325	3	1805.829071	1805.830907	R	Y	1284	1300
PSM	DSPSVWAAVPGK	841	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3420.3	37.29613	2	1212.610047	1212.613888	K	T	27	39
PSM	NTCPGDRSAITPGGLR	842	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3062.4	28.03132	3	1830.746171	1830.748514	K	L	410	426
PSM	VDSPTVTTTLK	843	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3031.2	27.24243	2	1240.591447	1240.595200	K	N	458	469
PSM	GGETPGSEQWK	844	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2923.5	24.47065	2	1254.491647	1254.491798	K	F	223	234
PSM	LSASTASELSPK	845	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2978.4	25.8888	2	1269.578847	1269.585364	R	S	451	463
PSM	TREAQQALGSAAADATEAK	846	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3151.2	30.34447	3	1967.891471	1967.894964	K	N	1405	1424
PSM	DQVANSAFVER	847	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3082.3	28.54957	2	1314.556047	1314.560546	K	L	500	511
PSM	DQVANSAFVER	848	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3090.5	28.76255	2	1314.556047	1314.560546	K	L	500	511
PSM	TQPDGTSVPGEPASPISQR	849	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3107.3	29.19752	3	2002.900271	2002.899715	R	L	1744	1763
PSM	DGFPSGTPALNAK	850	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3265.3	33.30868	2	1353.594047	1353.596597	K	G	148	161
PSM	LQAPDSATLLEK	851	sp|Q9BUL5|PHF23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3374.3	36.13222	2	1364.653447	1364.658863	R	M	119	131
PSM	SGGLQTPECLSR	852	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3086.4	28.65685	2	1383.581247	1383.585381	R	E	431	443
PSM	ICEPGYSPTYK	853	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3099.4	28.99075	2	1393.559847	1393.562520	K	Q	210	221
PSM	DSVFLSCSEDNR	854	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3213.2	31.96418	2	1427.595047	1427.598708	K	I	180	192
PSM	SSTPLHSPSPIR	855	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2947.3	25.0792	3	1437.606371	1437.605462	R	V	283	295
PSM	DGLNQTTIPVSPPSTTKPSR	856	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3287.4	33.88455	3	2175.051071	2175.057278	K	A	573	593
PSM	AIADTGANVVVTGGK	857	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3059.6	27.96042	2	1451.699847	1451.702125	K	V	282	297
PSM	NAPAAVDEGSISPR	858	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2969.6	25.66058	2	1462.640447	1462.645338	R	T	373	387
PSM	HEQNIDCGGGYVK	859	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2801.3	21.35022	3	1475.648771	1475.646327	K	L	99	112
PSM	AMSTTSISSPQPGK	860	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.2699.3	19.05725	2	1486.636847	1486.637476	R	L	267	281
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	861	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3193.3	31.44547	4	2987.318894	2987.319929	R	-	684	712
PSM	DVSGPMPDSYSPR	862	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2956.4	25.3156	2	1502.568047	1502.574876	K	Y	291	304
PSM	NWMVGGEGGAGGRSP	863	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3350.5	35.51355	2	1510.599047	1510.602427	K	-	79	94
PSM	NWMVGGEGGAGGRSP	864	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3134.5	29.91082	2	1526.593047	1526.597342	K	-	79	94
PSM	GDATVSYEDPPTAK	865	sp|Q01844|EWS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2972.5	25.73533	2	1529.625647	1529.628685	K	A	411	425
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	866	sp|O15355|PPM1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21,20-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3379.2	36.26297	4	3071.292894	3071.294441	R	V	221	251
PSM	CPNLTHLNLSGNK	867	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	32.37235	3	1546.693571	1546.696328	K	I	87	100
PSM	FQRPGDPQSAQDK	868	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2769.2	20.539	3	1552.664471	1552.667136	K	A	294	307
PSM	GDRSPEPGQTWTR	869	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2900.3	23.86683	3	1565.671871	1565.662385	K	E	90	103
PSM	LTFDSSFSPNTGKK	870	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	34.64852	3	1607.718971	1607.723254	K	N	97	111
PSM	AGGPTTPLSPTRLSR	871	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3201.2	31.65047	3	1669.759871	1669.759002	R	L	15	30
PSM	NQLTSNPENTVFDAK	872	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3304.2	34.31488	3	1676.799671	1676.800579	K	R	82	97
PSM	DSSGQHVDVSPTSQR	873	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2734.2	19.84113	3	1678.694171	1678.694808	K	L	550	565
PSM	LIAPVAEEEATVPNNK	874	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3258.2	33.12757	3	1693.886171	1693.888666	K	I	8	24
PSM	NVTELNEPLSNEER	875	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3244.2	32.7625	3	1722.742871	1722.746174	K	N	29	43
PSM	ALSRQEMQEVQSSR	876	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2902.3	23.9182	3	1727.762771	1727.766198	K	S	187	201
PSM	NQVAMNPTNTVFDAK	877	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3358.6	35.7265	2	1728.750247	1728.754237	K	R	57	72
PSM	EQGPYETYEGSPVSK	878	sp|P23921|RIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3082.5	28.55623	2	1749.710647	1749.713477	K	G	549	564
PSM	AGGSPAPGPETPAISPSK	879	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2983.5	26.02298	3	1779.743771	1779.748163	K	R	85	103
PSM	DKPHVNVGTIGHVDHGK	880	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2854.2	22.67402	4	1808.930494	1808.928179	R	T	54	71
PSM	IGRIEDVTPIPSDSTR	881	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3210.2	31.88605	3	1834.878671	1834.882608	K	R	126	142
PSM	DAGDKDKEQELSEEDK	882	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2679.3	18.6614	3	1834.806071	1834.806846	R	Q	35	51
PSM	DAPTSPASVASSSSTPSSK	883	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2893.6	23.69575	3	1842.802571	1842.788433	K	T	282	301
PSM	PGPTPSGTNVGSSGRSPSK	884	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2677.2	18.61818	3	1848.8348	1848.8362	M	A	2	21
PSM	DKGDEEEEGEEKLEEK	885	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2845.4	22.45035	3	1891.818671	1891.817077	K	Q	536	552
PSM	DNEESEQPPVPGTPTLR	886	sp|O15439|MRP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3267.3	33.35932	3	1944.843671	1944.846617	K	N	634	651
PSM	KPVTVSPTTPTSPTEGEAS	887	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2974.4	25.78428	3	1964.894171	1964.897984	R	-	505	524
PSM	HASSSPESPKPAPAPGSHR	888	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2378.2	16.28987	4	1975.894494	1975.890153	R	E	433	452
PSM	SHSPSSPDPDTPSPVGDSR	889	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2842.5	22.37973	3	2000.814071	2000.811294	R	A	616	635
PSM	TPSPKEEDEEPESPPEK	890	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2758.4	20.28437	3	2003.826071	2003.824878	K	K	202	219
PSM	IASPVSRKEPPLTPVPLK	891	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3269.2	33.40827	4	2088.075694	2088.078545	K	R	207	225
PSM	CGNTIPDDDNQVVSLSPGSR	892	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3391.5	36.54878	3	2209.927571	2209.931092	R	Y	643	663
PSM	TVGTPIASVPGSTNTGTVPGSEK	893	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3278.5	33.65313	3	2236.055771	2236.062423	R	D	270	293
PSM	IADPEHDHTGFLTEYVATR	894	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3408.2	36.97877	4	2250.992494	2250.994678	R	W	190	209
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	895	sp|P13051|UNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3302.6	34.27797	3	2621.134271	2621.141158	K	I	50	74
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	896	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3121.2	29.56078	5	2712.267118	2712.264371	K	T	139	165
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	897	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2748.3	20.03812	4	3104.323294	3104.322430	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	898	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2757.3	20.26662	4	3104.323294	3104.322430	K	S	145	174
PSM	NLLSVAYK	899	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3627.2	42.64798	2	986.483247	986.483799	R	N	44	52
PSM	RIDFTPVSPAPSPTRGFGK	900	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3515.2	39.76412	4	2189.003694	2189.007171	K	M	108	127
PSM	SLNILTAFQK	901	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4125.2	54.89499	2	1213.607447	1213.610790	K	K	244	254
PSM	VVVAENFDEIVNNENK	902	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3616.3	42.36322	3	1831.890071	1831.895208	K	D	380	396
PSM	SQEGESVTEDISFLESPNPENK	903	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3956.3	51.08207	4	2515.065294	2515.063940	K	D	81	103
PSM	KISLPGQMAGTPITPLK	904	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3671.2	43.79984	3	1910.928971	1910.934189	K	D	212	229
PSM	LDIDSPPITAR	905	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3462.3	38.38478	2	1276.603447	1276.606433	R	N	33	44
PSM	VLTPELYAELR	906	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3996.2	52.09825	2	1382.681447	1382.684684	K	A	33	44
PSM	IMNTFSVVPSPK	907	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3619.4	42.4448	2	1398.659847	1398.661840	R	V	163	175
PSM	ESVPEFPLSPPK	908	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3760.2	46.097	2	1405.650647	1405.653049	K	K	30	42
PSM	WPDPEDLLTPR	909	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4049.5	53.36923	2	1417.625247	1417.627897	R	W	39	50
PSM	TVIIEQSWGSPK	910	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3503.5	39.46463	2	1423.671447	1423.674847	R	V	61	73
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	911	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3523.3	39.97542	4	2961.185694	2961.178529	R	V	870	899
PSM	TSDIFGSPVTATSR	912	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3457.4	38.25783	2	1517.671247	1517.676304	K	L	91	105
PSM	EGEEAGPGDPLLEAVPKTGDEK	913	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3499.5	39.3604	3	2317.032971	2317.036268	K	D	353	375
PSM	DQVTAQEIFQDNHEDGPTAK	914	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3433.4	37.63152	3	2321.975471	2321.980150	K	K	546	566
PSM	DSPESPFEVIIDK	915	sp|O95197|RTN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4052.2	53.43753	2	1554.680447	1554.685472	K	A	242	255
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	916	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3550.5	40.66548	4	3246.377294	3246.383770	K	V	233	262
PSM	DMESPTKLDVTLAK	917	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3448.2	38.01591	3	1626.757871	1626.757591	K	D	277	291
PSM	EVSSLEGSPPPCLGQEEAVCTK	918	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3465.5	38.47272	3	2453.041271	2453.049158	K	I	1388	1410
PSM	SAPELKTGISDVFAK	919	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3600.2	41.95483	3	1641.801371	1641.801505	K	N	319	334
PSM	CFSPGVIEVQEVQGK	920	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3670.2	43.77368	3	1755.788171	1755.790288	R	K	256	271
PSM	ENSSSSSTPLSNGPLNGDVDYFGQQFDQISNR	921	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4517.2	60.81708	4	3539.508094	3539.511431	K	T	322	354
PSM	TITLEVEPSDTIENVK	922	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3581.2	41.46181	3	1786.918871	1786.920025	K	A	12	28
PSM	DDGLFSGDPNWFPKK	923	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4011.2	52.43612	3	1801.765871	1801.771267	R	S	140	155
PSM	DDGLFSGDPNWFPKK	924	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4020.2	52.66208	3	1801.765871	1801.771267	R	S	140	155
PSM	SATSSSPGSPLHSLETSL	925	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3922.2	50.21988	2	1836.810847	1836.814254	K	-	1203	1221
PSM	HSGGFLSSPADFSQENK	926	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3464.2	38.43345	3	1886.781671	1886.783623	R	A	772	789
PSM	SATSSSPGSPLHSLETSL	927	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4362.2	58.86362	3	1916.778071	1916.780585	K	-	1203	1221
PSM	ALSSGGSITSPPLSPALPK	928	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3752.2	45.88803	3	1938.906971	1938.910477	R	Y	17	36
PSM	DATNVGDEGGFAPNILENK	929	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3689.5	44.28087	3	1959.915971	1959.917400	K	E	203	222
PSM	DLLNELESPKEEPIEE	930	sp|Q9BZH6|WDR11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4142.2	55.27757	3	1962.870671	1962.871100	K	-	1209	1225
PSM	VVLAYEPVWAIGTGKTATPQQAQEVHEK	931	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3985.4	51.81143	5	3289.483118	3289.486279	K	L	198	226
PSM	DATNVGDEGGFAPNILENK	932	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3825.3	47.7322	3	2039.879171	2039.883731	K	E	203	222
PSM	YLLSQSSPAPLTAAEEELR	933	sp|Q12792|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4100.3	54.45775	3	2154.020771	2154.024581	K	Q	137	156
PSM	EINAREESLVEELSPASEK	934	sp|Q9BXK5|B2L13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3484.3	38.96187	3	2209.014971	2209.015139	K	K	413	432
PSM	QHPQPYIFPDSPGGTSYER	935	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3466.4	38.49272	3	2254.962971	2254.968463	R	Y	75	94
PSM	VPADTEVVCAPPTAYIDFAR	936	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4050.4	53.38863	3	2271.024971	2271.028287	K	Q	71	91
PSM	GSPLNAAPYGIESMSQDTEVR	937	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3773.4	46.443	3	2300.993471	2300.998443	K	S	351	372
PSM	IADPEHDHTGFLTEYVATR	938	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3483.6	38.94573	3	2330.959271	2330.961009	R	W	190	209
PSM	LYGSAGPPPTGEEDTAEKDEL	939	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3545.4	40.53115	3	2334.912371	2334.918201	K	-	634	655
PSM	DAEKTPAVSISCLELSNNLEK	940	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3796.2	46.97887	3	2397.110171	2397.113473	K	K	458	479
PSM	DNLTLWTSDTQGDEAEAGEGGEN	941	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3855.5	48.50417	3	2407.981871	2407.988786	R	-	223	246
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	942	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4024.3	52.7692	3	2540.083571	2540.089049	K	S	180	204
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	943	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3596.4	41.85705	3	2573.994671	2573.998594	R	G	239	267
PSM	NGRVEIIANDQGNRITPSYVAFTPEGER	944	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3639.5	42.97187	4	3262.478094	3262.480937	K	L	47	75
PSM	CIPALDSLTPANEDQK	945	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4520.2	60.86577	3	1833.7826	1833.7851	R	I	447	463
PSM	VSMPDVELNLKSPK	946	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3560.2	40.91813	3	1635.791771	1635.794311	K	V	3415	3429
PSM	EQSHAEISPPAESGQAVEECKEEGEEK	947	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.3046.5	27.62085	4	3063.267694	3063.265235	R	Q	246	273
PSM	MEGPLSVFGDR	948	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4150.3	55.3855	2	1344.5395	1344.5416	-	S	1	12
PSM	MDSAGQDINLNSPNK	949	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3189.2	31.33725	3	1740.7004	1740.7021	-	G	1	16
PSM	MTEWETAAPAVAETPDIK	950	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3866.3	48.78463	3	2096.8978	2096.9008	-	L	1	19
PSM	SYTPGVGGDPAQLAQR	951	sp|O15400|STX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	41.20583	3	1737.7717	1737.7718	M	I	2	18
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPK	952	sp|Q9H2V7|SPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=1.1.4122.2	54.82942	4	3356.4664	3356.4717	M	S	2	36
PSM	LYGPSSVSFADDFVRSSK	953	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3928.3	50.36752	3	2120.881271	2120.885719	R	Q	134	152
PSM	MQELTLSPGPAK	954	sp|Q93015-2|NAA80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3870.4	48.89245	2	1392.6345	1392.6355	-	L	1	13
PSM	SLTPAVPVESKPDKPSGK	955	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2960.2	25.41293	4	1915.965294	1915.965610	K	S	133	151
PSM	DRQSPLHGNHITISHTQATGSR	956	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2881.3	23.37552	5	2492.174118	2492.166997	K	S	255	277
PSM	AGDLLEDSPKRPK	957	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2858.2	22.777	3	1504.731971	1504.728674	R	E	158	171
PSM	SGLTVPTSPK	958	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3045.2	27.5856	2	1065.510847	1065.510742	R	G	87	97
PSM	SALFSESQK	959	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3059.2	27.94708	2	1075.457847	1075.458706	K	A	566	575
PSM	DYDDMSPR	960	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2892.2	23.6558	2	1077.347447	1077.347441	R	R	279	287
PSM	RLQEDPNYSPQRFPNAQR	961	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3057.3	27.89853	4	2295.060894	2295.054593	K	A	1109	1127
PSM	KKPRPPPALGPEETSASAGLPK	962	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3025.2	27.08867	4	2307.1984941913206	2307.1987970448195	K	K	14	36
PSM	SVEAAAELSAK	963	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2940.4	24.90353	2	1154.519847	1154.522035	K	D	5	16
PSM	QLSSGVSEIR	964	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3104.2	29.11545	2	1154.530847	1154.533268	R	H	80	90
PSM	LKGEATVSFDDPPSAK	965	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3125.5	29.67532	3	1740.799871	1740.797147	K	A	333	349
PSM	GASLKSPLPSQ	966	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3058.3	27.9244	2	1163.558047	1163.558755	K	-	113	124
PSM	LITPAVVSER	967	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3339.3	35.21988	2	1163.589247	1163.595140	K	L	67	77
PSM	GCESAVDELK	968	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3090.2	28.75255	2	1186.458447	1186.457721	K	G	441	451
PSM	TLRLNQPGTPTRTAV	969	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3169.2	30.81432	3	1783.835771	1783.838315	K	-	386	401
PSM	EQVANSAFVER	970	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2984.4	26.04547	2	1248.606247	1248.609865	K	V	365	376
PSM	SSEHINEGETAMLVCK	971	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3136.3	29.9564	3	1883.783171	1883.779466	K	S	228	244
PSM	GKGGEIQPVSVK	972	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2850.5	22.58148	2	1277.638647	1277.638068	K	V	55	67
PSM	SSPNPFVGSPPK	973	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3189.4	31.34392	2	1292.577647	1292.580219	K	G	393	405
PSM	SASSSAAGSPGGLTSLQQQK	974	sp|Q8NEZ2|VP37A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3128.3	29.74685	3	1940.884571	1940.884065	K	Q	10	30
PSM	DRSVSVDSGEQREAGTPSLDSEAK	975	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2952.5	25.21528	4	2599.134494	2599.139899	R	E	114	138
PSM	EITALAPSTMK	976	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3363.2	35.8433	2	1320.539447	1320.543772	K	I	318	329
PSM	LDQPVSAPPSPR	977	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2941.4	24.9288	2	1342.624047	1342.628231	K	D	235	247
PSM	NLYPSSSPYTR	978	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3212.4	31.94465	2	1363.579647	1363.580947	K	N	275	286
PSM	SQSLPNSLDYTQTSDPGR	979	sp|Q96TC7|RMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3376.4	36.18455	3	2044.864571	2044.873894	R	H	44	62
PSM	ADGYEPPVQESV	980	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3335.5	35.12328	2	1369.540647	1369.543893	R	-	253	265
PSM	DCDRAIEINPDSAQPYK	981	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3282.5	33.7573	3	2070.870071	2070.871786	R	W	170	187
PSM	SGSLDSELSVSPK	982	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3289.3	33.93372	2	1384.606847	1384.612307	K	R	2718	2731
PSM	QAGGFLGPPPPSGK	983	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3236.3	32.55725	2	1388.645647	1388.648967	K	F	224	238
PSM	VLQATVVAVGSGSK	984	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3170.5	30.85053	2	1394.714247	1394.717047	K	G	41	55
PSM	NSGSFPSPSISPR	985	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3280.4	33.70178	2	1411.621047	1411.613310	R	-	1258	1271
PSM	NQSPVDQGATGASQGLLDRK	986	sp|P18827|SDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3149.4	30.29898	3	2120.981171	2120.985176	R	E	231	251
PSM	DILAQSPAAEPLK	987	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3417.5	37.2243	2	1431.696447	1431.701062	K	N	1232	1245
PSM	VQISPDSGGLPER	988	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3182.6	31.1674	2	1433.653247	1433.655175	K	S	178	191
PSM	SSDQPLTVPVSPK	989	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3238.4	32.61212	2	1433.678047	1433.680327	K	F	728	741
PSM	SSGPYGGGGQYFAK	990	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3243.4	32.74297	2	1454.584647	1454.586761	R	P	285	299
PSM	VDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	991	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3362.4	35.82407	4	2925.342094	2925.350560	K	A	461	493
PSM	SCTPSPDQISHR	992	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2796.3	21.22127	3	1463.587871	1463.586443	R	A	271	283
PSM	DVSGPMPDSYSPR	993	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3206.5	31.79097	2	1486.577047	1486.579961	K	Y	291	304
PSM	SSDQPLTVPVSPK	994	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3304.4	34.32155	2	1513.637847	1513.646658	K	F	728	741
PSM	VLGTSPEAIDSAENR	995	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3255.2	33.04897	3	1637.732471	1637.729796	R	F	1034	1049
PSM	TPKTPKGPSSVEDIK	996	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2871.3	23.1161	3	1662.826571	1662.822968	K	A	234	249
PSM	GVEPSPSPIKPGDIK	997	sp|Q92890|UFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3215.3	32.01918	3	1679.758571	1679.757271	K	R	241	256
PSM	GEPAAAAAPEAGASPVEK	998	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2879.6	23.33368	2	1701.760247	1701.761096	K	E	88	106
PSM	GLGKPGGQGDAIQLSPK	999	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3123.2	29.61308	3	1701.845771	1701.845101	K	L	160	177
PSM	LKGEATVSFDDPPSAK	1000	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3141.2	30.0836	3	1740.799871	1740.797147	K	A	333	349
PSM	DGQVINETSQHHDDLE	1001	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2935.3	24.77463	3	1835.792171	1835.792199	R	-	451	467
PSM	DETVSDCSPHIANIGR	1002	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3206.3	31.7843	3	1849.766471	1849.766593	K	L	200	216
PSM	GVQVETISPGDGRTFPK	1003	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3302.3	34.26797	3	1866.8819	1866.8872	M	R	2	19
PSM	DVDDGSGSPHSPHQLSSK	1004	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2687.3	18.83097	4	1928.789694	1928.790165	R	S	2022	2040
PSM	NRVIGSGCNLDSARFR	1005	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3228.4	32.35367	3	1980.833171	1980.839060	K	Y	156	172
PSM	FIHQQPQSSSPVYGSSAK	1006	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2959.4	25.3997	3	2026.911671	2026.914971	R	T	76	94
PSM	GPPASSPAPAPKFSPVTPK	1007	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3318.5	34.68472	3	2071.878071	2071.882228	R	F	254	273
PSM	SHSPSSPDPDTPSPVGDSR	1008	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2827.6	22.01998	3	2080.778171	2080.777625	R	A	616	635
PSM	GGLNTPLHESDFSGVTPQR	1009	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3417.3	37.21763	3	2090.935571	2090.942249	K	Q	381	400
PSM	VKSATLSSTESTASEMQEEMK	1010	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3413.6	37.12207	3	2353.001471	2353.006624	K	G	638	659
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1011	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3329.6	34.9727	3	2639.203571	2639.207584	K	S	97	122
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	1012	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.2986.5	26.10075	4	2968.357694	2968.358028	R	L	420	447
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	1013	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3281.6	33.7344	3	2994.251771	2994.261530	K	A	106	138
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	1014	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3220.6	32.1588	4	3156.394494	3156.395856	K	G	306	335
PSM	SSNLLDLK	1015	sp|Q86X55|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3498.2	39.32435	2	968.454647	968.457978	K	N	463	471
PSM	GTPLISPLIK	1016	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3891.2	49.43528	2	1197.578247	1197.581144	R	W	826	836
PSM	QVPDSAATATAYLCGVK	1017	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3646.2	43.14587	3	1830.820571	1830.822317	R	A	107	124
PSM	ALDDFVLGSAR	1018	sp|O60831|PRAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3820.3	47.60117	2	1242.563047	1242.564569	R	L	11	22
PSM	SESAPTLHPYSPLSPK	1019	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3438.2	37.75358	3	1869.790271	1869.795113	R	G	100	116
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1020	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	47.05404	4	2515.085694	2515.082187	K	A	30	54
PSM	DLFSLDSEDPSPASPPLR	1021	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4184.3	55.97318	3	2021.893271	2021.898318	R	S	224	242
PSM	GLFSANDWQCK	1022	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3840.2	48.11963	2	1404.549447	1404.553352	R	T	62	73
PSM	ESVPEFPLSPPK	1023	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3744.2	45.6791	3	1405.653971	1405.653049	K	K	30	42
PSM	SIPLECPLSSPK	1024	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3467.4	38.51893	2	1406.648047	1406.651669	K	G	142	154
PSM	VNQSALEAVTPSPSFQQR	1025	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3424.3	37.4003	3	2117.911271	2117.918416	R	H	390	408
PSM	IMNTFSVVPSPK	1026	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3456.6	38.23865	2	1414.654447	1414.656755	R	V	163	175
PSM	LGGSAVISLEGKPL	1027	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3851.3	48.39665	2	1419.732647	1419.737448	K	-	153	167
PSM	NVMLLPVGSADDGAHSQNEK	1028	sp|Q96KP4|CNDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3484.2	38.95853	3	2160.947771	2160.951099	K	L	431	451
PSM	EFSPFGTITSAK	1029	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4019.4	52.64282	2	1443.569647	1443.572430	K	V	313	325
PSM	ATLPSPDKLPGFK	1030	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3563.2	40.99642	3	1449.728471	1449.726883	K	M	831	844
PSM	ASGQAFELILSPR	1031	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3933.4	50.50117	2	1467.711247	1467.712296	R	S	15	28
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1032	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3625.2	42.59568	4	2972.321294	2972.324602	K	Q	178	204
PSM	DVNSSSPVMLAFK	1033	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3560.6	40.93147	2	1489.648647	1489.652398	K	S	28	41
PSM	QASPNIVIALSGNK	1034	sp|P20339|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3675.2	43.90413	2	1490.745047	1490.749409	R	A	121	135
PSM	GALQNIIPASTGAAK	1035	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3481.3	38.8827	2	1490.746247	1490.749409	R	A	201	216
PSM	GVVDSEDLPLNISR	1036	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3612.5	42.26632	2	1512.772847	1512.778387	R	E	387	401
PSM	VHSPSGALEECYVTEIDQDK	1037	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3613.3	42.28478	3	2355.992471	2355.993023	K	Y	2368	2388
PSM	GALQNIIPASTGAAK	1038	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3633.4	42.81062	2	1570.712447	1570.715740	R	A	201	216
PSM	NREPLMPSPQFIK	1039	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3544.2	40.49752	3	1635.791771	1635.784415	K	S	246	259
PSM	NWTEDMEGGISSPVK	1040	sp|P08651|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3606.4	42.11568	2	1728.702247	1728.706618	R	K	312	327
PSM	ELPAAEPVLSPLEGTK	1041	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3727.2	45.23447	3	1729.852571	1729.853934	K	M	266	282
PSM	VTNGAFTGEISPGMIK	1042	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3831.4	47.89178	2	1780.745647	1780.750805	K	D	107	123
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	1043	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4155.3	55.50398	4	3681.634094	3681.639334	K	K	213	250
PSM	YFEADPPGQVAASPDPTT	1044	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3486.3	39.01422	3	1941.803471	1941.803355	R	-	157	175
PSM	SVPTSTVFYPSDGVATEK	1045	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3573.3	41.26178	3	1963.879871	1963.881605	R	A	439	457
PSM	SVPTSTVFYPSDGVATEK	1046	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3565.3	41.05222	3	1963.879871	1963.881605	R	A	439	457
PSM	FDRGYISPYFINTSK	1047	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3819.2	47.57175	3	1966.821971	1966.826747	K	G	219	234
PSM	VAPEEHPVLLTEAPLNPK	1048	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	40.04942	3	2033.022671	2033.023459	R	A	96	114
PSM	DTQSPSTCSEGLLGWSQK	1049	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3795.2	46.95424	3	2059.855871	2059.855802	K	D	709	727
PSM	QEQINTEPLEDTVLSPTK	1050	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3672.4	43.83237	3	2120.982071	2120.987861	K	K	271	289
PSM	DNLTLWTSDMQGDGEEQNK	1051	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3767.2	46.27938	4	2179.927294	2179.932792	R	E	226	245
PSM	DLGTQNHTSELILSSPPGQK	1052	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3425.4	37.42907	3	2201.033471	2201.036543	K	V	385	405
PSM	RIQEIIEQLDVTTSEYEK	1053	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3826.5	47.76492	3	2273.077571	2273.082825	K	E	370	388
PSM	SPWSNKYDPPLEDGAMPSAR	1054	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3543.6	40.48528	3	2296.980371	2296.982399	R	L	73	93
PSM	SPWSNKYDPPLEDGAMPSAR	1055	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3551.5	40.69178	3	2296.980371	2296.982399	R	L	73	93
PSM	GSPLNAAPYGIESMSQDTEVR	1056	sp|P18031|PTN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3477.3	38.7778	3	2316.986771	2316.993358	K	S	351	372
PSM	NALFPEVFSPTPDENSDQNSR	1057	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4111.3	54.69117	3	2443.027871	2443.032914	R	S	567	588
PSM	EGPYSISVLYGDEEVPRSPFK	1058	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3943.3	50.77043	3	2448.123971	2448.125024	R	V	1516	1537
PSM	DLGLPTEAYISVEEVHDDGTPTSK	1059	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3982.3	51.72325	4	2652.185294	2652.184389	K	T	130	154
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1060	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3513.2	39.71328	5	2833.354618	2833.352672	K	S	362	389
PSM	VSTTTDSPVSPAQAASPFIPLDELSSK	1061	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4474.2	60.25897	3	2904.301271	2904.308283	K	-	261	288
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1062	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3519.3	39.87105	5	2989.540618	2989.541321	K	G	202	228
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1063	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3503.2	39.45463	5	2989.540618	2989.541321	K	G	202	228
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	1064	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3534.3	40.24277	4	3062.395294	3062.401610	K	S	2194	2221
PSM	SLGYHGSSYSPEGVEPVSPVSSPSLTHDK	1065	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.3429.6	37.53652	4	3159.341294	3159.347523	R	G	2037	2066
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1066	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3827.4	47.78765	4	3522.467694	3522.472617	K	F	604	634
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	1067	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.3766.6	46.26672	4	3637.639294	3637.645482	R	V	592	630
PSM	YGKDATNVGDEGGFAPNILENK	1068	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3598.4	41.9095	3	2388.058871	2388.063486	K	E	200	222
PSM	SAESPTSPVTSETGSTFK	1069	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3411.4	37.06375	3	1972.777871	1971.775165	K	K	280	298
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1070	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3982.5	51.73325	3	2829.1930	2829.1964	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1071	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3867.2	48.80757	4	2749.2244	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1072	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4016.2	52.57252	3	2829.1909	2829.1964	-	Y	1	25
PSM	AAPEASSPPASPLQHLLPGK	1073	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3800.3	47.08303	3	2127.978971	2126.980288	K	A	686	706
PSM	AAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSER	1074	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4229.3	56.92428	5	4986.1791	4986.1822	M	L	2	48
PSM	NVSSFPDDATSPLQENR	1075	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3420.4	37.29947	3	1956.828071	1955.826216	R	N	52	69
PSM	AADVSVTHRPPLSPK	1076	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3155.2	30.44888	3	1695.8332	1695.8340	M	S	2	17
PSM	AIEINPDSAQPYK	1077	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3288.4	33.91082	2	1524.678847	1524.686140	R	W	174	187
PSM	QLSSGVSEIR	1078	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3575.3	41.31348	2	1137.5041	1137.5062	R	H	80	90
PSM	VLTPTQVK	1079	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	26.11677	2	964.496247	964.499449	K	N	40	48
PSM	NVSIGIVGK	1080	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	35.03555	2	965.492647	965.494698	K	D	209	218
PSM	AGFAGDDAPR	1081	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2814.2	21.67127	2	975.440447	975.441009	K	A	21	31
PSM	GGEIQPVSVKVGDK	1082	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3069.2	28.20758	3	1491.732371	1491.733425	K	V	57	71
PSM	GGEIQPVSVK	1083	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2981.3	25.96365	2	1092.518647	1092.521641	K	V	57	67
PSM	LEPQIASASEYAHR	1084	sp|O60664|PLIN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3179.2	31.07593	3	1650.740471	1650.740301	K	G	85	99
PSM	LVEPGSPAEK	1085	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2774.2	20.66992	2	1105.502447	1105.505657	R	A	41	51
PSM	SSSPLPTVQLHPQSPTAGKK	1086	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3176.3	31.00083	4	2219.038494	2219.038866	K	H	998	1018
PSM	RLSSSSATLLNSPDR	1087	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3054.3	27.82033	3	1682.798171	1682.798879	K	A	198	213
PSM	FEDRSPAAECLSEK	1088	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2954.2	25.25662	3	1717.701071	1717.701867	K	E	564	578
PSM	GLQSGVDIGVK	1089	sp|Q99439|CNN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3344.3	35.35043	2	1151.556847	1151.558755	K	Y	135	146
PSM	QLSSGVSEIR	1090	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3125.4	29.67198	2	1154.533247	1154.533268	R	H	80	90
PSM	NSFREQLEEEEEAK	1091	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3207.3	31.81073	3	1736.785871	1736.785323	K	H	1339	1353
PSM	LALGDDSPALK	1092	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3295.3	34.08952	2	1178.554447	1178.558421	R	E	87	98
PSM	HLGGSGSVVPGSPCLDR	1093	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3198.2	31.57223	3	1773.786071	1773.786934	R	H	1303	1320
PSM	LEGQGDVPTPK	1094	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2907.3	24.04812	2	1219.547447	1219.548584	K	Q	257	268
PSM	VEIIANDQGNR	1095	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2883.2	23.42427	3	1227.620471	1227.620764	R	I	50	61
PSM	SASWGSADQLK	1096	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3240.3	32.6613	2	1228.511247	1228.512533	R	E	221	232
PSM	STGCDFAVSPK	1097	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3044.2	27.5607	2	1247.486847	1247.489355	K	L	501	512
PSM	LLLDPSSPPTK	1098	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3414.5	37.14562	2	1246.618047	1246.621021	K	A	21	32
PSM	ASPEPQRENASPAPGTTAEEAMSR	1099	sp|P46379|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3048.5	27.67135	4	2563.097694	2563.101011	R	G	963	987
PSM	GGSGSGPTIEEVD	1100	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3231.2	32.42388	2	1283.490447	1283.491857	K	-	629	642
PSM	SMGLPTSDEQK	1101	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2788.2	21.02917	2	1287.504447	1287.505399	K	K	298	309
PSM	GCLLYGPPGTGK	1102	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3321.5	34.76228	2	1298.568247	1298.573025	K	T	169	181
PSM	QHEAPSNRPLNELLTPQGPSPR	1103	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3370.4	36.03335	4	2597.176894	2597.178881	R	T	167	189
PSM	TRSWDSSSPVDRPEPEAASPTTR	1104	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3050.3	27.71688	4	2608.158094	2608.155489	R	T	352	375
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1105	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2777.2	20.74613	4	2673.045694	2673.045055	K	G	134	157
PSM	NNASTDYDLSDK	1106	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2882.4	23.40437	2	1341.568047	1341.568454	K	S	301	313
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	1107	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3151.3	30.3478	4	2692.286894	2692.288766	R	Q	24	52
PSM	ELASPVSPELR	1108	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3346.3	35.40242	2	1356.571447	1356.572764	K	Q	175	186
PSM	RLQKLESPVAH	1109	sp|Q86TM6|SYVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2798.2	21.26952	3	1356.692471	1356.691500	R	-	607	618
PSM	VSDQNSPVLPKK	1110	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2737.2	19.87852	3	1390.684571	1390.685746	R	S	2042	2054
PSM	IIYGGSVTGATCK	1111	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3106.5	29.178	2	1405.628447	1405.631268	R	E	244	257
PSM	NKQDDDLNCEPLSPHNITPEPVSK	1112	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3278.4	33.6498	4	2826.248094	2826.253154	K	L	101	125
PSM	RYPSSISSSPQK	1113	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2770.2	20.57778	3	1415.642471	1415.644610	R	D	601	613
PSM	NGEVVHTPETSV	1114	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3036.4	27.37133	2	1427.534847	1427.537107	K	-	454	466
PSM	EMPQDLRSPARTPPSEEDSAEAER	1115	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2954.4	25.26328	4	2873.154094	2873.157614	K	L	70	94
PSM	EALSPCPSTVSTK	1116	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.2932.5	24.70377	2	1455.627447	1455.631662	R	S	670	683
PSM	NPSDSAVHSPFTK	1117	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2885.2	23.47593	3	1465.623671	1465.623874	K	R	408	421
PSM	TPSPKEEDEEPESPPEK	1118	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2762.4	20.36663	4	2003.828494	2003.824878	K	K	202	219
PSM	SGSSSPDSEITELK	1119	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3268.5	33.39198	2	1515.626647	1515.634164	R	F	571	585
PSM	NHCGIASAASYPTV	1120	sp|P07711|CATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3371.4	36.05945	2	1526.617847	1526.622494	R	-	320	334
PSM	SLPTTVPESPNYR	1121	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3243.6	32.74963	2	1539.693247	1539.697039	R	N	766	779
PSM	YLLGDAPVSPSSQK	1122	sp|Q9NYB0|TE2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3369.6	36.01362	2	1540.711047	1540.717440	K	L	195	209
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1123	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3200.4	31.63125	4	3093.278494	3093.277137	R	-	738	768
PSM	NGRVEIIANDQGNR	1124	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2855.3	22.70308	3	1554.786071	1554.786266	K	I	47	61
PSM	NGRVEIIANDQGNR	1125	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2847.4	22.50057	3	1554.786071	1554.786266	K	I	47	61
PSM	ACKVDSPTVTTTLK	1126	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2958.2	25.3609	3	1599.756071	1599.757925	K	N	455	469
PSM	TRVSDPISTSESSEEEEEAEAETAKATPR	1127	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3245.4	32.79472	4	3215.396494	3215.399086	K	L	76	105
PSM	DLVAQAPLKPKTPR	1128	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3043.2	27.53588	3	1612.868771	1612.870193	K	G	523	537
PSM	SVTEQGAELSNEER	1129	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2973.2	25.7514	3	1627.671071	1627.672675	K	N	28	42
PSM	SAMPFTASPASSTTAR	1130	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3314.3	34.57367	3	1661.708171	1661.712038	R	V	123	139
PSM	ESVPEFPLSPPKKK	1131	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3292.2	34.00873	3	1661.840771	1661.842975	K	D	30	44
PSM	TPKTPKGPSSVEDIK	1132	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2847.5	22.5039	3	1662.826571	1662.822968	K	A	234	249
PSM	GKGGEIQPVSVKVGDK	1133	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2943.2	24.97277	3	1676.847371	1676.849852	K	V	55	71
PSM	KVPQVSTPTLVEVSR	1134	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3316.3	34.62585	3	1718.892671	1718.896802	K	N	438	453
PSM	DTGKTPVEPEVAIHR	1135	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2999.3	26.421	3	1727.824271	1727.824365	K	I	5	20
PSM	MDATANDVPSPYEVR	1136	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3312.5	34.52808	2	1743.711847	1743.717517	K	G	434	449
PSM	NDSVIVADQTPTPTR	1137	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3092.2	28.8026	3	1772.739971	1772.738326	R	F	60	75
PSM	RELHGQNPVVTPCNK	1138	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2731.2	19.76575	3	1827.845771	1827.845118	K	Q	147	162
PSM	VDCTAHSDVCSAQGVR	1139	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2767.2	20.48773	3	1840.721771	1840.723348	K	G	119	135
PSM	IRYESLTDPSKLDSGK	1140	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3254.3	33.02578	3	1967.862371	1967.864255	K	E	54	70
PSM	DSENLASPSEYPENGER	1141	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3156.3	30.47753	3	1972.767071	1972.768760	R	F	617	634
PSM	KPVTVSPTTPTSPTEGEAS	1142	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2990.6	26.20772	3	2044.863071	2044.864315	R	-	505	524
PSM	IACKSPPPESVDTPTSTK	1143	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:4,5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.2811.5	21.60632	3	2073.870371	2073.873106	K	Q	1127	1145
PSM	TPSPKEEDEEPESPPEKK	1144	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2679.4	18.66807	3	2131.918871	2131.919841	K	T	202	220
PSM	DGLNQTTIPVSPPSTTKPSR	1145	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3336.5	35.14933	3	2255.018171	2255.023609	K	A	573	593
PSM	LYGSAGPPPTGEEDTAEKDEL	1146	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3385.3	36.39935	3	2254.944671	2254.951870	K	-	634	655
PSM	EASRPPEEPSAPSPTLPAQFK	1147	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3405.3	36.904	3	2315.079371	2315.083493	R	Q	351	372
PSM	KRDHANYEEDENGDITPIK	1148	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2902.4	23.92153	4	2323.010494	2323.011785	R	A	132	151
PSM	QIDSSPVGGETDETTVSQNYR	1149	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3201.5	31.66047	3	2361.992471	2361.996194	K	G	565	586
PSM	FNSESESGSEASSPDYFGPPAK	1150	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3391.6	36.55212	3	2368.928771	2368.937282	R	N	96	118
PSM	EHYPVSSPSSPSPPAQPGGVSR	1151	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3085.5	28.63423	3	2378.993771	2378.993372	K	N	2036	2058
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1152	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3410.2	37.03058	4	2619.207294	2619.213536	R	D	175	200
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1153	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3337.2	35.16503	4	2727.230894	2727.234862	R	G	70	97
PSM	GYNHGQGSYSYSNSYNSPGGGGGSDYNYESK	1154	sp|Q12906|ILF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3150.5	30.32838	4	3332.255294	3332.259238	K	F	776	807
PSM	IFRDGEEAGAYDGPRTADGIVSHLK	1155	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3447.2	37.98923	5	2753.286618	2753.281024	K	K	105	130
PSM	ESAFEFLSSA	1156	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4587.2	61.97305	2	1166.449847	1166.453287	K	-	325	335
PSM	VLPGVDALSNI	1157	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4204.2	56.3961	2	1176.577647	1176.579156	K	-	407	418
PSM	DAGTIAGLNVLR	1158	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3664.2	43.617	2	1198.667847	1198.666986	K	I	160	172
PSM	VMTIPYQPMPASSPVICAGGQDR	1159	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3628.3	42.67712	4	2570.135294	2570.136868	R	C	178	201
PSM	IMGTSPLQIDR	1160	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3507.4	39.5653	2	1309.606447	1309.610139	K	A	1075	1086
PSM	EFSPFGTITSAK	1161	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3793.2	46.90568	2	1363.603247	1363.606099	K	V	313	325
PSM	ERPTPSLNNNCTTSEDSLVLYNR	1162	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3465.2	38.45938	4	2759.220094	2759.222189	K	V	734	757
PSM	AEREKTPSAETPSEPVDWTFAQR	1163	sp|O60333|KIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3571.4	41.2125	4	2791.183694	2791.189171	R	E	642	665
PSM	IMNTFSVVPSPK	1164	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3627.3	42.65132	2	1398.659847	1398.661840	R	V	163	175
PSM	EFSPFGSITSAK	1165	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4047.3	53.30748	2	1429.552047	1429.556780	K	V	313	325
PSM	LFMAQALQEYNN	1166	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3908.3	49.86367	2	1440.664247	1440.670751	K	-	341	353
PSM	NEDGTWPRGPSTPKSPGASNFSTLPK	1167	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3469.3	38.56804	4	2887.255694	2887.257920	K	I	215	241
PSM	KKPEDSPSDDDVLIVYELTPTAEQK	1168	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3863.4	48.70928	4	2896.358494	2896.363082	K	A	2621	2646
PSM	ATLPSPDKLPGFK	1169	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3555.2	40.78667	3	1449.728471	1449.726883	K	M	831	844
PSM	IVSAQSLAEDDVE	1170	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3602.3	42.01107	2	1454.613847	1454.617786	R	-	133	146
PSM	VEIIANDQGNRITPSYVAFTPEGER	1171	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3803.4	47.16393	4	2935.313294	2935.315434	R	L	50	75
PSM	RVATPVDWKDGDSVMVLPTIPEEEAK	1172	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3862.2	48.67719	4	2961.410494	2961.419491	K	K	174	200
PSM	GNPTVEVDLFTSK	1173	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3718.5	45.01048	2	1485.672247	1485.675241	R	G	16	29
PSM	EQFLDGDGWTSR	1174	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3642.4	43.04752	2	1489.585247	1489.587489	K	W	25	37
PSM	GFSVVADTPELQR	1175	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3491.4	39.14793	2	1497.683247	1497.686475	K	I	97	110
PSM	TLTIVDTGIGMTK	1176	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3844.3	48.226	2	1508.656247	1508.659865	R	A	28	41
PSM	VEEQEPELTSTPNFVVEVIKNDDGKK	1177	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3917.4	50.10198	4	3023.436894	3023.437644	K	A	155	181
PSM	TPSSDVLVFDYTK	1178	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3872.2	48.93812	3	1550.691671	1550.690557	K	H	144	157
PSM	EAAFGGGLLSPGPEAT	1179	sp|Q01201|RELB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4008.2	52.36292	2	1552.676647	1552.681055	R	-	564	580
PSM	ANTTAFLTPLEIK	1180	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4057.4	53.57132	2	1577.713047	1577.714343	K	A	558	571
PSM	QSKPVTTPEEIAQVATISANGDK	1181	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3555.5	40.79667	3	2463.186371	2463.189415	K	E	158	181
PSM	IFVGGLSPDTPEEK	1182	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3659.5	43.49582	2	1647.678647	1647.683437	K	I	184	198
PSM	NPEVGLKPVWYSPK	1183	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3543.2	40.47195	3	1692.824171	1692.827660	K	V	536	550
PSM	RASGQAFELILSPR	1184	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3892.2	49.45853	3	1703.778671	1703.779738	K	S	14	28
PSM	VTNGAFTGEISPGMIK	1185	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3497.2	39.2983	3	1716.774971	1716.779389	K	D	107	123
PSM	CELLSDDSLAVSSPR	1186	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3572.2	41.23207	3	1727.742371	1727.743732	K	L	292	307
PSM	NLEQILNGGESPKQK	1187	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3459.3	38.30655	3	1733.832371	1733.834930	K	G	219	234
PSM	YEQGFITDPVVLSPK	1188	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3883.2	49.22305	3	1771.839371	1771.843369	K	D	110	125
PSM	VLLPEYGGTKVVLDDK	1189	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3596.2	41.85038	3	1824.927371	1824.927433	K	D	71	87
PSM	QATKDAGQISGLNVLR	1190	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3556.3	40.81623	3	1829.840171	1829.843794	R	V	203	219
PSM	NQYDNDVTVWSPQGR	1191	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3470.4	38.5978	3	1857.767471	1857.768307	R	I	4	19
PSM	HSGGFLSSPADFSQENK	1192	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3448.4	38.02258	3	1886.781671	1886.783623	R	A	772	789
PSM	EVDGLLTSEPMGSPVSSK	1193	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3631.2	42.75187	3	1911.854771	1911.853676	K	T	582	600
PSM	SATSSSPGSPLHSLETSL	1194	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4347.2	58.66197	3	1916.778071	1916.780585	K	-	1203	1221
PSM	QIESKTAFQEALDAAGDK	1195	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3622.3	42.52092	3	2000.908871	2000.909217	K	L	4	22
PSM	LATQSNEITIPVTFESR	1196	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4046.3	53.28495	3	2064.916271	2064.917019	K	A	172	189
PSM	LDNVPHTPSSYIETLPK	1197	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	48.46848	3	2069.902271	2069.911205	R	A	45	62
PSM	DALGDSLQVPVSPSSTTSSR	1198	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3586.4	41.59535	3	2082.943571	2082.947059	R	C	141	161
PSM	ILATPPQEDAPSVDIANIR	1199	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	47.0797	3	2099.026271	2099.030001	K	M	284	303
PSM	GSMSDGSYSPDYSLAAVDLK	1200	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3876.2	49.04217	3	2141.883071	2141.886433	K	S	479	499
PSM	DKPTYDEIFYTLSPVNGK	1201	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3933.2	50.4945	3	2165.993771	2165.992219	K	I	444	462
PSM	QHPQPYIFPDSPGGTSYER	1202	sp|Q9Y6M9|NDUB9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3458.4	38.28407	3	2254.962971	2254.968463	R	Y	75	94
PSM	ELSNSPLRENSFGSPLEFR	1203	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3931.5	50.45257	3	2338.001171	2338.003208	K	N	1316	1335
PSM	ETAVPGPLGIEDISPNLSPDDK	1204	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4052.3	53.44753	3	2343.085271	2343.088304	R	S	1413	1435
PSM	DYEIESQNPLASPTNTLLGSAK	1205	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4075.3	53.92957	3	2427.119171	2427.120667	K	E	618	640
PSM	FNEEHIPDSPFVVPVASPSGDAR	1206	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3766.4	46.26005	3	2546.140871	2546.147884	K	R	2311	2334
PSM	DNYVPEVSALDQEIIEVDPDTK	1207	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4852.2	64.38782	3	2568.141971	2568.152026	R	E	82	104
PSM	QREEYQPATPGLGMFVEVKDPEDK	1208	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3551.3	40.68512	4	2858.277694	2858.283392	K	V	72	96
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1209	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,22-UNIMOD:35,26-UNIMOD:21	ms_run[1]:scan=1.1.4639.2	62.4842	4	2968.319694	2968.325196	R	S	59	86
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	1210	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3537.5	40.32412	4	3199.390894	3199.394275	K	N	213	241
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	1211	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,22-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3642.3	43.04418	5	3544.539618	3544.541154	K	E	218	249
PSM	ESVPEFPLSPPK	1212	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3716.3	44.95198	2	1406.652847	1405.653049	K	K	30	42
PSM	SAVGFEYQGK	1213	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3154.3	30.4258	2	1164.483647	1164.485256	K	T	135	145
PSM	LGGSPTSLGTWGSWIGPDHDK	1214	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4021.2	52.70127	3	2246.996771	2246.999763	K	F	439	460
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1215	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3928.5	50.37418	4	3523.457294	3522.472617	K	F	604	634
PSM	TEWETAAPAVAETPDIK	1216	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3920.3	50.18705	3	1949.8642	1949.8654	M	L	2	19
PSM	KYEMFAQTLQQSR	1217	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3143.3	30.13873	3	1724.760071	1724.759322	R	G	754	767
PSM	QVPDSAATATAYLCGVK	1218	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3654.3	43.35797	3	1831.824371	1830.822317	R	A	107	124
PSM	QFTPCQLLADHANSPNKK	1219	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3801.2	47.10862	3	2210.9165	2210.9216	K	F	743	761
PSM	SHPSPQAKPSNPSNPR	1220	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2600.3	17.8741	3	1821.8146	1821.8154	M	V	2	18
PSM	CSDNSSYEEPLSPISASSSTSR	1221	sp|Q8IXK0|PHC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	35.38298	3	2439.973571	2439.973745	R	R	740	762
PSM	VKLDSPAGTALSPSGHTK	1222	sp|P32322|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3054.2	27.817	4	1924.874094	1924.869675	K	L	290	308
PSM	KETPPPLVPPAAR	1223	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.2	29.6387	3	1451.752571	1451.753766	R	E	3	16
PSM	IACKSPPPESVDTPTSTK	1224	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2817.2	21.7517	4	2073.878094	2073.873106	K	Q	1127	1145
PSM	AKPAMPQDSVPSPR	1225	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2929.2	24.61577	3	1559.713871	1559.716729	K	S	470	484
PSM	NLETPLCK	1226	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2984.2	26.0388	2	1053.454247	1053.456598	K	N	86	94
PSM	SGTSEFLNK	1227	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3068.2	28.18153	2	1061.443047	1061.443056	K	M	169	178
PSM	VVDNSALGNSPYHR	1228	sp|Q6P1L8|RM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2897.2	23.7857	3	1607.711771	1607.709335	R	A	40	54
PSM	DLSLEEIQK	1229	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3362.2	35.8174	2	1073.558247	1073.560455	K	K	44	53
PSM	PYQYPALTPEQKK	1230	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	29.01082	3	1641.7805	1641.7799	M	E	2	15
PSM	DVNAAIATIK	1231	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3167.3	30.76508	2	1094.536247	1094.537291	K	T	327	337
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1232	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3105.2	29.14158	6	3290.607141	3290.597273	K	E	178	210
PSM	HGSYEDAVHSGALND	1233	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3010.2	26.7008	3	1650.631571	1650.631145	K	-	542	557
PSM	VDALLSAQPK	1234	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3140.2	30.05735	2	1120.551847	1120.552941	K	G	950	960
PSM	KYEDICPSTHNMDVPNIK	1235	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3275.3	33.56792	4	2239.955694	2239.964306	K	R	68	86
PSM	GHLSRPEAQSLSPYTTSANR	1236	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3055.4	27.8499	4	2251.05329419132	2251.0382736521397	R	A	424	444
PSM	DCGSVDGVIK	1237	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3046.2	27.61085	2	1128.450247	1128.452241	K	E	26	36
PSM	DVNQQEFVR	1238	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3002.2	26.49543	2	1133.542847	1133.546536	K	A	8	17
PSM	GHASAPYFGKEEPSVAPSSTGK	1239	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3068.3	28.18487	4	2283.024894	2283.020893	K	T	131	153
PSM	RLQEDPNYSPQRFPNAQR	1240	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3065.3	28.10635	4	2295.060894	2295.054593	K	A	1109	1127
PSM	GTGLLSSDYR	1241	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3307.2	34.38987	2	1147.487447	1147.491069	K	I	402	412
PSM	YIDQEELNK	1242	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2910.4	24.12968	2	1150.550447	1150.550619	K	T	198	207
PSM	VLLPEYGGTK	1243	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3390.2	36.51394	2	1155.555447	1155.557692	K	V	71	81
PSM	NNEESPTATVAEQGEDITSKK	1244	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3204.2	31.72902	4	2327.024894	2327.016595	K	D	9	30
PSM	GASLKSPLPSQ	1245	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3074.3	28.34145	2	1163.558047	1163.558755	K	-	113	124
PSM	GSLAEAVGSPPPAATPTPTPPTR	1246	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3373.3	36.10773	4	2331.052094	2331.054910	R	K	446	469
PSM	GNDPLTSSPGR	1247	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2870.3	23.09023	2	1179.493247	1179.492132	R	S	20	31
PSM	YLSEVASGDNK	1248	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2831.3	22.11697	2	1181.559247	1181.556432	R	Q	130	141
PSM	WNSVSPASAGK	1249	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2942.4	24.95402	2	1182.503847	1182.507054	K	R	304	315
PSM	RGPAEESSSWRDSSR	1250	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2764.2	20.42445	3	1785.747671	1785.743155	R	R	1250	1265
PSM	DSYVGDEAQSK	1251	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2720.3	19.53797	2	1197.513247	1197.514961	K	R	53	64
PSM	EAESSPFVER	1252	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2961.3	25.44182	2	1229.493447	1229.496549	K	L	548	558
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	1253	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3265.2	33.30535	4	2494.085294	2494.089063	R	L	815	839
PSM	CLAENSLGSAR	1254	sp|P32004|L1CAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2959.3	25.39303	2	1256.518247	1256.522052	R	H	312	323
PSM	TSSGDPPSPLVK	1255	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2954.3	25.25995	2	1263.571447	1263.574799	K	Q	80	92
PSM	LGMLSPEGTCK	1256	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3274.4	33.54553	2	1271.522647	1271.529111	R	A	203	214
PSM	RFSEGVLQSPSQDQEK	1257	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3084.4	28.60483	3	1913.848571	1913.852037	R	L	427	443
PSM	ELASPVSPELR	1258	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3266.3	33.33377	2	1276.605047	1276.606433	K	Q	175	186
PSM	EQNSPIYISR	1259	sp|O14910|LIN7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3059.3	27.95042	2	1285.572247	1285.570382	K	I	127	137
PSM	YCRPESQEHPEADPGSAAPYLK	1260	sp|P40763|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3103.5	29.09907	4	2581.095294	2581.094469	K	T	686	708
PSM	HTIIPAKSPEK	1261	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2724.2	19.64512	3	1299.657671	1299.658803	R	C	1908	1919
PSM	SLVESVSSSPNK	1262	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2968.4	25.62732	2	1312.585847	1312.591177	R	E	309	321
PSM	AGGPTTPLSPTR	1263	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2878.5	23.30477	2	1313.540847	1313.541799	R	L	15	27
PSM	ASPGTPLSPGSLR	1264	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3294.3	34.0639	2	1318.625047	1318.628231	R	S	33	46
PSM	VTAEADSSSPTGILATSESK	1265	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3318.4	34.68139	3	2029.904171	2029.909277	K	S	486	506
PSM	GPSPSSPTPPAAAAPAEQAPR	1266	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3015.4	26.83525	3	2035.930871	2035.936435	R	A	103	124
PSM	TPQEWAPQTAR	1267	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3038.3	27.41658	2	1363.591247	1363.592180	K	I	286	297
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1268	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.2774.3	20.67992	4	2753.012094	2753.011386	K	G	134	157
PSM	AMHQAQTMEGCSSPMVVK	1269	sp|Q92879|CELF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3028.4	27.17335	3	2070.835871	2070.839640	K	F	167	185
PSM	YPLFEGQETGKKETIEE	1270	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3392.5	36.57398	3	2076.922871	2076.929284	R	-	723	740
PSM	QAGGFLGPPPPSGK	1271	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3244.3	32.76583	2	1388.645647	1388.648967	K	F	224	238
PSM	LLGGTRTPINDAS	1272	sp|Q8N357|S35F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3114.6	29.39055	2	1393.655047	1393.660260	R	-	359	372
PSM	ASPGTPLSPGSLR	1273	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3361.4	35.79787	2	1398.591247	1398.594562	R	S	33	46
PSM	NRGDLTADSVQR	1274	sp|P49069|CAMLG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2779.2	20.80713	3	1410.627071	1410.625271	R	G	135	147
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	1275	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3206.4	31.78763	4	2838.179294	2838.177635	K	M	23	49
PSM	DALKPNSPLTER	1276	sp|Q5R3I4|TTC38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2947.2	25.07587	3	1419.672371	1419.675910	R	L	446	458
PSM	SAHATAPVNIAGSR	1277	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2919.2	24.35678	3	1430.664971	1430.666742	R	T	2343	2357
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1278	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3097.5	28.94242	4	2914.288094	2914.285140	K	L	281	308
PSM	ETPAATEAPSSTPK	1279	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2680.3	18.69305	2	1465.630447	1465.633770	K	A	185	199
PSM	DVSGPMPDSYSPR	1280	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3214.3	31.99335	2	1486.577047	1486.579961	K	Y	291	304
PSM	KLEKEEEEGISQESSEEEQ	1281	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2856.6	22.73892	3	2235.988271	2235.986661	K	-	89	108
PSM	GGEIQPVSVKVGDK	1282	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3063.2	28.0508	3	1491.732371	1491.733425	K	V	57	71
PSM	NMAPGAVCSPGESK	1283	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2682.2	18.72407	2	1499.574047	1499.578581	R	E	1289	1303
PSM	DTYSDRSGSSSPDSEITELK	1284	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3299.6	34.20167	3	2252.928071	2252.932197	R	F	565	585
PSM	NIDINDVTPNCR	1285	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3213.3	31.96752	2	1509.623447	1509.628308	K	V	102	114
PSM	DQQNLPYGVTPASPSGHSQGR	1286	sp|Q7KZI7|MARK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3169.4	30.82098	3	2275.001771	2275.001889	R	R	607	628
PSM	ASEAASPLPDSPGDK	1287	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2887.6	23.54113	2	1520.641447	1520.639584	K	L	1144	1159
PSM	PFSAPKPQTSPSPK	1288	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2885.3	23.47927	3	1547.739071	1547.738510	K	R	299	313
PSM	DTCYSPKPSVYLSTPSSASK	1289	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3388.3	36.47153	3	2333.945471	2333.952813	K	A	538	558
PSM	FLMECRNSPVTK	1290	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3085.4	28.6309	2	1560.677847	1560.682986	K	T	58	70
PSM	EVVKPVPITSPAVSK	1291	sp|Q96HC4|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3106.2	29.168	3	1629.875471	1629.874276	K	V	102	117
PSM	DMESPTKLDVTLAK	1292	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3269.3	33.4116	3	1642.747571	1642.752506	K	D	277	291
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	1293	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3056.2	27.86918	5	2769.243118	2769.239553	K	V	100	125
PSM	SAPASPTHPGLMSPR	1294	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3095.4	28.88637	3	1664.677571	1664.678309	R	S	416	431
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	1295	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3207.5	31.8174	4	3351.399294	3351.401211	R	A	108	139
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	1296	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3064.6	28.09055	4	3365.454094	3365.451593	K	K	799	833
PSM	GEPAAAAAPEAGASPVEK	1297	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2911.4	24.15582	3	1701.760871	1701.761096	K	E	88	106
PSM	ASSPSPLTIGTPESQR	1298	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3308.2	34.41485	3	1706.781971	1706.787645	K	K	521	537
PSM	TLNAETPKSSPLPAK	1299	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2917.5	24.31455	3	1712.775671	1712.778735	R	G	208	223
PSM	NLDIERPTYTNLNR	1300	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3274.3	33.5422	3	1717.870271	1717.874747	R	L	216	230
PSM	AVASPEATVSQTDENK	1301	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2928.4	24.59652	3	1725.744971	1725.745840	K	A	495	511
PSM	GQAAVQQLQAEGLSPR	1302	sp|P16152|CBR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3299.3	34.19167	3	1731.826571	1731.830513	R	F	43	59
PSM	ERAMSTTSISSPQPGK	1303	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2825.2	21.9549	3	1755.787871	1755.786265	K	L	265	281
PSM	MDATANDVPSPYEVR	1304	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3211.2	31.91193	3	1759.709171	1759.712432	K	G	434	449
PSM	ICEPGYSPTYKQDK	1305	sp|P07858|CATB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.2957.2	25.33445	3	1764.743771	1764.743004	K	H	210	224
PSM	NHSGSRTPPVALNSSR	1306	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2820.2	21.82887	4	1838.782494	1838.782591	R	M	2098	2114
PSM	TSPSSPAPLPHQEATPR	1307	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2912.2	24.17475	3	1851.850571	1851.851643	R	A	169	186
PSM	QLVRGEPNVSYICSR	1308	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3236.2	32.55392	3	1856.857571	1856.860433	K	Y	269	284
PSM	QASTDAGTAGALTPQHVR	1309	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2866.5	22.99368	3	1859.853371	1859.852705	R	A	107	125
PSM	GVQVETISPGDGRTFPK	1310	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3310.3	34.46898	3	1866.8819	1866.8872	M	R	2	19
PSM	SAPAMQSSGSFNYARPK	1311	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3126.3	29.69473	3	1877.812271	1877.813149	R	Q	719	736
PSM	TTWGDGGENSPCNVVSK	1312	sp|O00161|SNP23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3195.5	31.5042	3	1886.766371	1886.750608	K	Q	101	118
PSM	LSLEGDHSTPPSAYGSVK	1313	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3223.2	32.22173	3	1923.858071	1923.861539	K	A	11	29
PSM	DVDDGSGSPHSPHQLSSK	1314	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2700.3	19.08208	3	2008.756271	2008.756496	R	S	2022	2040
PSM	SHSPSSPDPDTPSPVGDSR	1315	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2819.6	21.81322	3	2080.778171	2080.777625	R	A	616	635
PSM	NPQSILKPHSPTYNDEGL	1316	sp|Q9NVA1|UQCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3361.3	35.79453	3	2088.949271	2088.951751	K	-	282	300
PSM	DSESSNDDTSFPSTPEGIK	1317	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	34.51808	3	2091.811571	2091.815770	K	D	437	456
PSM	AQTPPGPSLSGSKSPCPQEK	1318	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2936.5	24.80988	3	2211.922571	2211.927266	K	S	1001	1021
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	1319	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3109.6	29.25973	3	2779.095971	2779.094999	K	M	571	596
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1320	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3067.5	28.16552	5	3112.509118	3112.507789	R	S	847	876
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1321	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3316.5	34.63251	4	3223.223294	3223.230486	K	-	122	148
PSM	VVLAYEPVWAIGTGK	1322	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4137.2	55.15605	3	1681.843271	1681.848061	K	T	198	213
PSM	QREEYQPATPGLGMFVEVKDPEDK	1323	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3557.2	40.83933	5	2858.282618	2858.283392	K	V	72	96
PSM	STFVLDEFK	1324	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3907.4	49.84103	2	1164.508047	1164.510408	K	R	286	295
PSM	ESAFEFLSSA	1325	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4632.2	62.40093	2	1166.449847	1166.453287	K	-	325	335
PSM	SVDFDSLTVR	1326	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3707.2	44.72343	2	1217.535447	1217.532934	K	T	458	468
PSM	AIVDALPPPCESACTVPTDVDK	1327	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3650.2	43.25033	4	2434.080894	2434.079730	R	W	261	283
PSM	NIEDVIAQGIGK	1328	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3830.2	47.85867	2	1255.670647	1255.677216	K	L	50	62
PSM	YADLTEDQLPSCESLK	1329	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3572.4	41.23874	3	1947.817571	1947.817291	R	D	142	158
PSM	ADLINNLGTIAK	1330	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3617.2	42.3858	2	1321.663647	1321.664283	K	F	96	108
PSM	LLLSSETPIEGK	1331	sp|Q9HDC9|APMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3424.2	37.39697	2	1365.675847	1365.679264	K	N	184	196
PSM	CSPTVAFVEFPSSPQLK	1332	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,2-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4221.2	56.7268	3	2052.865571	2052.866898	R	N	669	686
PSM	ESVPEFPLSPPK	1333	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3724.2	45.1562	2	1405.650647	1405.653049	K	K	30	42
PSM	IMNTFSVVPSPK	1334	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3464.5	38.44345	2	1414.654447	1414.656755	R	V	163	175
PSM	WPDPEDLLTPR	1335	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4057.3	53.56798	2	1417.625247	1417.627897	R	W	39	50
PSM	TVIIEQSWGSPK	1336	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3511.3	39.66562	2	1423.671447	1423.674847	R	V	61	73
PSM	EFSPFGTITSAK	1337	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4010.3	52.41503	2	1443.569647	1443.572430	K	V	313	325
PSM	YHTSQSGDEMTSLSEYVSR	1338	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3522.2	39.946	3	2255.898371	2255.904208	R	M	457	476
PSM	SACGNCYLGDAFR	1339	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3600.3	41.95817	2	1569.570647	1569.574164	K	C	272	285
PSM	GALQNIIPASTGAAK	1340	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3625.4	42.60235	2	1570.712447	1570.715740	R	A	201	216
PSM	HSDLFSSSSPWDK	1341	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3483.2	38.9324	3	1571.630171	1571.629354	K	G	779	792
PSM	KQSLGELIGTLNAAK	1342	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3817.2	47.5197	3	1621.848071	1621.844038	R	V	56	71
PSM	RASGQAFELILSPR	1343	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3685.5	44.17597	2	1623.808647	1623.813407	K	S	14	28
PSM	DHMVSPTAVAFLER	1344	sp|O60499|STX10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3816.2	47.49358	3	1651.743071	1651.742944	K	N	104	118
PSM	APNTPDILEIEFKK	1345	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3738.4	45.52873	3	1693.831271	1693.832805	K	G	216	230
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	1346	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3673.5	43.86187	4	3393.342894	3393.345713	K	F	86	114
PSM	RASGQAFELILSPR	1347	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3901.2	49.67647	3	1703.778671	1703.779738	K	S	14	28
PSM	NTPASASLEGLAQTAGR	1348	sp|Q96Q45|TM237_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3665.2	43.64337	3	1722.795071	1722.793793	K	R	43	60
PSM	VSSGYVPPPVATPFSSK	1349	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3489.3	39.09265	3	1798.854371	1798.854268	R	S	168	185
PSM	ASLGSLEGEAEAEASSPK	1350	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3572.3	41.2354	3	1811.783771	1811.782620	K	G	5748	5766
PSM	DMASPNWSILPEEER	1351	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4056.3	53.5418	3	1852.767371	1852.770281	R	N	327	342
PSM	YFQINQDEEEEEDED	1352	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3427.4	37.47922	2	1930.719847	1930.722842	R	-	114	129
PSM	AEELSPAALSPSLEPIR	1353	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3931.3	50.4459	3	1938.870971	1938.874092	R	C	441	458
PSM	YVASYLLAALGGNSSPSAK	1354	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.4419.2	59.64463	3	1947.930971	1947.934310	R	D	3	22
PSM	TIGGGDDSFNTFFSETGAGK	1355	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3910.2	49.91582	3	2006.879771	2006.885765	K	H	41	61
PSM	AIGGEFSDTNAAVEGTPLPK	1356	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3505.3	39.5102	3	2052.934871	2052.940517	K	A	242	262
PSM	LSGSNPYTTVTPQIINSK	1357	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3605.3	42.08793	3	2078.927471	2078.932669	K	W	605	623
PSM	LTPSPDIIVLSDNEASSPR	1358	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3809.3	47.31617	3	2089.987871	2089.993281	R	S	119	138
PSM	TDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEAR	1359	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,38-UNIMOD:21	ms_run[1]:scan=1.1.4350.2	58.70268	4	4390.914894	4390.915962	R	D	307	349
PSM	SVLCSTPTINIPASPFMQK	1360	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4217.3	56.66305	3	2249.984471	2249.986696	K	L	19	38
PSM	ESMCSTPAFPVSPETPYVK	1361	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3843.3	48.20122	3	2285.901071	2285.902691	K	T	839	858
PSM	SGSSSPDSEITELKFPSINHD	1362	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3848.2	48.31995	3	2325.992171	2326.000217	R	-	571	592
PSM	IADPEHDHTGFLTEYVATR	1363	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3526.6	40.05942	2	2330.951447	2330.961009	R	W	190	209
PSM	IADPEHDHTGFLTEYVATR	1364	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3737.4	45.50225	3	2330.959271	2330.961009	R	W	190	209
PSM	DNLTLWTSENQGDEGDAGEGEN	1365	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3807.5	47.27473	3	2349.941171	2349.946922	R	-	225	247
PSM	TLEEVVMAEEEDEGTDRPGSPA	1366	sp|A6NKF1|SAC31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3872.4	48.94478	3	2439.993971	2439.998897	R	-	383	405
PSM	QSKPVTTPEEIAQVATISANGDK	1367	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3511.6	39.67562	3	2543.147771	2543.155746	K	E	158	181
PSM	DGAVNGPSVVGDQTPIEPQTSIER	1368	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3494.6	39.23305	3	2545.167671	2545.169742	K	L	377	401
PSM	FNEEHIPDSPFVVPVASPSGDAR	1369	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3870.6	48.89912	3	2626.107971	2626.114215	K	R	2311	2334
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	1370	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4749.2	63.41437	3	2996.298071	2996.305323	R	E	492	521
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	1371	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3823.3	47.6795	4	3456.438094	3456.442334	R	-	207	238
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	1372	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3877.6	49.08153	4	3536.404894	3536.408665	R	-	207	238
PSM	QSKPVTTPEEIAQVATISANGDK	1373	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.3678.3	43.98622	3	2446.1548	2446.1623	K	E	158	181
PSM	ADLSLADALTEPSPDIEGEIKR	1374	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4376.2	59.09063	3	2461.1596	2461.1620	M	D	2	24
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1375	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3572.6	41.2454	3	2588.0447	2588.0424	M	R	2	32
PSM	DNNQFASASLDR	1376	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3102.5	29.07262	2	1337.601447	1336.600757	K	T	154	166
PSM	ATGANATPLDFPSK	1377	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3580.3	41.44047	2	1510.6700	1510.6700	M	K	2	16
PSM	TEWETAAPAVAETPDIK	1378	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3990.3	51.93165	3	2029.8290	2029.8318	M	L	2	19
PSM	QVPDSAATATAYLCGVK	1379	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4019.3	52.63948	3	1813.7974	1813.7952	R	A	107	124
PSM	LSLEGDHSTPPSAYGSVK	1380	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3239.3	32.63502	3	1924.860371	1923.861539	K	A	11	29
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1381	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3676.4	43.93699	4	2882.1852	2882.1622	M	D	2	29
PSM	CESAFLSK	1382	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3919.3	50.15055	2	1003.3699	1003.3717	K	R	36	44
PSM	QLSSGVSEIR	1383	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3510.2	39.63662	2	1137.5009	1137.5062	R	H	80	90
PSM	MNPVYSPGSSGVPYANAK	1384	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	40.71135	3	1975.8368	1975.8382	-	G	1	19
PSM	MNLLPNIESPVTRQEK	1385	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4188.2	56.0546	3	1989.9539	1989.9590	-	M	1	17
PSM	SDAAVDTSSEITTK	1386	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3122.5	29.59672	2	1465.6778	1465.6779	M	D	2	16
PSM	AAAMDVDTPSGTNSGAGKK	1387	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3028.2	27.16668	3	1898.8057	1898.8076	M	R	2	21
PSM	LITPAVVSER	1388	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3331.2	35.01022	2	1163.589647	1163.595140	K	L	67	77
PSM	QISSSSTGCLSSPNATVQSPKHEWK	1389	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3151.4	30.35113	4	2875.226494	2875.224905	K	I	266	291
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1390	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3637.3	42.9212	3	2574.981371	2573.998594	R	G	239	267
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1391	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3645.5	43.12942	3	2574.981371	2573.998594	R	G	239	267
PSM	GGGTPDANSLAPPGK	1392	sp|Q9BRQ0|PYGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2952.2	25.20528	3	1417.621571	1417.623874	R	A	299	314
PSM	DGLILTSR	1393	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	35.21655	2	953.454247	953.458313	K	G	149	157
PSM	VLTPTQVK	1394	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2979.2	25.90798	2	964.496247	964.499449	K	N	40	48
PSM	GLTSVINQK	1395	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3350.2	35.50355	2	1038.508847	1038.511076	R	L	300	309
PSM	DATLTALDR	1396	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3319.2	34.7006	2	1054.467647	1054.469606	K	G	391	400
PSM	MLTFNPNK	1397	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	30.31838	2	1059.444047	1059.446034	R	R	310	318
PSM	DGYNYTLSK	1398	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3051.2	27.739	2	1059.486247	1059.487290	K	T	28	37
PSM	SQGDEAGGHGEDRPEPLSPK	1399	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2784.2	20.91865	4	2141.904094	2141.901506	R	E	361	381
PSM	VDLEPVSPR	1400	sp|Q9HCH0|NCK5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3132.2	29.84845	2	1090.516447	1090.505991	R	S	757	766
PSM	SAHVTVSGGTPKGEAVLGTHK	1401	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2964.3	25.52045	4	2191.998894	2192.002814	K	L	305	326
PSM	SPGAPGPLTLK	1402	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3278.2	33.64314	2	1116.554247	1116.558027	R	E	344	355
PSM	SPGAPGPLTLK	1403	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3286.2	33.85165	2	1116.554247	1116.558027	R	E	344	355
PSM	TTEEQVQASTPCPR	1404	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.2745.2	19.95927	3	1682.695571	1682.697116	K	T	97	111
PSM	GHTDTEGRPPSPPPTSTPEK	1405	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2717.2	19.47473	4	2246.928494	2246.924624	R	C	353	373
PSM	IDEMPEAAVKSTANK	1406	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2853.3	22.65163	3	1698.752771	1698.753568	R	Y	30	45
PSM	NLQTVNVDEN	1407	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3023.2	27.0364	2	1144.532847	1144.536031	K	-	116	126
PSM	VGSLTPPSSPK	1408	sp|Q2M2I8|AAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2917.6	24.31788	2	1148.545647	1148.547856	K	T	616	627
PSM	NIGLGFKTPK	1409	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3249.2	32.89245	2	1153.586647	1153.589661	K	E	39	49
PSM	RGGSGSHNWGTVKDELTESPK	1410	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3109.2	29.2464	4	2321.042494	2321.043754	K	Y	216	237
PSM	DNLTSATLPR	1411	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3276.2	33.59115	2	1166.530047	1166.533268	K	N	302	312
PSM	SWNETLTSR	1412	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3174.2	30.94512	2	1172.485647	1172.486318	K	L	33	42
PSM	LALGDDSPALK	1413	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	33.87788	2	1178.554447	1178.558421	R	E	87	98
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1414	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3373.4	36.11106	4	2378.072494	2378.078288	K	S	366	389
PSM	KKPRPPPALGPEETSASAGLPK	1415	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3087.3	28.67945	4	2387.1684941913204	2387.1651280448195	K	K	14	36
PSM	LGAGGGSPEKSPSAQELK	1416	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2890.3	23.60802	3	1791.840671	1791.840409	R	E	13	31
PSM	DITSDTSGDFR	1417	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3112.4	29.33153	2	1212.527047	1212.525861	K	N	167	178
PSM	NAGVEGSLIVEK	1418	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3141.3	30.08693	2	1214.649047	1214.650667	K	I	482	494
PSM	SASVAPFTCK	1419	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3182.4	31.16073	2	1226.444647	1226.444393	K	T	1057	1067
PSM	LLLDPSSPPTK	1420	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3406.4	36.93336	2	1246.618047	1246.621021	K	A	21	32
PSM	DNSTMGYMMAK	1421	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3230.4	32.40482	2	1247.497447	1247.498465	R	K	486	497
PSM	VLQSPATTVVR	1422	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3045.4	27.59227	2	1249.637247	1249.643153	K	T	751	762
PSM	TSSGDPPSPLVK	1423	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2946.5	25.0597	2	1263.571447	1263.574799	K	Q	80	92
PSM	PKIESPKLER	1424	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2829.2	22.05857	3	1275.657671	1275.658803	K	T	805	815
PSM	LMIEMDGTENK	1425	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3260.3	33.18317	2	1279.576847	1279.578824	K	S	93	104
PSM	KQSKPVTTPEEIAQVATISANGDK	1426	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3335.4	35.11995	4	2591.283294	2591.284378	K	E	157	181
PSM	QHEAPSNRPLNELLTPQGPSPR	1427	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3362.3	35.82073	4	2597.176894	2597.178881	R	T	167	189
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	1428	sp|Q27J81|INF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3393.3	36.59308	5	3291.352118	3291.357615	R	S	1160	1192
PSM	EQVANSAFVER	1429	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3063.4	28.05747	2	1328.575647	1328.576196	K	V	365	376
PSM	NGLAAELGPASPR	1430	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3273.3	33.51603	2	1331.616247	1331.623480	R	R	91	104
PSM	LDQPVSAPPSPR	1431	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2949.3	25.1311	2	1342.624047	1342.628231	K	D	235	247
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	1432	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3123.4	29.61975	4	2712.262094	2712.264371	K	T	139	165
PSM	ISVYYNEATGGK	1433	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3147.3	30.2429	2	1380.594847	1380.596263	R	Y	47	59
PSM	ASEAKEGEEAGPGDPLLEAVPKTGDEK	1434	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3328.4	34.94028	4	2803.274494	2803.280080	K	D	348	375
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1435	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3365.4	35.90237	4	2807.196094	2807.201193	R	G	70	97
PSM	GSGSGGSGSDSEPDSPVFEDSK	1436	sp|P36956|SRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3049.4	27.69405	3	2163.807371	2163.811748	R	A	447	469
PSM	AMSTTSISSPQPGK	1437	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2875.5	23.22683	2	1470.641047	1470.642561	R	L	267	281
PSM	SKPIPIMPASPQK	1438	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3137.5	29.98947	2	1472.742247	1472.746238	K	G	607	620
PSM	IIYGGSVTGATCK	1439	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3163.3	30.66068	2	1485.598647	1485.597599	R	E	244	257
PSM	TTPSYVAFTDTER	1440	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3331.4	35.01688	2	1486.686647	1486.693989	R	L	37	50
PSM	AGDLLEDSPKRPK	1441	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2850.3	22.57482	3	1504.731971	1504.728674	R	E	158	171
PSM	DLVAQAPLKPKTPR	1442	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3051.3	27.74233	3	1612.868771	1612.870193	K	G	523	537
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	1443	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3305.5	34.3498	4	3242.258094	3242.265475	K	D	929	958
PSM	SSGGREDLESSGLQR	1444	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2921.5	24.41855	3	1656.706871	1656.710458	K	R	70	85
PSM	MQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSK	1445	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3122.6	29.60005	5	4165.738618	4165.736558	K	D	522	558
PSM	SSGPYGGGGQYFAKPR	1446	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3153.2	30.39662	3	1707.737771	1707.740636	R	N	337	353
PSM	TEDEVLTSKGDAWAK	1447	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	31.86313	3	1728.762371	1728.760762	K	Y	138	153
PSM	FSEGVLQSPSQDQEK	1448	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3187.2	31.28522	3	1757.752271	1757.750926	R	L	428	443
PSM	HAEPLTDTGSETPTAR	1449	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2819.4	21.80655	3	1761.754271	1761.757074	K	R	51	67
PSM	KISPFEHQTYCQR	1450	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.2997.2	26.36762	3	1772.767271	1772.770556	K	T	55	68
PSM	ALVSGKPAESSAVAATEK	1451	sp|O95182|NDUA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3029.2	27.19293	3	1794.875471	1794.876460	K	K	75	93
PSM	SSFASSSASDASKPSSPR	1452	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2747.3	20.01968	3	1834.776671	1834.773452	R	G	122	140
PSM	DAPTSPASVASSSSTPSSK	1453	sp|Q04726|TLE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2892.5	23.6658	3	1842.802571	1842.788433	K	T	282	301
PSM	TSSVSNPQDSVGSPCSR	1454	sp|P49023|PAXI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.2821.2	21.85125	3	1843.742171	1843.740772	K	V	94	111
PSM	QLVRGEPNVSYICSR	1455	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3228.2	32.347	3	1856.857571	1856.860433	K	Y	269	284
PSM	VPSEGPKETPSSANGPSR	1456	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2686.2	18.8056	3	1875.835571	1875.836387	R	E	54	72
PSM	FQEQECPPSPEPTRK	1457	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2834.5	22.19778	3	1908.807971	1908.807729	K	E	178	193
PSM	LPQSSSSESSPPSPQPTK	1458	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2763.5	20.3956	3	1919.849471	1919.851368	K	V	412	430
PSM	NASTFEDVTQVSSAYQK	1459	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3415.4	37.16843	3	1953.832571	1953.835718	K	T	320	337
PSM	SGPKPFSAPKPQTSPSPK	1460	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2919.3	24.36012	4	1996.906094	1996.906060	R	R	295	313
PSM	STPSHGSVSSLNSTGSLSPK	1461	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2965.5	25.55307	3	2008.906871	2008.910280	R	H	238	258
PSM	SMGTGDTPGLEVPSSPLRK	1462	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3267.4	33.36265	3	2023.923971	2023.928573	R	A	381	400
PSM	GPSPSSPTPPAAAAPAEQAPR	1463	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3007.5	26.63473	3	2035.931771	2035.936435	R	A	103	124
PSM	VNQSALEAVTPSPSFQQR	1464	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3375.4	36.16012	3	2037.949571	2037.952085	R	H	390	408
PSM	KDNEESEQPPVPGTPTLR	1465	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3094.4	28.86047	3	2072.940671	2072.941580	K	N	633	651
PSM	SSSPLPTVQLHPQSPTAGK	1466	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3340.2	35.24267	3	2090.939471	2090.943902	K	K	998	1017
PSM	ITITNDQNRLTPEEIER	1467	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3333.4	35.06773	3	2121.006071	2121.010328	K	M	524	541
PSM	DYHFKVDNDENEHQLSLR	1468	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3239.2	32.63168	4	2258.037294	2258.035223	K	T	28	46
PSM	DYHFKVDNDENEHQLSLR	1469	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3247.2	32.83993	4	2258.037294	2258.035223	K	T	28	46
PSM	DQQNLPYGVTPASPSGHSQGR	1470	sp|Q7KZI7|MARK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3161.3	30.60817	3	2275.001771	2275.001889	R	R	607	628
PSM	WLNSGRGDEASEEGQNGSSPK	1471	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2920.6	24.39568	3	2283.936071	2283.939348	R	S	447	468
PSM	IVRGDQPAASGDSDDDEPPPLPR	1472	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3139.5	30.04142	3	2483.094971	2483.096577	K	L	45	68
PSM	ETESAPGSPRAVTPVPTKTEEVSNLK	1473	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3152.4	30.37723	4	2883.325294	2883.330416	K	T	514	540
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	1474	sp|P49006|MRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3076.6	28.4031	4	3492.326494	3492.326786	K	A	111	145
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	1475	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3339.6	35.22989	5	4716.090618	4716.094806	K	A	530	573
PSM	IGPLGLSPK	1476	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3467.2	38.51227	2	960.503047	960.504534	K	K	32	41
PSM	DVQTALALAK	1477	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3590.2	41.69328	2	1108.549847	1108.552941	K	G	70	80
PSM	FEDENFILK	1478	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3545.2	40.52448	2	1153.561047	1153.565540	K	H	83	92
PSM	DDTDDEIAKYDGKWEVEEMK	1479	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3630.3	42.72867	4	2415.040894	2415.042402	K	E	91	111
PSM	DIDISSPEFK	1480	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3527.3	40.07358	2	1229.519847	1229.521701	K	I	172	182
PSM	APVPEPGLDLSLSPRPDSPQPR	1481	sp|Q8TAP8|PPR35_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3767.3	46.28271	4	2484.138894	2484.145122	R	H	35	57
PSM	RIPSIVSSPLNSPLDR	1482	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3741.4	45.60778	3	1909.905971	1909.906395	K	S	327	343
PSM	EGMNIVEAMER	1483	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3623.2	42.54347	2	1277.573247	1277.574407	K	F	134	145
PSM	YFEADPPGQVAASPDPTT	1484	sp|O43598|DNPH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3478.4	38.80748	3	1941.803471	1941.803355	R	-	157	175
PSM	YADLTEDQLPSCESLK	1485	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3580.2	41.43713	3	1947.817571	1947.817291	R	D	142	158
PSM	DITEEIMSGAR	1486	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3705.4	44.6811	2	1300.535647	1300.537033	K	T	191	202
PSM	NSLESYAFNMK	1487	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3550.2	40.65548	2	1302.587647	1302.591438	K	A	540	551
PSM	GRPSSPRTPLYLQPDAYGSLDR	1488	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3620.2	42.46518	4	2605.170094	2605.172733	K	A	116	138
PSM	DVLSVAFSSDNR	1489	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3652.4	43.3091	2	1308.629047	1308.630994	K	Q	107	119
PSM	VWSPLVTEEGK	1490	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3620.3	42.46852	2	1323.608247	1323.611184	K	R	88	99
PSM	NSDVLQSPLDSAARDEL	1491	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3990.2	51.92832	3	1988.811671	1988.812948	K	-	606	623
PSM	NDPFTSDPFTK	1492	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3817.4	47.52637	2	1347.536447	1347.538413	K	N	684	695
PSM	SFSTALYGESDL	1493	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4230.2	56.93987	2	1368.548447	1368.548644	K	-	900	912
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1494	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3854.3	48.47182	5	3465.478118	3465.481982	K	A	399	429
PSM	EQFLDGDGWTSR	1495	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3536.3	40.2925	2	1409.618447	1409.621158	K	W	25	37
PSM	IMNTFSVVPSPK	1496	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3448.5	38.02592	2	1414.654447	1414.656755	R	V	163	175
PSM	GFPTIYFSPANK	1497	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3886.3	49.30447	2	1420.639447	1420.642819	R	K	449	461
PSM	GFPTIYFSPANK	1498	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3895.4	49.5255	2	1420.639447	1420.642819	R	K	449	461
PSM	EFVSISSPAHVAT	1499	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3479.4	38.8339	2	1423.634647	1423.638462	R	-	894	907
PSM	EGFSIPVSADGFK	1500	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3916.3	50.07243	2	1432.626047	1432.627563	K	F	1887	1900
PSM	SVFGTPTLETANK	1501	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3453.5	38.15703	2	1443.659047	1443.664677	K	N	1140	1153
PSM	DFTPVCTTELGR	1502	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3516.4	39.79628	2	1474.614047	1474.616346	R	A	42	54
PSM	NLEQILNGGESPK	1503	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3717.5	44.98418	2	1477.677447	1477.681389	K	Q	219	232
PSM	IMNTFSVVPSPK	1504	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3771.6	46.3975	2	1478.625247	1478.628171	R	V	163	175
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	1505	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3539.3	40.3707	4	2964.312094	2964.313840	K	-	178	207
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1506	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3641.4	43.02078	4	2972.325294	2972.324602	K	Q	178	204
PSM	YRCELLYEGPPDDEAAMGIKSCDPK	1507	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4,21-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3570.2	41.17983	4	2993.264494	2993.264647	K	G	367	392
PSM	SDPVVSYRETVSEESNVLCLSKSPNK	1508	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3670.4	43.78035	4	3003.385294	3003.389648	K	H	573	599
PSM	QQPPEPEWIGDGESTSPSDK	1509	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3483.5	38.9424	3	2262.925271	2262.931803	K	V	7	27
PSM	EGFSIPVSADGFK	1510	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4139.3	55.2183	2	1512.589847	1512.593894	K	F	1887	1900
PSM	TLEAEFNSPSPPTPEPGEGPR	1511	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3496.5	39.28193	3	2287.997771	2287.999823	K	K	525	546
PSM	TTPSVVAFTADGER	1512	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3497.5	39.3083	2	1529.672447	1529.676304	R	L	86	100
PSM	ISMQDVDLSLGSPK	1513	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3835.3	47.99235	2	1568.709647	1568.715726	K	L	500	514
PSM	APLATGEDDDDEVPDLVENFDEASKNEAN	1514	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4397.2	59.42872	4	3198.3020	3198.3033	K	-	178	207
PSM	FSPVTPKFTPVASK	1515	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3468.2	38.53867	3	1664.759771	1664.761628	K	F	266	280
PSM	NGQHVASSPIPVVISQSEIGDASR	1516	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3583.4	41.51887	3	2527.197071	2527.206796	K	V	2026	2050
PSM	LQLDSPEDAEFIVAK	1517	sp|O43242|PSMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3900.2	49.65003	3	1753.814171	1753.817549	K	A	426	441
PSM	DASDDLDDLNFFNQK	1518	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4150.2	55.37883	3	1755.757571	1755.758774	K	K	65	80
PSM	MYFPDVEFDIKSPK	1519	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3975.2	51.53742	3	1794.790271	1794.793976	K	F	5088	5102
PSM	GQEDSLASAVDAATEQK	1520	sp|Q8WUD4|CCD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3709.3	44.7758	3	1798.760471	1798.762219	K	T	145	162
PSM	RIDFIPVSPAPSPTR	1521	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3762.2	46.1494	3	1811.832371	1811.837252	K	G	136	151
PSM	VYWDNGAQIISPHDK	1522	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3449.2	38.04212	3	1821.806471	1821.808715	K	G	176	191
PSM	ASSTSPVEISEWLDQK	1523	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4041.2	53.15197	3	1855.821971	1855.824091	K	L	188	204
PSM	ASSTSPVEISEWLDQK	1524	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4049.4	53.36257	3	1855.821971	1855.824091	K	L	188	204
PSM	GADFLVTEVENGGSLGSK	1525	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3976.2	51.56355	3	1858.830671	1858.834990	K	K	189	207
PSM	SESAPTLHPYSPLSPK	1526	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3430.2	37.54878	3	1869.790271	1869.795113	R	G	100	116
PSM	EGSVLDILKSPGFASPK	1527	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4190.2	56.08837	3	1903.871771	1903.873363	K	I	605	622
PSM	DGDSYDPYDFSDTEEEMPQVHTPKTADSQETK	1528	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3751.4	45.87494	4	3821.446094	3821.448889	K	E	701	733
PSM	AAVPSGASTGIYEALELR	1529	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4558.2	61.54762	3	1963.866971	1963.869341	R	D	33	51
PSM	VLDSGAPIKIPVGPETLGR	1530	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3956.4	51.0854	3	2078.017871	2078.021425	K	I	125	144
PSM	EYIPTVFDNYSAQSAVDGR	1531	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3961.2	51.20885	3	2210.947871	2210.952145	K	T	31	50
PSM	SLPTPAVLLSPTKEPPPLLAK	1532	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4105.2	54.56975	3	2328.210971	2328.214705	K	P	632	653
PSM	DNLTLWTSENQGDEGDAGEGEN	1533	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3815.5	47.47788	3	2349.942371	2349.946922	R	-	225	247
PSM	LVGQGASAVLLDLPNSGGEAQAK	1534	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4029.3	52.88432	3	2354.089571	2354.092023	R	K	30	53
PSM	DSGSDEDFLMEDDDDSDYGSSK	1535	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3444.4	37.9173	3	2443.857071	2443.860534	K	K	129	151
PSM	ADLLLSTQPGREEGSPLELER	1536	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3837.6	48.05465	3	2469.111671	2469.118966	K	L	593	614
PSM	IAQLEEELEEEQGNTELINDR	1537	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3806.3	47.24187	3	2471.168171	2471.166357	R	L	1731	1752
PSM	ERIQQFDDGGSDEEDIWEEK	1538	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3647.5	43.18198	3	2504.001671	2504.001674	K	H	607	627
PSM	YDSDGDKSDDLVVDVSNEDPATPR	1539	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3471.6	38.63043	3	2688.102971	2688.107595	R	V	238	262
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	1540	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4773.2	63.64418	3	2996.298071	2996.305323	R	E	492	521
PSM	VSMPDVELNLKSPK	1541	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3255.3	33.0523	3	1651.787171	1651.789226	K	V	3415	3429
PSM	DDDIAALVVDNGSGMCK	1542	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.3970.5	51.42003	2	1836.7866	1836.7865	M	A	2	19
PSM	EDFDSLLQSAK	1543	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3745.3	45.7082	2	1331.561647	1331.564628	K	K	288	299
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1544	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3502.4	39.43532	3	2508.0724	2508.0760	M	R	2	32
PSM	AESSESFTMASSPAQR	1545	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3422.6	37.35845	2	1806.7115	1806.7126	M	R	2	18
PSM	DSENLASPSEYPENGER	1546	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3172.4	30.8996	3	1972.767071	1972.768760	R	F	617	634
PSM	ATAEVLNIGKK	1547	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3483.3	38.93573	2	1264.6405	1264.6423	M	L	2	13
PSM	NSGSFPSPSISPR	1548	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3352.6	35.5692	2	1491.577047	1491.579641	R	-	1258	1271
PSM	CGNTIPDDDNQVVSLSPGSR	1549	sp|P07942|LAMB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3698.3	44.50414	3	2192.8984	2192.9040	R	Y	643	663
PSM	ISVREPMQTGIK	1550	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	28.93242	3	1437.708071	1437.705102	R	A	183	195
PSM	AADVSVTHRPPLSPK	1551	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3163.2	30.65735	3	1695.8332	1695.8340	M	S	2	17
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1552	sp|Q04760|LGUL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3674.6	43.89158	3	2882.1529	2882.1618	M	D	2	29
PSM	GSLSNAGDPEIVKSPSDPK	1553	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3044.3	27.56403	3	1976.905871	1976.909217	R	Q	93	112
PSM	ASGVTVNDEVIK	1554	sp|Q9Y281|COF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3514.3	39.74172	2	1352.6152	1352.6220	M	V	2	14
PSM	KPAAAAAPGTAEKLSPK	1555	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2776.5	20.72742	3	1766.834171	1766.836918	K	A	23	40
PSM	EFFPIADGDQQSPIEIK	1556	sp|Q8N1Q1|CAH13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4061.2	53.6351	3	2013.913571	2012.913240	K	T	19	36
PSM	VYWDNGAQIISPHDK	1557	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3457.3	38.2545	3	1821.806471	1821.808715	K	G	176	191
PSM	LQPQEISPPPTANLDRSNDK	1558	sp|Q05397|FAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3238.2	32.60545	4	2379.062094	2379.050887	K	V	904	924
PSM	QAGGFLGPPPPSGK	1559	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=1.1.3659.3	43.48915	2	1371.6185	1371.6219	K	F	224	238
PSM	QAGGFLGPPPPSGK	1560	sp|Q9UM00|TMCO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=1.1.3651.3	43.27935	2	1371.6185	1371.6219	K	F	224	238
PSM	QHEAPSNRPLNELLTPQGPSPR	1561	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3546.2	40.55057	4	2580.1544	2580.1518	R	T	167	189
PSM	TLNEADCATVPPAIR	1562	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3270.4	33.44102	3	1706.764571	1706.769887	K	S	648	663
PSM	VASGGGGVGDGVQEPTTGNWR	1563	sp|O00429-2|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3254.4	33.02912	3	2079.896171	2079.901112	K	G	559	580
PSM	ADLNQGIGEPQSPSRR	1564	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2932.3	24.6971	4	1803.825694	1803.826490	R	V	63	79
PSM	ETERASPIKMDLAPSK	1565	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3095.2	28.8797	4	1851.893694	1851.880166	K	D	353	369
PSM	DISLSDYK	1566	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3230.2	32.39815	2	939.455447	939.454927	K	G	28	36
PSM	TLRLNQPGTPTR	1567	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2911.2	24.14915	3	1432.718171	1432.718778	K	T	386	398
PSM	AMAPTSPQI	1568	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3057.2	27.8952	2	1010.414247	1010.414399	K	-	259	268
PSM	HELQANCYEEVK	1569	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2890.2	23.60468	3	1518.678671	1518.677293	K	D	133	145
PSM	CESAFLSK	1570	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3081.2	28.51992	2	1020.396847	1020.398749	K	R	36	44
PSM	TTHFVEGGDAGNREDQINR	1571	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2853.2	22.6483	4	2114.976494	2114.972957	K	L	224	243
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	1572	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3378.4	36.23907	3	3185.429171	3185.436140	K	-	708	738
PSM	AQQNNVEHKVETFSGVYK	1573	sp|P62081|RS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3186.2	31.25905	4	2156.987294	2156.989199	K	K	161	179
PSM	HVEEFSPR	1574	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2830.2	22.09773	2	1079.445847	1079.443725	K	A	408	416
PSM	GHTDTEGRPPSPPPTSTPEK	1575	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2700.2	19.07208	4	2246.928494	2246.924624	R	C	353	373
PSM	YNLQEVVKSPKDPSQLNSK	1576	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3272.3	33.49017	4	2253.098894	2253.104229	K	Q	262	281
PSM	DYGNSPLHR	1577	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2773.3	20.64782	2	1137.462047	1137.460438	K	F	429	438
PSM	SGCSEAQPPESPETR	1578	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2715.3	19.43137	3	1710.657071	1710.655645	K	L	424	439
PSM	VLLPEYGGTK	1579	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3364.3	35.87282	2	1155.555447	1155.557692	K	V	71	81
PSM	LKGEATVSFDDPPSAK	1580	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3150.3	30.32172	3	1740.799871	1740.797147	K	A	333	349
PSM	IFQKGESPVDYDGGR	1581	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3080.5	28.50393	3	1746.759071	1746.761431	K	T	242	257
PSM	MDATANDVPSPYEVR	1582	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3315.2	34.59633	3	1743.713471	1743.717517	K	G	434	449
PSM	TPESSHEGLITDPHSPSRFR	1583	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3037.2	27.38895	4	2329.052094	2329.048839	R	V	719	739
PSM	GNDPLTSSPGR	1584	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2878.4	23.30143	2	1179.493247	1179.492132	R	S	20	31
PSM	LPDLSPVENK	1585	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3341.2	35.26859	2	1190.552047	1190.558421	K	E	2101	2111
PSM	EAALPPVSPLK	1586	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	35.7912	2	1200.613647	1200.615542	R	A	1224	1235
PSM	EAALPPVSPLK	1587	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3369.2	36.00028	2	1200.613647	1200.615542	R	A	1224	1235
PSM	NLQTVNVDEN	1588	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3112.5	29.33487	2	1224.500647	1224.502362	K	-	116	126
PSM	SASVAPFTCK	1589	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3094.3	28.85713	2	1226.449447	1226.444393	K	T	1057	1067
PSM	ALINSPEGAVGR	1590	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3240.4	32.66463	2	1262.597447	1262.602017	R	S	66	78
PSM	WNSVSPASAGK	1591	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2998.3	26.3958	2	1262.470247	1262.473385	K	R	304	315
PSM	DCAVKPCQSDEVPDGIKSASYK	1592	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3134.2	29.90082	4	2533.084494	2533.086607	R	Y	98	120
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1593	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3321.4	34.75895	4	2539.245694	2539.247205	R	D	175	200
PSM	NFSDNQLQEGK	1594	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2920.4	24.38902	2	1278.578847	1278.584044	R	N	161	172
PSM	VDSPTVNTTLR	1595	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3021.3	26.98785	2	1281.592447	1281.596597	K	S	443	454
PSM	GGSGSGPTIEEVD	1596	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3203.4	31.70915	2	1283.492847	1283.491857	K	-	629	642
PSM	ELISNSSDALDK	1597	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3067.6	28.16885	2	1290.627847	1290.630326	R	I	47	59
PSM	IACRSPQPDPVGTPTIFKPQSK	1598	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3392.4	36.57065	4	2583.189294	2583.195777	K	R	2219	2241
PSM	NLQYYDISAK	1599	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3371.3	36.05612	2	1293.560247	1293.564234	K	S	143	153
PSM	CSGPGLSPGMVR	1600	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3243.3	32.73963	2	1296.532647	1296.535594	K	A	1453	1465
PSM	VNTPTTTVYR	1601	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.2950.6	25.16702	2	1310.527447	1310.530900	K	C	244	254
PSM	SERPPTILMTEEPSSPK	1602	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3314.4	34.577	3	1977.908771	1977.911860	K	G	1080	1097
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1603	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3198.4	31.5789	4	2637.344894	2637.341499	R	R	31	56
PSM	NSNPALNDNLEK	1604	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2912.5	24.18475	2	1327.636047	1327.636808	K	G	120	132
PSM	EITALAPSTMK	1605	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3123.3	29.61642	2	1336.536447	1336.538687	K	I	318	329
PSM	TQPDGTSVPGEPASPISQR	1606	sp|Q14980|NUMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3099.2	28.98408	3	2002.900271	2002.899715	R	L	1744	1763
PSM	TPKGPSSVEDIK	1607	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2883.3	23.4276	3	1336.628171	1336.627563	K	A	237	249
PSM	TPKGPSSVEDIK	1608	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2891.4	23.63687	2	1336.623847	1336.627563	K	A	237	249
PSM	LAIQGPEDSPSR	1609	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3059.5	27.95708	2	1348.599047	1348.602411	R	Q	230	242
PSM	ELASPVSPELR	1610	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3338.4	35.19753	2	1356.571447	1356.572764	K	Q	175	186
PSM	LPQPPEGQTYNN	1611	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3078.4	28.44822	2	1356.626247	1356.630994	K	-	134	146
PSM	REAALPPVSPLK	1612	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3175.2	30.97113	3	1356.717971	1356.716653	K	A	1223	1235
PSM	TFDQLTPEESK	1613	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3089.4	28.73393	2	1373.572847	1373.575193	K	E	60	71
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	1614	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2870.6	23.10023	4	2750.195694	2750.193331	R	T	13	39
PSM	GVQVETISPGDGR	1615	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3061.3	28.00213	2	1393.6209	1393.6233	M	T	2	15
PSM	GGTTSWGTSGQPSPSYDSSR	1616	sp|Q99081|HTF4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3135.3	29.93052	3	2093.837471	2093.832758	R	G	55	75
PSM	ASPGTPLSPGSLR	1617	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3353.4	35.58852	2	1398.591247	1398.594562	R	S	33	46
PSM	NSGSFPSPSISPR	1618	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3272.5	33.49683	2	1411.621047	1411.613310	R	-	1258	1271
PSM	GILAADESTGSIAK	1619	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3200.3	31.62792	2	1411.658247	1411.659591	K	R	29	43
PSM	DTPTSAGPNSFNK	1620	sp|Q8WW12|PCNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2908.5	24.08432	2	1414.583447	1414.576590	R	G	138	151
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	1621	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3198.5	31.58223	4	2838.179294	2838.177635	K	M	23	49
PSM	NSVTPLASPEPTK	1622	sp|Q16875|F263_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3017.5	26.8907	2	1419.658847	1419.664677	R	K	460	473
PSM	TPQAPASANLVGPRSAHATAPVNIAGSR	1623	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3306.2	34.36473	4	2870.357694	2870.358971	R	T	2329	2357
PSM	NIIHGSDSVESAEK	1624	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2836.2	22.23923	3	1484.710571	1484.710701	R	E	115	129
PSM	RRGNDPLTSSPGR	1625	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2713.2	19.38817	3	1491.692471	1491.694354	R	S	18	31
PSM	NDSLVTPSPQQAR	1626	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2945.4	25.03058	2	1491.669247	1491.671887	R	V	144	157
PSM	SHVEDGDIAGAPASSPEAPPAEQDPVQLK	1627	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3363.4	35.84997	4	2991.344094	2991.349891	K	T	1263	1292
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	1628	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3348.5	35.46137	4	3044.153694	3044.151982	K	L	595	622
PSM	NVFSSSGTSFSGRK	1629	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3122.2	29.58672	3	1539.677171	1539.671887	K	I	1453	1467
PSM	LGNNEACSSCHCSPVGSLSTQCDSYGR	1630	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4,10-UNIMOD:4,12-UNIMOD:4,17-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3165.5	30.71942	4	3082.168894	3082.167470	R	C	389	416
PSM	VPSPLEGSEGDGDTD	1631	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3265.6	33.31868	2	1553.572647	1553.577043	K	-	413	428
PSM	TQSPGGCSAEAVLAR	1632	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3188.6	31.32442	2	1582.679847	1582.681072	R	K	74	89
PSM	GGKPEPPAMPQPVPTA	1633	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3254.6	33.03578	2	1652.758647	1652.763345	K	-	228	244
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	1634	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3199.5	31.60827	4	3351.399294	3351.401211	R	A	108	139
PSM	KYEDICPSTHNMDVPNIK	1635	sp|P63241|IF5A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3283.2	33.77355	4	2239.955694	2239.964306	K	R	68	86
PSM	YNEQHVPGSPFTAR	1636	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3154.2	30.42247	3	1681.730471	1681.724985	K	V	1938	1952
PSM	DYTGCSTSESLSPVK	1637	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3119.5	29.5179	3	1709.686871	1709.685548	R	Q	199	214
PSM	QLRFEDVVNQSSPK	1638	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3358.2	35.71317	3	1725.807671	1725.808715	K	N	190	204
PSM	AVTPVPTKTEEVSNLK	1639	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3060.2	27.97298	3	1791.901571	1791.901947	R	T	524	540
PSM	SLSSQIETMRSPDGSK	1640	sp|P05997|CO5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3222.2	32.1965	3	1801.787471	1801.791745	K	K	1274	1290
PSM	TPEPSSPVKEPPPVLAK	1641	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3092.4	28.80927	3	1851.933371	1851.938332	K	P	639	656
PSM	TKTEQELPRPQSPSDLDSLDGR	1642	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3290.3	33.95975	4	2548.177694	2548.180641	K	S	90	112
PSM	VKLESPTVSTLTPSSPGK	1643	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3288.2	33.90415	3	1986.926171	1986.931606	R	L	290	308
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	1644	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3255.5	33.05897	4	2660.143694	2660.147901	R	-	621	645
PSM	SMGTGDTPGLEVPSSPLRK	1645	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3376.3	36.18122	3	2007.923171	2007.933658	R	A	381	400
PSM	KPVTVSPTTPTSPTEGEAS	1646	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.2999.4	26.42433	3	2044.863071	2044.864315	R	-	505	524
PSM	HFKDEDEDEDVASPDGLGR	1647	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3056.4	27.87585	3	2209.880771	2209.880102	K	L	537	556
PSM	DCAVKPCQSDEVPDGIKSASYK	1648	sp|Q96HE7|ERO1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3142.2	30.10955	4	2533.084494	2533.086607	R	Y	98	120
PSM	DSLIDSLT	1649	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3884.2	49.25238	2	862.426847	862.428378	R	-	238	246
PSM	DVIEEYFK	1650	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3723.2	45.13045	2	1041.500047	1041.501878	K	C	122	130
PSM	GLESAFTEK	1651	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3535.2	40.26413	2	1060.444447	1060.447807	K	V	1291	1300
PSM	AVDSLVPIGR	1652	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3562.2	40.97048	2	1105.551447	1105.553276	K	G	195	205
PSM	GTPLISPLIK	1653	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3786.2	46.75613	2	1117.614847	1117.614813	R	W	826	836
PSM	QREEYQPATPGLGMFVEVKDPEDK	1654	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3556.2	40.8129	5	2858.282618	2858.283392	K	V	72	96
PSM	SVSPLVWCR	1655	sp|Q9P270|SLAI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3583.2	41.5122	2	1182.529847	1182.525681	K	Q	145	154
PSM	AEEYEFLTPVEEAPK	1656	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3736.2	45.46947	3	1830.792671	1830.796479	R	G	153	168
PSM	NLFEDQNTLTSICEK	1657	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3797.2	47.00372	3	1890.809771	1890.807061	K	V	332	347
PSM	LDIDSPPITAR	1658	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3449.3	38.04545	2	1276.603447	1276.606433	R	N	33	44
PSM	LDIDSPPITAR	1659	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3446.3	37.9667	2	1276.603447	1276.606433	R	N	33	44
PSM	NLEELNISSAQ	1660	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3636.4	42.8891	2	1296.559247	1296.559877	K	-	120	131
PSM	TVSLPLSSPNIK	1661	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3536.2	40.28917	2	1334.681647	1334.684684	K	L	1663	1675
PSM	DVIELTDDSFDK	1662	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3670.3	43.77702	2	1395.637247	1395.640556	K	N	161	173
PSM	AFLAELEQNSPK	1663	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3639.4	42.96853	2	1425.652047	1425.654112	K	I	4512	4524
PSM	QREEYQPATPGLGMFVEVKDPEDK	1664	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3559.2	40.89192	4	2858.277694	2858.283392	K	V	72	96
PSM	SSTVGLVTLNDMK	1665	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3709.5	44.78247	2	1443.659847	1443.668047	K	A	62	75
PSM	KYEQGFITDPVVLSPKDR	1666	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3479.5	38.83723	3	2171.065271	2171.066387	K	V	109	127
PSM	TSSLAPVVGTTTTTPSPSAIK	1667	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3553.2	40.7338	3	2175.005171	2175.011313	K	A	226	247
PSM	ESDQTLAALLSPK	1668	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3943.2	50.76043	2	1451.689047	1451.690891	K	E	1687	1700
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	1669	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3686.2	44.19227	4	2908.389694	2908.396782	R	S	67	92
PSM	IMNTFSVVPSPK	1670	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3755.3	45.96928	2	1478.625647	1478.628171	R	V	163	175
PSM	GIQYIDLSSDSEDVVSPNCSNTVQEK	1671	sp|Q9H4L7|SMRCD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3755.4	45.97262	4	2963.268494	2963.274343	R	T	88	114
PSM	EQFLDGDGWTSR	1672	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3650.3	43.25367	2	1489.585247	1489.587489	K	W	25	37
PSM	YQIDPDACFSAK	1673	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3473.4	38.67624	2	1493.585447	1493.589797	K	V	225	237
PSM	GTPLYGQPSWWGDDEVDEK	1674	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3992.2	51.98417	3	2257.920971	2257.920510	R	R	173	192
PSM	LTFDTTFSPNTGK	1675	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3625.3	42.59902	2	1507.661447	1507.659591	K	K	108	121
PSM	TTPSVVAFTADGER	1676	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3489.5	39.09932	2	1529.672447	1529.676304	R	L	86	100
PSM	LQALVNSLCAGQSP	1677	sp|Q6XQN6|PNCB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3758.2	46.04433	2	1536.699247	1536.700745	R	-	525	539
PSM	DNLTLWTSENQGDEGDAGEGEN	1678	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3770.5	46.36828	3	2349.941171	2349.946922	R	-	225	247
PSM	GALQNIIPASTGAAK	1679	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3641.5	43.02412	2	1570.712447	1570.715740	R	A	201	216
PSM	TCNSPQNSTDSVSDIVPDSPFPGALGSDTR	1680	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3911.3	49.94513	4	3200.352094	3200.360533	R	T	208	238
PSM	IDFSSIAVPGTSSPR	1681	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3862.3	48.68052	2	1612.745847	1612.749803	R	Q	94	109
PSM	DVDASPSPLSVQDLK	1682	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3585.3	41.56615	2	1649.749047	1649.754948	R	G	405	420
PSM	VTNGAFTGEISPGMIK	1683	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3506.3	39.53618	3	1716.778871	1716.779389	K	D	107	123
PSM	NVQAEEMVEFSSGLK	1684	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3727.3	45.2378	3	1746.748271	1746.753568	R	G	89	104
PSM	VDIDTPDINIEGSEGK	1685	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3544.6	40.51085	2	1780.774047	1780.776806	K	F	3712	3728
PSM	RTLDFDPLLSPASPK	1686	sp|Q53H80|AKIR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4047.2	53.30415	3	1815.815171	1815.820934	K	R	9	24
PSM	CIPALDSLTPANEDQK	1687	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3532.5	40.20407	2	1850.805047	1850.812146	R	I	447	463
PSM	LLSPRPSLLTPTGDPR	1688	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3630.4	42.732	3	1878.896171	1878.900581	R	A	937	953
PSM	TDGFAEAIHSPQVAGVPR	1689	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3456.5	38.23532	3	1930.890971	1930.893842	R	F	2146	2164
PSM	CPSLDNLAVPESPGVGGGK	1690	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	40.92147	3	1932.861971	1932.865244	R	A	2249	2268
PSM	NASTFEDVTQVSSAYQK	1691	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3485.6	38.99838	2	1953.833647	1953.835718	K	T	320	337
PSM	SSSPAPADIAQTVQEDLR	1692	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3743.2	45.65302	3	2043.851471	2043.855147	K	T	230	248
PSM	FSGWYDADLSPAGHEEAK	1693	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3587.3	41.61798	3	2058.834371	2058.836052	R	R	22	40
PSM	DNLTLWTSDQQDEEAGEGN	1694	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3818.3	47.54883	3	2120.871371	2120.877051	R	-	228	247
PSM	ATESGAQSAPLPMEGVDISPK	1695	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3640.5	42.99813	3	2163.972671	2163.975917	K	Q	8	29
PSM	YESQEPLAGQESPLPLATR	1696	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	41.33883	3	2165.007371	2165.004180	R	E	590	609
PSM	GVAQTPGSVEEDALLCGPVSK	1697	sp|Q9BQP7|MGME1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3755.2	45.96595	3	2193.000071	2193.002466	R	H	64	85
PSM	AGSPRGSPLAEGPQAFFPER	1698	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3909.4	49.89308	3	2229.956171	2229.960950	R	G	181	201
PSM	QQPPEPEWIGDGESTSPSDK	1699	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3491.5	39.15127	3	2262.925271	2262.931803	K	V	7	27
PSM	DSALQDTDDSDDDPVLIPGAR	1700	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3772.2	46.41051	3	2293.954571	2293.958746	R	Y	648	669
PSM	DDLVTVKTPAFAESVTEGDVR	1701	sp|P36957|ODO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3775.3	46.49163	3	2328.075971	2328.088638	K	W	68	89
PSM	ELSNSPLRENSFGSPLEFR	1702	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3923.5	50.24672	3	2338.001171	2338.003208	K	N	1316	1335
PSM	TMIISPERLDPFADGGKTPDPK	1703	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4038.2	53.07815	4	2544.134894	2544.137259	R	M	125	147
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1704	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3795.5	46.96423	3	2881.086971	2881.094982	K	T	701	725
PSM	SEPERGRLTPSPDIIVLSDNEASSPR	1705	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3612.4	42.26299	4	2981.350894	2981.353277	R	S	112	138
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	1706	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3438.4	37.76025	4	3114.457294	3114.465924	K	R	65	93
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1707	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3725.5	45.19192	4	3385.513294	3385.515651	K	A	399	429
PSM	VLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST	1708	sp|Q16740|CLPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	34-UNIMOD:21	ms_run[1]:scan=1.1.3535.5	40.27413	5	3596.727118	3596.728741	K	-	244	278
PSM	PVTTPEEIAQVATISANGDK	1709	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3687.3	44.2219	3	2120.001971	2120.003846	K	E	161	181
PSM	CSGPGLSPGMVR	1710	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	41.74558	2	1279.5107	1279.5085	K	A	1453	1465
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1711	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2781.2	20.8483	4	2594.063294	2593.078724	K	G	134	157
PSM	NPEVGLKPVWYSPK	1712	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3551.2	40.68178	3	1692.824171	1692.827660	K	V	536	550
PSM	PAEKPAETPVATSPTATDSTSGDSSR	1713	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2826.6	21.99422	3	2639.163071	2639.159965	K	S	148	174
PSM	IDEMPEAAVKSTANK	1714	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2955.5	25.29253	3	1683.759371	1682.758653	R	Y	30	45
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1715	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3998.4	52.14988	3	2830.1932	2829.1962	-	Y	1	25
PSM	ASGVAVSDGVIK	1716	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3657.4	43.4403	2	1303.5443	1303.5457	M	V	2	14
PSM	SPWSNKYDPPLEDGAMPSAR	1717	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3410.4	37.03725	3	2312.981171	2312.977314	R	L	73	93
PSM	EQFLDGDGWTSR	1718	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3634.2	42.83015	2	1490.587047	1489.587489	K	W	25	37
PSM	DLGTQNHTSELILSSPPGQK	1719	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3417.6	37.22763	3	2202.033671	2201.036543	K	V	385	405
PSM	QEEEAAQQGPVVVSPASDYK	1720	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=1.1.3453.6	38.16037	3	2193.9400	2193.9462	R	D	145	165
PSM	NVSSFPDDATSPLQENR	1721	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	37.0831	3	1956.828071	1955.826216	R	N	52	69
PSM	TDSWALAVDEQEAAVKSMTNLQIKEEK	1722	sp|Q9NUU7|DD19A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	17-UNIMOD:21,18-UNIMOD:35,19-UNIMOD:21	ms_run[1]:scan=1.1.2708.2	19.26295	5	3209.4502	3209.4232	A	V	3	30
PSM	CESAFLSK	1723	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3928.2	50.36418	2	1003.3699	1003.3717	K	R	36	44
PSM	CDFTEDQTAEFK	1724	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3649.6	43.2376	2	1611.5807	1611.5795	M	E	2	14
PSM	QLSSGVSEIR	1725	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3567.2	41.10092	2	1137.5041	1137.5062	R	H	80	90
PSM	AENVVEPGPPSAK	1726	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3215.6	32.02918	2	1415.6332	1415.6329	M	R	2	15
PSM	GEAAPGPAPPAPEATPPPASAAGK	1727	sp|Q9NSI2|F207A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3070.5	28.24333	3	2267.983871	2267.986496	K	D	20	44
PSM	TVSLTPSPTTQVETPDLVDHDNTSPLFR	1728	sp|Q05209|PTN12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21,14-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4135.3	55.11413	4	3306.405294	3306.413568	K	T	565	593
PSM	EKEEHTQEEGTVPSRTIEEEK	1729	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2500.2	17.08698	5	2565.1272	2564.1272	R	G	399	420
PSM	RPESPSEISPIK	1730	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2993.5	26.27923	2	1498.6462	1498.6465	K	G	218	230
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	1731	sp|A0FGR8|ESYT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3080.6	28.50727	4	3212.325694	3212.319276	K	A	688	720
PSM	APASVLPAATPR	1732	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3154.5	30.43247	2	1309.580847	1309.583269	R	Q	45	57
PSM	EAALPPVSPLK	1733	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3382.2	36.3244	2	1200.606047	1200.615542	R	A	1224	1235
PSM	LILDSAR	1734	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3127.2	29.71755	2	866.425847	866.426284	K	A	544	551
PSM	RRWDQTADQTPGATPK	1735	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2847.2	22.4939	4	1906.870094	1906.868690	K	K	198	214
PSM	VLTPTQVK	1736	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2971.2	25.69918	2	964.496247	964.499449	K	N	40	48
PSM	SKPIPIMPASPQK	1737	sp|O00429|DNM1L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.2880.3	23.34962	3	1488.749471	1488.741153	K	G	607	620
PSM	DWDDDQND	1738	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2926.4	24.54478	2	1021.323447	1021.326098	K	-	541	549
PSM	DWDDDQND	1739	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2934.2	24.74552	2	1021.323447	1021.326098	K	-	541	549
PSM	MLTFNPNK	1740	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3406.2	36.9267	2	1043.449247	1043.451119	R	R	310	318
PSM	DAYSSFGSR	1741	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3126.2	29.6914	2	1068.391647	1068.391355	K	S	67	76
PSM	DGGAWGTEQR	1742	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2849.5	22.55565	2	1075.471847	1075.468286	K	E	65	75
PSM	DYDDMSPR	1743	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2884.3	23.45323	2	1077.347447	1077.347441	R	R	279	287
PSM	INNFSADIK	1744	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3242.3	32.71367	2	1100.488447	1100.490341	K	D	289	298
PSM	MESALDQLK	1745	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3355.2	35.63438	2	1113.477847	1113.477727	R	Q	11	20
PSM	NYLQSLPSK	1746	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3299.2	34.18833	2	1128.519047	1128.521641	R	T	279	288
PSM	HYGGLTGLNK	1747	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3015.2	26.82858	2	1138.513447	1138.517224	R	A	91	101
PSM	WNSVSPASAGK	1748	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2934.4	24.75218	2	1182.503847	1182.507054	K	R	304	315
PSM	GMGPGTPAGYGR	1749	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2958.4	25.36757	2	1199.478647	1199.479459	R	G	682	694
PSM	RSEACPCQPDSGSPLPAEEEK	1750	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2922.5	24.44413	4	2422.9823	2422.9765	R	R	492	513
PSM	VQEAESPVFK	1751	sp|Q08357|S20A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3045.3	27.58893	2	1212.5391	1212.5422	K	E	263	273
PSM	TASRPDDIPDSPSSPK	1752	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2899.4	23.84368	3	1828.725671	1828.728156	R	V	1278	1294
PSM	EEGSPLELER	1753	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3178.2	31.04947	2	1237.525647	1237.522763	R	L	604	614
PSM	TSSGDPPSPLVK	1754	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2962.4	25.47125	2	1263.572647	1263.574799	K	Q	80	92
PSM	ALINSPEGAVGR	1755	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3256.4	33.08163	2	1262.597447	1262.602017	R	S	66	78
PSM	TSSGDPPSPLVK	1756	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2938.5	24.86003	2	1263.571447	1263.574799	K	Q	80	92
PSM	VKLESPTVSTLTPSSPGK	1757	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3282.3	33.75063	3	1906.958171	1906.965275	R	L	290	308
PSM	SSTPSSPTGTSSSDSGGHHIGWGER	1758	sp|P46019|KPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2976.5	25.83993	4	2550.042094	2550.040853	R	Q	1039	1064
PSM	ELASPVSPELR	1759	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3258.3	33.1309	2	1276.605047	1276.606433	K	Q	175	186
PSM	SHGLEPAAPSPR	1760	sp|Q9ULL5|PRR12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2829.3	22.0619	3	1297.581971	1297.581616	R	L	856	868
PSM	AGGPTTPLSPTR	1761	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2886.4	23.51493	2	1313.540847	1313.541799	R	L	15	27
PSM	SAESPTSPVTSETGSTFK	1762	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3403.3	36.85232	3	1971.7732	1971.7746	K	K	280	298
PSM	GPPASSPAPAPKFSPVTPK	1763	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3246.4	32.82113	3	1991.914571	1991.915897	R	F	254	273
PSM	NGEVVHTPETSV	1764	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2978.5	25.89213	2	1347.567047	1347.570776	K	-	454	466
PSM	EAGVEMGDEDDLSTPNEK	1765	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.2948.3	25.105	3	2030.766371	2030.766378	R	L	357	375
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1766	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3237.3	32.58317	4	2717.305294	2717.307830	R	R	31	56
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1767	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	34.95937	4	2727.230894	2727.234862	R	G	70	97
PSM	LQAPDSATLLEK	1768	sp|Q9BUL5|PHF23_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3366.3	35.92532	2	1364.653447	1364.658863	R	M	119	131
PSM	AEGAATEEEGTPKESEPQAAAEPAEAK	1769	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2867.4	23.02248	4	2777.197294	2777.191659	K	E	26	53
PSM	ICEPGYSPTYK	1770	sp|P07858|CATB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3091.4	28.78422	2	1393.559847	1393.562520	K	Q	210	221
PSM	DFTPVCTTELGR	1771	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3407.4	36.95923	2	1394.646647	1394.650015	R	A	42	54
PSM	EMPQDLRSPARTPPSEEDSAEAER	1772	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.2913.5	24.21062	4	2793.188094	2793.191283	K	L	70	94
PSM	YQEQGGEASPQRTWEQQQEVVSR	1773	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3261.2	33.20525	4	2799.230894	2799.224966	R	N	224	247
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1774	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3357.4	35.69353	4	2807.196094	2807.201193	R	G	70	97
PSM	TQYNQVPSEDFERTPQSPTLPPAK	1775	sp|P78310|CXAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3368.3	35.97772	4	2809.289694	2809.296005	K	V	316	340
PSM	ELSVQDQPSLSPTSLQNSSSHTTTAK	1776	sp|O95628|CNOT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3350.4	35.51022	4	2822.297694	2822.297128	K	G	422	448
PSM	LVEDERSDREETESSEGEEAAAGGGAK	1777	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2843.5	22.40762	4	2887.208894	2887.199264	K	S	335	362
PSM	GGDSIGETPTPGASK	1778	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2825.4	21.96157	2	1452.611847	1452.613369	R	R	319	334
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1779	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=1.1.3186.5	31.26905	4	2914.287694	2914.285140	K	L	281	308
PSM	NAPAAVDEGSISPR	1780	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2977.5	25.86622	2	1462.640447	1462.645338	R	T	373	387
PSM	DKKDEEEDMSLD	1781	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:35	ms_run[1]:scan=1.1.2659.2	18.42995	3	1468.585271	1468.587535	K	-	396	408
PSM	SPPKSPEEEGAVSS	1782	sp|Q01130|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2706.2	19.23197	2	1479.613047	1479.613035	K	-	208	222
PSM	DVSGPMPDSYSPR	1783	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3198.6	31.58557	2	1486.577047	1486.579961	K	Y	291	304
PSM	NSGSFPSPSISPR	1784	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3344.6	35.36043	2	1491.577047	1491.579641	R	-	1258	1271
PSM	GAVDGGLSIPHSTK	1785	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3232.5	32.45993	2	1497.624247	1497.626591	K	R	165	179
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	1786	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3283.5	33.78355	4	2994.254494	2994.261530	K	A	106	138
PSM	AEEDEILNRSPR	1787	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3001.3	26.47245	3	1507.665071	1507.666802	K	N	574	586
PSM	NIDINDVTPNCR	1788	sp|P62195|PRS8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3205.3	31.75845	2	1509.623447	1509.628308	K	V	102	114
PSM	SSDQPLTVPVSPK	1789	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3312.4	34.52475	2	1513.637847	1513.646658	K	F	728	741
PSM	EVSDDEAEEKEDKEEEK	1790	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2508.2	17.17382	4	2036.858094	2036.854584	K	E	229	246
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1791	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3191.6	31.4026	4	3093.276894	3093.277137	R	-	738	768
PSM	LAVDEEENADNNTK	1792	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2796.4	21.2246	3	1560.690971	1560.690360	K	A	40	54
PSM	ESQRSGNVAELALK	1793	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3160.2	30.57883	3	1580.756471	1580.755951	K	A	658	672
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1794	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3179.5	31.08593	4	3197.252894	3197.249993	R	A	333	362
PSM	VAAETQSPSLFGSTK	1795	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3300.6	34.22697	2	1601.730247	1601.733819	K	L	215	230
PSM	NIIHGSDSVKSAEK	1796	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2791.4	21.09785	3	1643.697971	1643.695733	R	E	100	114
PSM	ADLNQGIGEPQSPSR	1797	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3021.5	26.99452	2	1647.721447	1647.725379	R	R	63	78
PSM	ESLKEEDESDDDNM	1798	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2863.6	22.91943	2	1654.615247	1654.615206	K	-	242	256
PSM	ESLKEEDESDDDNM	1799	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2646.2	18.26402	3	1670.608871	1670.610121	K	-	242	256
PSM	EADGSETPEPFAAEAK	1800	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3202.5	31.68677	2	1727.687647	1727.692742	R	F	234	250
PSM	FSEGVLQSPSQDQEK	1801	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3203.3	31.70582	3	1757.752271	1757.750926	R	L	428	443
PSM	VQHASPAGTYAHTVNR	1802	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2796.2	21.21793	4	1787.813694	1787.810446	R	N	173	189
PSM	SLSSQIETMRSPDGSK	1803	sp|P05997|CO5A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3230.3	32.40148	3	1801.787471	1801.791745	K	K	1274	1290
PSM	RTEGVGPGVPGEVEMVK	1804	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3141.4	30.09027	3	1835.848871	1835.848866	R	G	16	33
PSM	TSPSSPAPLPHQEATPR	1805	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2904.2	23.96705	3	1851.850571	1851.851643	R	A	169	186
PSM	VVESPDFSKDEDYLGK	1806	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3415.3	37.1651	3	1906.820471	1906.823756	K	V	923	939
PSM	ELEKPIQSKPQSPVIQAAAVSPK	1807	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3179.4	31.0826	4	2604.296894	2604.296537	R	F	207	230
PSM	RADLNQGIGEPQSPSRR	1808	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2833.2	22.16152	4	1959.932494	1959.927602	R	V	62	79
PSM	GPPASSPAPAPKFSPVTPK	1809	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3334.3	35.09027	3	2071.878071	2071.882228	R	F	254	273
PSM	SSPASSQEGSPSGDQQFSPK	1810	sp|Q6ZW49|PAXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2891.5	23.6402	3	2086.845371	2086.848073	K	S	218	238
PSM	NTNAGAPPGTAYQSPLPLSR	1811	sp|Q02218|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3369.4	36.00695	3	2090.967971	2090.978634	R	G	82	102
PSM	DSESSNDDTSFPSTPEGIK	1812	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3304.3	34.31822	3	2091.811571	2091.815770	K	D	437	456
PSM	NSLDASRPAGLSPTLTPGER	1813	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3322.4	34.78465	3	2118.003071	2118.010663	K	Q	138	158
PSM	NVASGGGGVGDGVQEPTTGNWR	1814	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3293.5	34.04472	3	2193.937271	2193.944040	K	G	569	591
PSM	EHYPVSSPSSPSPPAQPGGVSR	1815	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3069.6	28.22092	3	2378.993771	2378.993372	K	N	2036	2058
PSM	ITRKPVTVSPTTPTSPTEGEAS	1816	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2979.5	25.91798	3	2415.090971	2415.097168	R	-	502	524
PSM	AAAAAAAAAPAAAATAPTTAATTAATAAQ	1817	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3337.5	35.17503	3	2447.162471	2447.169348	K	-	108	137
PSM	SVTSNQSDGTQESCESPDVLDR	1818	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3120.6	29.54735	3	2489.984171	2489.985372	R	H	346	368
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1819	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3324.4	34.83647	4	3223.223294	3223.230486	K	-	122	148
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	1820	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3046.6	27.62418	4	3445.413694	3445.417924	K	K	799	833
PSM	DLTDYLMK	1821	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3790.2	46.8335	2	997.477447	997.479034	R	I	186	194
PSM	WLCPLSGK	1822	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3512.2	39.688	2	1039.454047	1039.456204	K	K	713	721
PSM	EIIDLVLDR	1823	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3932.2	50.46862	2	1084.611847	1084.612825	K	I	113	122
PSM	DQIYDIFQK	1824	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3761.2	46.1232	2	1168.572847	1168.576440	K	L	194	203
PSM	SADTLWDIQK	1825	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3475.2	38.72203	2	1175.577847	1175.582253	K	D	320	330
PSM	SMSAPVIFDR	1826	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3654.2	43.35463	2	1201.516247	1201.520261	K	S	117	127
PSM	QSKPVTTPEEIAQVATISANGDK	1827	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3503.3	39.45797	4	2543.155294	2543.155746	K	E	158	181
PSM	SADTLWGIQK	1828	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3923.2	50.23338	2	1277.507847	1277.509436	K	E	319	329
PSM	DAGTIAGLNVLR	1829	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3877.2	49.0682	2	1278.630047	1278.633317	K	I	160	172
PSM	DLKPSNLLLNTTCDLK	1830	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3677.3	43.9602	3	1923.936071	1923.937681	R	I	149	165
PSM	CSPTVAFVEFPSSPQLK	1831	sp|Q9UPQ0|LIMC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3977.2	51.59298	3	1972.896371	1972.900567	R	N	669	686
PSM	SGFGEISSPVIR	1832	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3573.4	41.26512	2	1327.616647	1327.617332	R	E	4	16
PSM	AAMYDIISSPSK	1833	sp|Q6KC79|NIPBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3516.2	39.78962	2	1361.587447	1361.593820	K	D	342	354
PSM	NNIPYFETSAK	1834	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3500.3	39.3797	2	1362.580647	1362.585698	K	E	147	158
PSM	SESVEGFLSPSR	1835	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3543.5	40.48195	2	1373.590247	1373.586426	R	C	1311	1323
PSM	NLSSPFIFHEK	1836	sp|P52569|CTR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	41.87657	2	1397.635847	1397.638068	R	T	644	655
PSM	DINTFLGTPVQK	1837	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3672.3	43.82902	2	1411.669847	1411.674847	K	L	1794	1806
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1838	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3501.3	39.40585	4	2833.346094	2833.352672	K	S	362	389
PSM	TLTIVDTGIGMTK	1839	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3603.4	42.04037	2	1428.691647	1428.693534	R	A	28	41
PSM	VEIIANDQGNRTTPSYVAFTDTER	1840	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3652.6	43.31577	4	2856.237294	2856.236850	K	L	26	50
PSM	AALEALGSCLNNK	1841	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3492.2	39.16748	2	1439.647847	1439.647981	R	Y	83	96
PSM	GSGGLFSPSTAHVPDGALGQR	1842	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3744.5	45.6891	3	2169.923771	2169.924564	R	D	1023	1044
PSM	SFGTRPLSSGFSPEEAQQQDEEFEK	1843	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3614.3	42.31068	4	2909.239294	2909.239278	R	K	976	1001
PSM	DNLTLWTSDQQDDDGGEGNN	1844	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3900.4	49.66337	3	2192.869271	2192.873028	R	-	228	248
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	1845	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3732.4	45.37188	4	2952.309694	2952.317863	K	I	350	377
PSM	NLEQILNGGESPK	1846	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3730.5	45.32281	2	1477.677447	1477.681389	K	Q	219	232
PSM	LTFDSSFSPNTGK	1847	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3535.6	40.27747	2	1479.624447	1479.628291	K	K	97	110
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1848	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3617.3	42.38913	4	2972.321294	2972.324602	K	Q	178	204
PSM	EQFLDGDGWTSR	1849	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3624.4	42.5767	2	1489.584847	1489.587489	K	W	25	37
PSM	DVNSSSPVMLAFK	1850	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3568.5	41.13703	2	1489.648647	1489.652398	K	S	28	41
PSM	TLTIVDTGIGMTK	1851	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3836.2	48.01432	2	1508.656247	1508.659865	R	A	28	41
PSM	TSDIFGSPVTATSR	1852	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3465.4	38.46605	2	1517.671247	1517.676304	K	L	91	105
PSM	DQGTYEDYVEGLR	1853	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3646.4	43.15253	2	1543.675847	1543.679067	K	V	82	95
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	1854	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3725.4	45.18858	4	3095.576894	3095.580500	R	A	655	686
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	1855	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.3850.3	48.37207	4	3175.540094	3175.546831	R	A	655	686
PSM	NLEQILNGGESPKQK	1856	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3451.3	38.09801	3	1733.832371	1733.834930	K	G	219	234
PSM	VFVGGLSPDTSEEQIK	1857	sp|O14979|HNRDL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3584.2	41.53753	3	1784.816771	1784.823362	K	E	235	251
PSM	NQLTSNPENTVFDAK	1858	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3468.4	38.54533	3	1836.732071	1836.733241	K	R	82	97
PSM	SATSSSPGSPLHSLETSL	1859	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3930.5	50.42648	2	1836.810847	1836.814254	K	-	1203	1221
PSM	MNGVMFPGNSPSYTER	1860	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3579.3	41.41607	3	1865.7495706434902	1865.74777127785	R	S	150	166
PSM	WLDDLLASPPPSGGGAR	1861	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4511.2	60.72842	3	1867.788071	1867.790696	R	R	684	701
PSM	VSSGYVPPPVATPFSSK	1862	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3563.3	40.99975	3	1878.823271	1878.820599	R	S	168	185
PSM	CFSPGVIEVQEVQGKK	1863	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3476.4	38.7549	3	1883.881271	1883.885251	R	V	256	272
PSM	QGAIVAVTGDGVNDSPALK	1864	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3434.2	37.65028	3	1890.903671	1890.908823	R	K	708	727
PSM	DLKPSNLLLNTTCDLK	1865	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3722.4	45.11098	3	1923.939371	1923.937681	R	I	149	165
PSM	DSGPLPTPPGVSLLGEPPK	1866	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4166.3	55.72287	3	1936.952471	1936.954711	K	D	482	501
PSM	LSPPYSSPQEFAQDVGR	1867	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3735.3	45.4468	3	1956.857771	1956.861873	K	M	751	768
PSM	SVPTSTVFYPSDGVATEK	1868	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3557.4	40.846	3	1963.879871	1963.881605	R	A	439	457
PSM	GHVFEESQVAGTPMFVVK	1869	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3631.4	42.75853	3	2040.930971	2040.938015	R	A	768	786
PSM	VEIIANDQGNRTTPSYVAFTDTER	1870	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3610.2	42.20688	4	2776.269694	2776.270519	K	L	26	50
PSM	DLLLTSSYLSDSGSTGEHTK	1871	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3591.4	41.72595	3	2110.005071	2110.006609	K	S	397	417
PSM	DNLTLWTSDQQDEEAGEGN	1872	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3826.3	47.75825	3	2120.873471	2120.877051	R	-	228	247
PSM	DCCVEPGTELSPTLPHQL	1873	sp|Q14012|KCC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3817.6	47.53303	3	2131.895471	2131.895558	R	-	353	371
PSM	GSGGLFSPSTAHVPDGALGQR	1874	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3752.4	45.8947	3	2169.9232	2169.9240	R	D	1023	1044
PSM	TDKSSASAPDVDDPEAFPALA	1875	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3849.3	48.34757	3	2182.922771	2182.930741	R	-	388	409
PSM	DLLLTSSYLSDSGSTGEHTK	1876	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3731.3	45.34218	3	2189.970371	2189.972940	K	S	397	417
PSM	SRDYNPYNYSDSISPFNK	1877	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	40.8229	3	2245.926671	2245.931744	R	S	1016	1034
PSM	IADPEHDHTGFLTEYVATR	1878	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3662.2	43.56443	4	2250.993294	2250.994678	R	W	190	209
PSM	SCEGQNPELLPKTPISPLK	1879	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3602.4	42.0144	3	2267.026571	2267.031003	K	T	308	327
PSM	VPADTEVVCAPPTAYIDFAR	1880	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4023.3	52.74322	3	2271.024971	2271.028287	K	Q	71	91
PSM	DYEEVGVDSVEGEGEEEGEEY	1881	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3727.5	45.24446	3	2347.892171	2347.897571	K	-	431	452
PSM	TLEAEFNSPSPPTPEPGEGPR	1882	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3527.4	40.07692	3	2367.960971	2367.966154	K	K	525	546
PSM	DKNTPSPFIETFTEDDEASR	1883	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3870.5	48.89578	3	2377.989071	2377.995132	K	A	210	230
PSM	AIVDALPPPCESACTVPTDVDK	1884	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3634.4	42.83681	3	2434.076771	2434.079730	R	W	261	283
PSM	QSKPVTTPEEIAQVATISANGDK	1885	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3455.5	38.20912	3	2463.184271	2463.189415	K	E	158	181
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1886	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:21	ms_run[1]:scan=1.1.4661.2	62.70365	3	2968.321571	2968.325196	R	S	59	86
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	1887	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3613.6	42.29478	3	2988.153071	2988.155727	K	E	144	170
PSM	HSVTAATPPPSPTSGESGDLLSNLLQSPSSAK	1888	sp|Q96QU8|XPO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4206.4	56.45772	4	3292.486094	3292.490164	K	L	198	230
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	1889	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:4,22-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.3639.6	42.9752	4	3544.536494	3544.541154	K	E	218	249
PSM	CIPALDSLTPANEDQK	1890	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4507.2	60.66333	2	1833.7800	1833.7851	R	I	447	463
PSM	LYGSAGPPPTGEEDTAEKDEL	1891	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3553.3	40.73713	3	2334.912371	2334.918201	K	-	634	655
PSM	SSPNPFVGSPPK	1892	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3349.3	35.48082	2	1373.551247	1372.546550	K	G	393	405
PSM	SSPNPFVGSPPK	1893	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3357.3	35.6902	2	1373.551247	1372.546550	K	G	393	405
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1894	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2804.2	21.42315	4	2674.033694	2673.045055	K	G	134	157
PSM	GGNFGGRSSGPYGGGGQYFAK	1895	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3277.5	33.62712	3	2099.882471	2099.885068	K	P	278	299
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1896	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3866.2	48.7813	4	2749.2244	2749.2301	-	Y	1	25
PSM	AIVDALPPPCESACTVPTDVDK	1897	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3650.4	43.257	3	2435.100071	2434.079730	R	W	261	283
PSM	ASGVAVSDGVIK	1898	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3394.2	36.61562	2	1223.5742	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	1899	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3507.3	39.56197	2	1223.5764	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	1900	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3482.2	38.9063	2	1223.5776	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	1901	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3649.2	43.22427	2	1303.5443	1303.5457	M	V	2	14
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1902	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3936.4	50.57967	4	3523.457294	3522.472617	K	F	604	634
PSM	TEWETAAPAVAETPDIK	1903	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3982.4	51.72658	3	2029.8290	2029.8318	M	L	2	19
PSM	QREEYQPATPGLGMFVEVKDPEDK	1904	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.3919.4	50.15388	4	2825.2568	2825.2614	K	V	72	96
PSM	MNPVYSPGSSGVPYANAK	1905	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3771.4	46.39083	3	1959.8429	1959.8433	-	G	1	19
PSM	FLMECRNSPVTK	1906	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.2880.4	23.35295	3	1576.680071	1576.677901	K	T	58	70
PSM	AVETLSPDWEFDRVDDGSQK	1907	sp|Q2M389|WASC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4070.2	53.84263	3	2415.0283	2415.0262	M	I	2	22
PSM	PRPDPSPEIEGDLQPATHGSR	1908	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3137.2	29.97947	4	2335.055694	2335.059404	R	F	146	167
PSM	SDKDDIETPLLTEAAPILEDGNCEPAK	1909	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,8-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.4273.2	57.80283	3	3062.3627	3062.3674	M	N	2	29
PSM	NSVERPAEPVAGAATPSLVEQQK	1910	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3200.5	31.63458	3	2458.182071	2457.190084	R	M	1455	1478
PSM	AALGHLAGEAAAAPGPGTPCASR	1911	sp|Q9H7E9|CH033_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,18-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.3627.5	42.65798	3	2224.0010	2224.0091	M	G	2	25
PSM	MGNTPDSASDNLGFR	1912	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=1.1.3267.6	33.36932	2	1676.6429	1676.6496	R	C	275	290
PSM	GSGPLSPSIQSR	1913	sp|P10586|PTPRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3088.3	28.70512	2	1264.580247	1264.581281	K	T	995	1007
PSM	ETYTDDLPPPPVPPPAIKSPTAQSK	1914	sp|Q9Y6N7|ROBO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3574.2	41.28395	4	2725.325294	2725.325180	R	T	1474	1499
PSM	KINEELESQYQQSMDSKLSGR	1915	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3316.4	34.62918	4	2549.126894	2549.146898	K	Y	75	96
PSM	ETYTDDLPPPPVPPPAIKSPTAQSK	1916	sp|Q9Y6N7|ROBO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3566.5	41.08478	4	2725.325294	2725.325180	R	T	1474	1499
PSM	EQSCVNCGREAMSECTGCHK	1917	sp|O75398|DEAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:27,4-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:21,15-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3846.3	48.28493	3	2461.9042	2460.8732	K	V	501	521
PSM	EGTCQRGDQCCYSHSPPTPR	1918	sp|Q9NXH9|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.2730.3	19.74067	4	2471.942494	2471.940628	K	V	611	631
PSM	EGAASPAPETPQPTSPETSPK	1919	sp|Q9Y3X0|CCDC9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2861.6	22.86778	3	2237.9137	2237.9125	K	E	372	393
PSM	SPSHSSSNRPFTPPTSTGGSK	1920	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3031.5	27.25243	3	2276.953571	2274.930772	K	S	1021	1042
PSM	VPTANVSVVDLTCRLEK	1921	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,12-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3676.3	43.93365	3	2059.938371	2059.941460	R	P	235	252
PSM	SSSPAPADIAQTVQEDLR	1922	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4089.2	54.23332	3	1964.875571	1963.888816	K	T	230	248
PSM	LISPYK	1923	sp|O14929|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3020.2	26.95865	2	799.385247	799.388108	R	K	359	365
PSM	HIAEEADRKYEEVAR	1924	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2908.3	24.07432	4	1814.891694	1814.891125	K	K	154	169
PSM	SAITPGGLR	1925	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3047.2	27.63583	2	950.456247	950.458647	R	L	417	426
PSM	SGPKPFSAPKPQTSPSPK	1926	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2867.2	23.00915	4	1916.945294	1916.939729	R	R	295	313
PSM	CIACQAAKLSPR	1927	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2933.2	24.71953	3	1453.656671	1453.657106	K	D	678	690
PSM	AALLKASPK	1928	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2791.2	21.09118	2	977.529847	977.531084	K	K	133	142
PSM	AMAPTSPQI	1929	sp|Q9BYD2|RM09_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3065.2	28.10302	2	1010.414247	1010.414399	K	-	259	268
PSM	DGLTDVYNK	1930	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3085.2	28.62423	2	1023.486447	1023.487290	K	I	182	191
PSM	DGGFCEVCK	1931	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2917.4	24.31122	2	1070.414647	1070.416116	K	K	405	414
PSM	AAHSEGNTTAGLDMR	1932	sp|P78371|TCPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2860.5	22.8386	3	1609.660871	1609.655585	R	E	467	482
PSM	ALENVLSGKA	1933	sp|O43678|NDUA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3333.2	35.06107	2	1080.519447	1080.521641	R	-	90	100
PSM	SAFSGGYYR	1934	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3162.2	30.63093	2	1086.419247	1086.417176	K	G	43	52
PSM	EGMTAFVEK	1935	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3391.2	36.53878	2	1090.438247	1090.440614	K	R	274	283
PSM	ELTSTCSPIISKPK	1936	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3027.2	27.14088	3	1639.788371	1639.789226	K	P	774	788
PSM	LVLVGDGGTGK	1937	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3159.3	30.55583	2	1094.536247	1094.537291	K	T	13	24
PSM	QLEHVMDSAAEDPQSPKTPPHFQTHLAK	1938	sp|Q9NS87|KIF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	32.9444	6	3298.4528	3298.4514	R	L	1127	1155
PSM	KVEPVPVTKQPTPPSEAAASK	1939	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2926.5	24.54812	4	2240.143694	2240.145365	K	K	142	163
PSM	EKTPSPKEEDEEPESPPEK	1940	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2709.3	19.28827	4	2260.962894	2260.962435	K	K	200	219
PSM	VPKTAENFR	1941	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2775.3	20.6985	2	1140.532247	1140.532874	K	A	29	38
PSM	LGIHEDSTNR	1942	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.2702.2	19.11875	3	1140.552971	1140.552350	K	R	439	449
PSM	IYQYIQSR	1943	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2947.6	25.0892	2	1149.521047	1149.521975	R	F	318	326
PSM	SILVSPTGPSR	1944	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3174.3	30.94845	2	1192.583247	1192.585304	K	V	702	713
PSM	SILVSPTGPSR	1945	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3180.2	31.10202	2	1192.5840470956603	1192.58530367404	K	V	702	713
PSM	SGEGEVSGLMR	1946	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3271.2	33.46053	2	1200.479047	1200.484604	R	K	473	484
PSM	EAALPPVSPLK	1947	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3417.2	37.2143	2	1200.613447	1200.615542	R	A	1224	1235
PSM	GMKDDKEEEEDGTGSPQLNNR	1948	sp|P49407|ARRB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2747.2	20.00968	4	2427.985694	2427.984978	K	-	398	419
PSM	DQVANSAFVER	1949	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3023.3	27.03973	2	1234.590647	1234.594215	K	L	500	511
PSM	VSSPTVNTTLR	1950	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2973.5	25.7614	2	1253.598647	1253.601682	K	N	458	469
PSM	RQPPVSPLTLSPGPEAHQGFSR	1951	sp|Q6UUV7|CRTC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3405.2	36.90067	4	2517.152494	2517.156689	R	Q	386	408
PSM	WNSVSPASAGK	1952	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3006.2	26.5991	2	1262.470247	1262.473385	K	R	304	315
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1953	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3330.3	34.98817	4	2539.245694	2539.247205	R	D	175	200
PSM	NQSPVLEPVGR	1954	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3056.3	27.87252	2	1274.600647	1274.602017	R	S	713	724
PSM	NQSPVLEPVGR	1955	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3064.4	28.08388	2	1274.600647	1274.602017	R	S	713	724
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1956	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3110.3	29.2759	5	3192.478118	3192.474120	R	S	847	876
PSM	SSPNPFVGSPPK	1957	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3276.4	33.59782	2	1292.574047	1292.580219	K	G	393	405
PSM	SPSDSSTASTPVAEQIER	1958	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3082.2	28.54623	3	1940.838971	1940.836446	R	A	337	355
PSM	CSGPGLSPGMVR	1959	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3251.3	32.94773	2	1296.532647	1296.535594	K	A	1453	1465
PSM	SLVESVSSSPNK	1960	sp|Q9H2U2|IPYR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2960.5	25.42293	2	1312.585847	1312.591177	R	E	309	321
PSM	AGGPTTPLSPTR	1961	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.2870.5	23.0969	2	1313.540847	1313.541799	R	L	15	27
PSM	DITEEIMSGAR	1962	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3315.4	34.603	2	1316.532847	1316.531948	K	T	191	202
PSM	ASPGTPLSPGSLR	1963	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3286.3	33.85498	2	1318.625047	1318.628231	R	S	33	46
PSM	DGEDQTQDTELVETRPAGDGTFQK	1964	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3234.2	32.50122	4	2636.182094	2636.183798	R	W	244	268
PSM	VKLESPTVSTLTPSSPGK	1965	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3318.3	34.67805	3	1986.926171	1986.931606	R	L	290	308
PSM	SLSPGAASSSSGDGDGKEGLEEPKGPR	1966	sp|Q6ZN18|AEBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2965.4	25.54973	4	2651.166494	2651.171199	R	G	139	166
PSM	TLNMTTSPEEK	1967	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2944.4	25.00502	2	1329.549847	1329.552349	K	R	326	337
PSM	SASQGALTSPSVSFSNHR	1968	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3283.3	33.77688	3	1991.814671	1991.813951	R	T	475	493
PSM	NSTLNSAAVTVSS	1969	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3184.3	31.20993	2	1329.579247	1329.581341	R	-	523	536
PSM	SHSPSSPDPDTPSPVGDSR	1970	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2795.3	21.19547	3	2000.811671	2000.811294	R	A	616	635
PSM	NGEVVHTPETSV	1971	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3071.5	28.26952	2	1347.572047	1347.570776	K	-	454	466
PSM	SAESPTSPVTSETGSTFKK	1972	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3042.3	27.51447	3	2019.903971	2019.903797	K	F	280	299
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1973	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3253.2	32.9966	4	2717.305294	2717.307830	R	R	31	56
PSM	ELISNSSDALDK	1974	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3176.5	31.0075	2	1370.595247	1370.596657	R	I	47	59
PSM	MDSTANEVEAVK	1975	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.2848.5	22.52983	2	1388.553647	1388.553078	K	V	425	437
PSM	EMPQDLRSPARTPPSEEDSAEAER	1976	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3046.4	27.61752	4	2777.194094	2777.196368	K	L	70	94
PSM	GILAADESTGSIAK	1977	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3228.6	32.36033	2	1411.655847	1411.659591	K	R	29	43
PSM	SSTETCYSAIPK	1978	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3101.4	29.04348	2	1422.569847	1422.573813	R	A	2496	2508
PSM	NSEPAGLETPEAK	1979	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2895.6	23.7472	2	1421.607647	1421.607556	R	V	890	903
PSM	LDQPVSAPPSPR	1980	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.2957.5	25.34445	2	1422.592447	1422.594562	K	D	235	247
PSM	GGGGNFGPGPGSNFR	1981	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3220.5	32.15547	2	1456.587447	1456.588492	R	G	214	229
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	1982	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3397.4	36.70042	4	2933.354094	2933.357299	K	K	62	95
PSM	LELQGPRGSPNAR	1983	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2926.3	24.54145	3	1473.708071	1473.708941	R	S	555	568
PSM	SVDPDSPAEASGLR	1984	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3076.5	28.39977	2	1479.620847	1479.624268	R	A	181	195
PSM	GTDTQTPAVLSPSK	1985	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2996.3	26.34623	2	1480.674447	1480.681055	K	T	722	736
PSM	QSGSPTLDTAPNGR	1986	sp|Q9H2J7|S6A15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2821.4	21.86458	2	1479.632047	1479.635502	K	Y	698	712
PSM	SGSSSPDSEITELK	1987	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3284.5	33.80955	2	1515.626647	1515.634164	R	F	571	585
PSM	YRDVAECGPQQELDLNSPRNTTLER	1988	sp|Q9BTE3|MCMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3355.6	35.64772	4	3040.366894	3040.370978	K	Q	102	127
PSM	YADEEIPRSPFK	1989	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3277.2	33.61712	3	1530.673571	1530.675576	K	V	1497	1509
PSM	SLPTTVPESPNYR	1990	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3251.6	32.95773	2	1539.693247	1539.697039	R	N	766	779
PSM	RSPTSSAIPLQSPR	1991	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3014.2	26.80293	3	1575.772871	1575.777021	K	N	1244	1258
PSM	APVPGTPDSLSSGSSR	1992	sp|Q9UJZ1|STML2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3006.6	26.61243	2	1593.700847	1593.703581	K	D	322	338
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	1993	sp|Q9UKS6|PACN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3171.4	30.8735	4	3197.252894	3197.249993	R	A	333	362
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	1994	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3294.5	34.07057	4	3213.331294	3213.342046	K	F	173	200
PSM	ESVPEFPLSPPKKK	1995	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3284.2	33.79955	3	1661.840771	1661.842975	K	D	30	44
PSM	ELEREESGAAESPALVTPDSEK	1996	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3106.6	29.18133	3	2503.0381	2503.0399	K	S	173	195
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	1997	sp|P04920|B3A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3295.5	34.09618	4	3431.355294	3431.367542	R	A	108	139
PSM	TPKTPKGPSSVEDIK	1998	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2919.4	24.36345	3	1742.785571	1742.789299	K	A	234	249
PSM	SAPPTRGPPPSYGGSSR	1999	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2780.3	20.83263	3	1749.780371	1749.783563	R	Y	293	310
PSM	QNQTTAISTPASSEISK	2000	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2993.2	26.26923	3	1841.835971	1841.840803	K	A	1753	1770
PSM	LGAGGGSPEKSPSAQELK	2001	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2925.4	24.51875	3	1871.805071	1871.806740	R	E	13	31
PSM	AVPMAPAPASPGSSNDSSAR	2002	sp|Q66K74|MAP1S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3007.4	26.6314	3	1948.830671	1948.835006	K	S	750	770
PSM	DSENLASPSEYPENGER	2003	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3172.6	30.90627	2	1972.766847	1972.768760	R	F	617	634
PSM	RSRLTPVSPESSSTEEK	2004	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.2812.3	21.62783	3	2048.880071	2048.881696	K	S	265	282
PSM	IACKSPQPDPVDTPASTK	2005	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.2823.4	21.91635	3	2070.869471	2070.873440	K	Q	2340	2358
PSM	AAQQAASSSGQGQQAQTPTGF	2006	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3082.4	28.5529	3	2099.889671	2099.890941	K	-	305	326
PSM	DQMEGSPNSSESFEHIAR	2007	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3156.4	30.48087	3	2115.824171	2115.820479	R	S	774	792
PSM	AGEAAELQDAEVESSAKSGKP	2008	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3129.4	29.77605	3	2152.948871	2152.952539	K	-	657	678
PSM	EKTPSPKEEDEEPESPPEK	2009	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2728.3	19.68365	4	2260.966894	2260.962435	K	K	200	219
PSM	SWDSSSPVDRPEPEAASPTTR	2010	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3159.4	30.55917	3	2351.005271	2351.006699	R	T	354	375
PSM	SISSPSVSSETMDKPVDLSTRK	2011	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3216.3	32.04548	4	2430.136094	2430.134936	K	E	2802	2824
PSM	LDNTPASPPRSPAEPNDIPIAK	2012	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3349.6	35.49082	3	2459.107271	2459.113487	K	G	2311	2333
PSM	GSLAEAVGSPPPAATPTPTPPTRK	2013	sp|Q9Y6I3|EPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3204.5	31.73902	3	2459.147471	2459.149873	R	T	446	470
PSM	SANPPHTIQASEEQSSTPAPVKK	2014	sp|Q9Y450|HBS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2809.3	21.5487	4	2483.175294	2483.169348	K	S	215	238
PSM	IVRGDQPAASGDSDDDEPPPLPR	2015	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3130.6	29.80945	3	2483.094971	2483.096577	K	L	45	68
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	2016	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3371.6	36.06612	3	2574.215171	2574.222781	K	K	453	479
PSM	GSSGGSGAKPSDAASEAARPATSTLNR	2017	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2857.6	22.76462	4	2582.173294	2582.172202	K	F	1096	1123
PSM	QPATPTAAESSEGEGEEGDDGGETESR	2018	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2852.5	22.63578	3	2772.053471	2772.051931	K	E	82	109
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	2019	sp|Q92598|HS105_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	33-UNIMOD:21	ms_run[1]:scan=1.1.3336.6	35.15267	4	4716.086894	4716.094806	K	A	530	573
PSM	DFLLTAR	2020	sp|P63173|RL38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3648.2	43.19815	2	914.425647	914.426284	K	R	10	17
PSM	VEYHFLSPYVSPK	2021	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3970.2	51.4067	3	1724.722871	1724.725242	R	E	681	694
PSM	SLSSPTVTLSAPLEGAK	2022	sp|Q96PU5|NED4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3679.2	44.0088	3	1736.861471	1736.859748	R	D	446	463
PSM	NSPEDLGLSLTGDSCK	2023	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3589.2	41.66687	3	1771.733471	1771.733561	K	L	499	515
PSM	VSPLNLSSVTP	2024	sp|Q9UJX2|CDC23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3837.2	48.04132	2	1192.567047	1192.574071	R	-	587	598
PSM	APSEEDSLSSVPISPYKDEPWK	2025	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3728.2	45.26063	4	2540.136094	2540.135982	K	Y	36	58
PSM	GYFEYIEENK	2026	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3554.2	40.7608	2	1290.576647	1290.576833	R	Y	256	266
PSM	SSVSHSVLSEMQVIEQETPVSAK	2027	sp|Q8N6H7|ARFG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3898.3	49.60072	4	2631.152894	2631.154031	R	S	314	337
PSM	VWSPLVTEEGK	2028	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3636.5	42.89243	2	1323.608247	1323.611184	K	R	88	99
PSM	EVYELLDSPGK	2029	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3509.4	39.61743	2	1328.587047	1328.590115	K	V	20	31
PSM	IISNASCTTNCLAPLAK	2030	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,7-UNIMOD:4,9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3563.4	41.00308	3	1992.843071	1992.845117	K	V	146	163
PSM	EDFDSLLQSAK	2031	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3753.2	45.91398	2	1331.561647	1331.564628	K	K	288	299
PSM	GDNITLLQSVSN	2032	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3759.2	46.07084	2	1339.599047	1339.602076	K	-	81	93
PSM	DSSQGPCEPLPGPLTQPR	2033	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3464.4	38.44012	3	2014.878071	2014.881957	R	A	101	119
PSM	GRDSPYQSRGSPHYFSPFRPY	2034	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	4-UNIMOD:21,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3738.5	45.53207	4	2740.0648941913205	2740.0662330193095	R	-	201	222
PSM	IGAFGYMECSAK	2035	sp|P61586|RHOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3560.4	40.9248	2	1412.550047	1412.550575	R	T	151	163
PSM	EQFLDGDGWTSRWIESK	2036	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3953.4	51.00758	3	2132.919071	2132.920451	K	H	25	42
PSM	TVIIEQSWGSPK	2037	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3487.5	39.04707	2	1423.671447	1423.674847	R	V	61	73
PSM	LISPLASPADGVK	2038	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3592.3	41.74892	2	1426.648847	1426.651015	R	S	2220	2233
PSM	SVWGSLAVQNSPK	2039	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3598.2	41.90283	2	1451.675247	1451.680995	K	G	343	356
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	2040	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3678.2	43.98288	4	2908.389694	2908.396782	R	S	67	92
PSM	SAVPFNQYLPNK	2041	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3679.4	44.01546	2	1456.670647	1456.675182	K	S	262	274
PSM	SLVSVTKEGLELPEDEEEK	2042	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3820.4	47.6045	3	2210.023271	2210.024307	K	K	405	424
PSM	SLVSVTKEGLELPEDEEEK	2043	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3828.4	47.8137	3	2210.023271	2210.024307	K	K	405	424
PSM	TQVLSPDSLFTAK	2044	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3923.4	50.24005	2	1485.705647	1485.711627	K	F	1717	1730
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	2045	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3651.4	43.28268	4	2972.3184	2972.3241	K	Q	178	204
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	2046	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3633.3	42.80728	4	2972.321294	2972.324602	K	Q	178	204
PSM	GALQNIIPASTGAAK	2047	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3505.4	39.51353	2	1490.746247	1490.749409	R	A	201	216
PSM	DNPGVVTCLDEAR	2048	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3588.5	41.65059	2	1524.622447	1524.627974	K	H	227	240
PSM	DTPENNPDTPFDFTPENYK	2049	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3836.3	48.01765	3	2319.914171	2319.920904	R	R	43	62
PSM	AASQLAVPSTPLSPHSAASGTAAGSQPSSPR	2050	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,19-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3449.5	38.05212	4	3127.335294	3127.341406	R	Y	299	330
PSM	RPPSPDVIVLSDNEQPSSPR	2051	sp|Q86YP4|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3485.5	38.99505	3	2349.041171	2349.040322	R	V	97	117
PSM	DWALSSAAAVMEER	2052	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4098.4	54.42533	2	1614.672247	1614.674924	K	K	547	561
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	2053	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3665.4	43.65003	4	3393.342894	3393.345713	K	F	86	114
PSM	EDVKSCAEWVSLSK	2054	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3457.2	38.25117	3	1716.744071	1716.743004	K	A	96	110
PSM	TWTTPEVTSPPPSPR	2055	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3443.3	37.88762	3	1811.753471	1811.753248	R	T	125	140
PSM	TWTTPEVTSPPPSPR	2056	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3459.4	38.30988	3	1811.753471	1811.753248	R	T	125	140
PSM	ASLGSLEGEAEAEASSPK	2057	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3564.2	41.0228	3	1811.783771	1811.782620	K	G	5748	5766
PSM	VLLPEYGGTKVVLDDK	2058	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3593.2	41.77175	3	1904.893271	1904.893764	K	D	71	87
PSM	SQIFSTASDNQPTVTIK	2059	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3474.3	38.6989	3	1915.889471	1915.892839	K	V	448	465
PSM	SSTPPGESYFGVSSLQLK	2060	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3968.2	51.35453	3	1962.895571	1962.897590	K	G	1041	1059
PSM	DSSTSPGDYVLSVSENSR	2061	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3749.4	45.81652	3	1978.814471	1978.815711	R	V	39	57
PSM	MASPPAPSPAPPAISPIIK	2062	sp|Q00587|BORG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	47.75492	3	2000.943671	2000.944754	R	N	99	118
PSM	DYNPYNYSDSISPFNK	2063	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3841.2	48.14572	3	2002.790171	2002.798604	R	S	1018	1034
PSM	LDNVPHTPSSYIETLPK	2064	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3845.2	48.24752	3	2069.904671	2069.911205	R	A	45	62
PSM	DQPAFTPSGILTPHALGSR	2065	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3909.3	49.88975	3	2123.938271	2123.944237	R	N	428	447
PSM	DNLTLWTSDQQDDDGGEGNN	2066	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3891.3	49.44528	3	2192.870471	2192.873028	R	-	228	248
PSM	TQDPAKAPNTPDILEIEFK	2067	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	48.22267	3	2206.051271	2206.055881	K	K	210	229
PSM	AGSPRGSPLAEGPQAFFPER	2068	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3896.2	49.54478	3	2229.956171	2229.960950	R	G	181	201
PSM	ESMCSTPAFPVSPETPYVK	2069	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3835.2	47.98902	3	2285.901071	2285.902691	K	T	839	858
PSM	DNLTLWTSDTQGDEAEAGEGGEN	2070	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3906.3	49.81432	3	2407.982471	2407.988786	R	-	223	246
PSM	DTCYSPKPSVYLSTPSSASK	2071	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,9-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3489.6	39.10265	3	2413.916771	2413.919144	K	A	538	558
PSM	RGFFICDQPYEPVSPYSCK	2072	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,14-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3748.3	45.78667	3	2429.023571	2429.022156	R	E	675	694
PSM	GGPGSAVSPYPTFNPSSDVAALHK	2073	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3716.5	44.95865	3	2435.109671	2435.115856	K	A	30	54
PSM	APSEEDSLSSVPISPYKDEPWK	2074	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3733.4	45.39787	3	2540.130371	2540.135982	K	Y	36	58
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	2075	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.3984.4	51.78522	3	2763.126071	2763.129259	K	D	208	233
PSM	TSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDK	2076	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4216.3	56.64367	4	3705.685294	3705.683581	R	Q	616	649
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	2077	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3914.5	50.03015	4	3756.434494	3756.438824	K	A	469	503
PSM	GYISPYFINTSK	2078	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3940.4	50.68452	2	1548.628447	1548.630279	R	G	222	234
PSM	VIGSGCNLDSARFR	2079	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3192.3	31.41935	3	1630.730771	1630.728691	R	Y	158	172
PSM	VTNGAFTGEISPGMIK	2080	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3489.2	39.08932	3	1716.774971	1716.779389	K	D	107	123
PSM	AIVDALPPPCESACTVPTDVDK	2081	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3613.2	42.28145	4	2434.0804	2434.0792	R	W	261	283
PSM	ATGANATPLDFPSK	2082	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3564.4	41.02947	2	1510.6700	1510.6700	M	K	2	16
PSM	MTEWETAAPAVAETPDIK	2083	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4233.2	57.017	3	2080.9051	2080.9059	-	L	1	19
PSM	DITEEIMSGAR	2084	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3302.4	34.2713	2	1316.529647	1316.531948	K	T	191	202
PSM	ADYSTVPPPSSGSAGGGGGGGGGGGVNDAFK	2085	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3573.6	41.27178	3	2758.1462	2758.1503	M	D	2	33
PSM	MDEPSPLAQPLELNQHSR	2086	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3808.2	47.28698	3	2182.9660	2182.9713	-	F	1	19
PSM	MLAESDESGDEESVSQTDKTELQNTLR	2087	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3550.4	40.66215	4	3187.273294	3187.278911	K	T	186	213
PSM	SDAAVDTSSEITTK	2088	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3135.4	29.93385	2	1545.6411	1545.6442	M	D	2	16
PSM	SDAAVDTSSEITTK	2089	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3056.5	27.87918	2	1545.6435	1545.6442	M	D	2	16
PSM	DVQDSLTVSNEAQTAK	2090	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3121.3	29.56412	3	1784.783171	1784.782954	K	E	211	227
PSM	SGPDVETPSAIQICR	2091	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3634.6	42.84348	2	1750.7571	1750.7592	M	I	2	17
PSM	GMGPGTPAGYGR	2092	sp|P23246|SFPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2768.5	20.52343	2	1215.475647	1215.474374	R	G	682	694
PSM	NSVERPAEPVAGAATPSLVEQQK	2093	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3196.4	31.52708	3	2458.182071	2457.190084	R	M	1455	1478
PSM	AENVVEPGPPSAK	2094	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3207.4	31.81407	2	1415.6332	1415.6329	M	R	2	15
PSM	MLSPQR	2095	sp|Q6DD88|ATLA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3148.2	30.26627	2	852.3548	852.3560	-	V	1	7
PSM	YAGGNPVCVRPTPK	2096	sp|Q15004|PAF15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.2947.4	25.08253	3	1594.732271	1594.732714	K	W	47	61
PSM	DCNDTLEEENTNLETPTK	2097	sp|Q9BZE2|PUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3197.4	31.55315	3	2201.864471	2201.867154	R	R	452	470
PSM	RRDEDMLYSPELAQR	2098	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3269.4	33.41493	3	1957.865171	1957.871726	R	G	229	244
PSM	GSTIETEQKEDKGEDSEPVTSK	2099	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2711.2	19.33823	4	2473.074494	2473.074504	K	A	462	484
PSM	DLLTPCYSR	2100	sp|P07686|HEXB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3575.4	41.31682	2	1283.464647	1283.465857	K	Q	304	313
PSM	DNNLLGR	2101	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2921.2	24.40855	2	800.411847	800.414066	K	F	452	459
PSM	SGPKPFSAPKPQTSPSPK	2102	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2859.2	22.803	4	1916.945294	1916.939729	R	R	295	313
PSM	FANLTPSR	2103	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3070.2	28.23333	2	984.443247	984.442997	K	T	2050	2058
PSM	FANLTPSR	2104	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3062.2	28.02465	2	984.443247	984.442997	K	T	2050	2058
PSM	ILSPSMASK	2105	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3077.2	28.41607	2	1012.465647	1012.466434	R	L	69	78
PSM	LYEQLSGK	2106	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2948.2	25.10167	2	1016.456447	1016.457978	K	-	180	188
PSM	SGKPAELLK	2107	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2884.2	23.4499	2	1021.520847	1021.520913	R	M	595	604
PSM	AYEDGCKTVDLKPDWGK	2108	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3275.2	33.56458	4	2060.892094	2060.891459	K	G	57	74
PSM	IESPKLER	2109	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2811.2	21.59632	2	1050.510647	1050.511076	K	T	807	815
PSM	MLVSGAGDIK	2110	sp|Q92526|TCPW_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3270.2	33.43435	2	1069.483447	1069.487898	K	L	46	56
PSM	ENLSAAFSR	2111	sp|P15170-2|ERF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3338.2	35.19087	2	1073.449647	1073.454290	R	Q	59	68
PSM	GVVFDVTSGK	2112	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3356.2	35.66051	2	1087.495247	1087.495092	K	E	70	80
PSM	AAVVTSPPPTTAPHK	2113	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2771.4	20.59662	3	1632.730271	1632.731390	R	E	7	22
PSM	DYDDMSPR	2114	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2567.2	17.6309	2	1093.339047	1093.342356	R	R	279	287
PSM	FFVSSSQGR	2115	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3135.2	29.92718	2	1093.459247	1093.459375	R	S	274	283
PSM	ASAVSELSPR	2116	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2946.3	25.05303	2	1095.493847	1095.496155	R	E	236	246
PSM	GFVEIQTPK	2117	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	34.67472	2	1097.512247	1097.515827	K	I	214	223
PSM	VSGAGFSPSSK	2118	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2843.2	22.39428	2	1102.471647	1102.469606	R	M	1132	1143
PSM	STTPPPAEPVSLPQEPPKPR	2119	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3229.3	32.37568	4	2204.084494	2204.087850	K	V	225	245
PSM	IIAEGANGPTTPEADK	2120	sp|P00367|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2893.5	23.69242	3	1662.750371	1662.750197	K	I	400	416
PSM	DNVVCLSPK	2121	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3127.4	29.72422	2	1110.476647	1110.478062	K	L	252	261
PSM	DANNGNLQLR	2122	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2895.4	23.74053	2	1113.550247	1113.552684	K	N	288	298
PSM	GYSFTTTAER	2123	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3051.4	27.74567	2	1131.516247	1131.519653	R	E	197	207
PSM	TLTPDQWAR	2124	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3355.3	35.63772	2	1166.508847	1166.512139	K	E	74	83
PSM	ADTSQEICSPRLPISASHSSK	2125	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3173.2	30.91915	4	2350.064094	2350.062440	K	T	1020	1041
PSM	AAISQLRSPR	2126	sp|O95747|OXSR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2858.3	22.78367	2	1177.597047	1177.596872	K	V	352	362
PSM	SILVSPTGPSR	2127	sp|Q14684|RRP1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3183.3	31.1834	2	1192.583247	1192.585304	K	V	702	713
PSM	EAALPPVSPLK	2128	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3391.3	36.54212	2	1200.610647	1200.615542	R	A	1224	1235
PSM	GGLGAPPLQSAR	2129	sp|Q01433|AMPD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3132.4	29.85512	2	1202.581447	1202.580887	R	S	88	100
PSM	IPGSPPESMGR	2130	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3013.3	26.7804	2	1206.510447	1206.510425	K	G	58	69
PSM	AIPGDQHPESPVHTEPMGIQGR	2131	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3118.2	29.482	4	2432.092894	2432.094409	R	G	784	806
PSM	ITEVSCKSPQPDPVKTPTSSK	2132	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,6-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2896.2	23.75977	4	2445.088894	2445.089975	K	Q	1976	1997
PSM	GPTTGEGALDLSDVHSPPKSPEGK	2133	sp|O95684|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3190.4	31.37012	4	2455.129694	2455.126815	K	T	141	165
PSM	VEIIANDQGNR	2134	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2889.2	23.57917	2	1227.619647	1227.620764	R	I	50	61
PSM	EQGQAPITPQQGQALAK	2135	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3049.2	27.68738	3	1843.881671	1843.882943	K	Q	131	148
PSM	NCQTVLAPCSPNPCENAAVCK	2136	sp|Q04721|NOTC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	10-UNIMOD:21,2-UNIMOD:4,9-UNIMOD:4,14-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3250.2	32.91848	4	2468.9956941913206	2468.994638329679	K	E	829	850
PSM	EITALAPSTMK	2137	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3323.5	34.81395	2	1240.573847	1240.577441	K	I	318	329
PSM	VSDQNSPVLPK	2138	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2906.4	24.02575	2	1262.586047	1262.590783	R	K	2042	2053
PSM	TKTEQELPRPQSPSDLDSLDGR	2139	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3282.4	33.75397	4	2548.177694	2548.180641	K	S	90	112
PSM	NCQTLVNLCSRSPCK	2140	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3161.2	30.60483	3	1915.813271	1915.810389	K	N	1059	1074
PSM	GPSTPKSPGASNFSTLPK	2141	sp|Q9Y4E8|UBP15_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3232.4	32.4566	3	1931.843471	1931.843126	R	I	223	241
PSM	DDKHGSYEDAVHSGALND	2142	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2979.3	25.91132	3	1928.813171	1928.813663	K	-	539	557
PSM	SSPNPFVGSPPK	2143	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3284.4	33.80622	2	1292.574047	1292.580219	K	G	393	405
PSM	TANVPQTVPMR	2144	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3081.5	28.52992	2	1292.593647	1292.594823	K	L	77	88
PSM	EITALAPSTMK	2145	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3355.4	35.64105	2	1320.539447	1320.543772	K	I	318	329
PSM	SGTSSPQSPVFR	2146	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2984.5	26.0488	2	1328.569847	1328.576196	K	H	661	673
PSM	TYGEPESAGPSR	2147	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2771.5	20.59995	2	1329.523247	1329.523826	R	A	104	116
PSM	NGSLDSPGKQDTEEDEEEDEKDK	2148	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2722.5	19.59142	4	2673.045294	2673.045055	K	G	134	157
PSM	STPSHGSVSSLNSTGSLSPK	2149	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2973.6	25.76473	3	2008.906871	2008.910280	R	H	238	258
PSM	EQISDIDDAVR	2150	sp|P53999|TCP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3368.2	35.97438	2	1339.564047	1339.565691	K	K	115	126
PSM	ASPLTHSPPDEL	2151	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3292.4	34.0154	2	1342.578247	1342.580613	K	-	267	279
PSM	DGFPSGTPALNAK	2152	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3257.3	33.10435	2	1353.594047	1353.596597	K	G	148	161
PSM	SPAVATSTAAPPPPSSPLPSK	2153	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3100.5	29.02082	3	2038.994771	2038.997638	K	S	439	460
PSM	INVYYNEATGGK	2154	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3134.3	29.90415	2	1407.606247	1407.607162	R	Y	47	59
PSM	SAGLEQPTDPVAR	2155	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3086.6	28.66352	2	1419.636447	1419.639524	K	D	361	374
PSM	NSEPAGLETPEAK	2156	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2904.5	23.97705	2	1421.607647	1421.607556	R	V	890	903
PSM	RRSPSPYYSR	2157	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2695.2	18.944	3	1427.577071	1427.574830	R	Y	258	268
PSM	NGEVVHTPETSV	2158	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3019.4	26.9388	2	1427.534847	1427.537107	K	-	454	466
PSM	AHSPMIAVGSDDSSPNAMAK	2159	sp|Q96EE3|SEH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3225.2	32.27175	3	2144.823371	2144.830923	R	V	177	197
PSM	SIDTQTPSVQER	2160	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2862.5	22.89028	2	1439.632047	1439.629354	R	S	345	357
PSM	FQTGNKSPEVLR	2161	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2940.5	24.90687	2	1454.688647	1454.691894	R	A	432	444
PSM	CVSPIPVSPTSR	2162	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3138.5	30.015	2	1458.600247	1458.597934	R	I	811	823
PSM	AWNKPCEPCPTPGTADFK	2163	sp|P35556|FBN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,9-UNIMOD:4,11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3339.5	35.22655	3	2234.855771	2234.856744	K	T	1771	1789
PSM	RPPSPDVIVLSDNEQPSSPR	2164	sp|Q86YP4|P66A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3366.5	35.93198	3	2269.065371	2269.073991	R	V	97	117
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	2165	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	26-UNIMOD:21	ms_run[1]:scan=1.1.2945.5	25.03725	4	3061.347294	3061.351348	K	G	56	88
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	2166	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3224.5	32.25698	4	3093.278494	3093.277137	R	-	738	768
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	2167	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3183.6	31.1934	4	3093.276894	3093.277137	R	-	738	768
PSM	DEILPTTPISEQK	2168	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3408.6	36.9921	2	1549.723447	1549.727671	K	G	215	228
PSM	YRDVAECGPQQELDLNSPR	2169	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3317.5	34.65852	3	2325.999071	2326.004926	K	N	102	121
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	2170	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3212.6	31.95132	4	3156.394494	3156.395856	K	G	306	335
PSM	NNAYLAQSPQLYK	2171	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3349.5	35.48748	2	1588.725247	1588.728674	K	Q	242	255
PSM	DGSLASNPYSGDLTK	2172	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	35.40575	2	1603.676047	1603.676698	R	F	850	865
PSM	ELQAAGKSPEDLER	2173	sp|P06744|G6PI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2955.3	25.28587	3	1621.732271	1621.734881	K	L	448	462
PSM	ETPHSPGVEDAPIAK	2174	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2928.3	24.59318	3	1626.728471	1626.729068	R	V	486	501
PSM	NVTELNEPLSNEER	2175	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3177.4	31.03012	2	1642.778047	1642.779843	K	N	29	43
PSM	GGKPEPPAMPQPVPTA	2176	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3246.6	32.8278	2	1652.758647	1652.763345	K	-	228	244
PSM	SAPASPTHPGLMSPR	2177	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3079.5	28.47788	3	1664.677271	1664.678309	R	S	416	431
PSM	SAPASPTHPGLMSPR	2178	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3087.2	28.67612	3	1664.677271	1664.678309	R	S	416	431
PSM	GNDTPLALESTNTEK	2179	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3168.3	30.79132	3	1668.737471	1668.724376	K	E	1719	1734
PSM	REESPMDVDQPSPSAQDTQSIASDGTPQGEK	2180	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3247.6	32.85327	4	3366.410094	3366.419504	R	E	3805	3836
PSM	VDNLTYRTSPDTLR	2181	sp|Q01130|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3153.3	30.39995	3	1729.804871	1729.803630	K	R	18	32
PSM	LKGEATVSFDDPPSAK	2182	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3167.4	30.76842	3	1740.798371	1740.797147	K	A	333	349
PSM	RADLNQGIGEPQSPSRR	2183	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2850.2	22.57148	4	1959.932494	1959.927602	R	V	62	79
PSM	SERPPTILMTEEPSSPK	2184	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3160.6	30.59217	3	1993.902671	1993.906775	K	G	1080	1097
PSM	LREQDCGEPASPAASISR	2185	sp|O60353|FZD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2916.2	24.27822	3	2022.874871	2022.883019	R	L	610	628
PSM	KSQIFSTASDNQPTVTIK	2186	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3268.4	33.38865	3	2043.981071	2043.987802	K	V	447	465
PSM	DKSPVREPIDNLTPEER	2187	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3178.3	31.0528	3	2073.970271	2073.973214	K	D	134	151
PSM	EYIPGQPPLSQSSDSSPTR	2188	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3337.4	35.1717	3	2124.929471	2124.936495	K	N	871	890
PSM	TVEVAEGEAVRTPQSVTAK	2189	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3131.3	29.8255	3	2130.958571	2130.959947	R	Q	132	151
PSM	SSVSRVPCNVEGISPELEK	2190	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3403.4	36.85565	3	2165.994971	2166.002800	K	V	290	309
PSM	EEDCHSPTSKPPKPDQPLK	2191	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2712.2	19.35327	4	2269.012094	2269.008614	K	V	454	473
PSM	YRDVAECGPQQELDLNSPR	2192	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3333.5	35.07107	3	2325.999071	2326.004926	K	N	102	121
PSM	RSEACPCQPDSGSPLPAEEEK	2193	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.2919.6	24.37012	3	2422.974671	2422.977056	R	R	492	513
PSM	DAAASASTPAQAPTSDSPVAEDASR	2194	sp|P55789|ALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3021.4	26.99118	3	2452.037171	2452.039122	R	R	43	68
PSM	HGEVCPAGWKPGSDTIKPDVQK	2195	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3096.2	28.90622	5	2485.145618	2485.146110	K	S	169	191
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	2196	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3260.5	33.18983	3	2494.086071	2494.089063	R	L	815	839
PSM	STSAPQMSPGSSDNQSSSPQPAQQK	2197	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2802.3	21.37767	3	2611.084271	2611.085754	K	L	460	485
PSM	TAASGVEANSRPLDHAQPPSSLVIDK	2198	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3327.4	34.91442	4	2739.318894	2739.322889	K	E	167	193
PSM	SSERTPGAATASASGAAEDGACGCLPNPGTFEECHRK	2199	sp|O96008|TOM40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,22-UNIMOD:4,24-UNIMOD:4,34-UNIMOD:4	ms_run[1]:scan=1.1.3300.5	34.22363	5	3885.609118	3885.614215	R	C	53	90
PSM	TDRVGVEASEETPQTSSSSARPGTPSDHQSQEASQFER	2200	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3043.4	27.54255	5	4154.803618	4154.805047	K	K	359	397
PSM	DQLIYNLLK	2201	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3934.2	50.5238	2	1118.632647	1118.633560	K	E	6	15
PSM	SSGSEGSSPNWLQALK	2202	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3895.2	49.51883	3	1726.755671	1726.756345	K	L	1708	1724
PSM	ELIFQETAR	2203	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3476.3	38.75157	2	1185.540647	1185.543105	K	F	362	371
PSM	VPPAPVPCPPPSPGPSAVPSSPK	2204	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3436.3	37.7046	4	2378.076094	2378.078288	K	S	366	389
PSM	DGFVTVDELK	2205	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3668.2	43.72145	2	1201.524447	1201.526786	K	D	85	95
PSM	KLSSWDQAETPGHTPSLRWDETPGR	2206	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3539.2	40.36737	5	3010.295118	3010.301181	K	A	214	239
PSM	TWTTPEVTSPPPSPR	2207	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3468.3	38.542	3	1811.753471	1811.753248	R	T	125	140
PSM	FIVSPVPESR	2208	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3425.2	37.4224	2	1209.574247	1209.579490	R	L	1258	1268
PSM	AIVDALPPPCESACTVPTDVDK	2209	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3674.2	43.87825	4	2434.077694	2434.079730	R	W	261	283
PSM	GVLLFGPPGTGK	2210	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3834.2	47.96265	2	1221.611447	1221.615876	K	T	211	223
PSM	EVSSLEGSPPPCLGQEEAVCTK	2211	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	13.0	3-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3456.3	38.22865	4	2453.0480941913206	2453.0491583581397	K	I	1388	1410
PSM	TVFSPTLPAAR	2212	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3541.3	40.42307	2	1238.601847	1238.606039	K	S	375	386
PSM	DLRSPLIATPTFVADK	2213	sp|P49116|NR2C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3855.2	48.49417	3	1902.889571	1902.889348	K	D	216	232
PSM	KKIEEAMDGSETPQLFTVLPEK	2214	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3685.3	44.1693	4	2569.2331	2569.2381	K	R	769	791
PSM	DGLLSPGAWNGEPSGEGSR	2215	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3940.3	50.68118	3	1964.826971	1964.826550	K	S	504	523
PSM	NPLPPILGSPTK	2216	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3635.2	42.85633	2	1312.678247	1312.679204	R	A	615	627
PSM	TLTPISAAYAR	2217	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3452.2	38.12108	2	1322.564647	1322.567285	K	A	295	306
PSM	VPLFSPNFSEK	2218	sp|Q9BQ52|RNZ2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3811.2	47.36505	2	1343.610647	1343.616270	K	V	732	743
PSM	DLFSLDSEDPSPASPPLR	2219	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4169.2	55.76097	3	2021.893271	2021.898318	R	S	224	242
PSM	EFSPFGSITSAK	2220	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3814.2	47.44195	2	1349.585247	1349.590449	K	V	313	325
PSM	EGLELLKTAIGK	2221	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3590.3	41.69662	2	1350.712047	1350.715984	K	A	222	234
PSM	IVSAQSLAEDDVE	2222	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3432.2	37.59958	2	1374.645847	1374.651455	R	-	133	146
PSM	TLEEDEEELFK	2223	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3723.3	45.13378	2	1380.625247	1380.629657	K	M	40	51
PSM	DQPPFGDSDDSVEADKSSPGIHLER	2224	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3437.2	37.72757	4	2777.169694	2777.181763	K	S	488	513
PSM	DVIELTDDSFDK	2225	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3662.3	43.56777	2	1395.637247	1395.640556	K	N	161	173
PSM	ESVPEFPLSPPK	2226	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3681.2	44.06135	2	1405.648447	1405.653049	K	K	30	42
PSM	ESVPEFPLSPPK	2227	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3732.2	45.36522	2	1405.650647	1405.653049	K	K	30	42
PSM	TSSLAPVVGTTTTTPSPSAIK	2228	sp|Q92733|PRCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3561.3	40.94755	3	2175.005171	2175.011313	K	A	226	247
PSM	DNLTLWTSDMQGDGEEQNK	2229	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3551.4	40.68845	3	2195.923271	2195.927707	R	E	226	245
PSM	VVGDRENGSDNLPSSAGSGDKPLSDPAPF	2230	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3546.3	40.5539	4	2964.312094	2964.313840	K	-	178	207
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	2231	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3609.3	42.18563	4	2972.321294	2972.324602	K	Q	178	204
PSM	YQIDPDACFSAK	2232	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3465.3	38.46272	2	1493.585447	1493.589797	K	V	225	237
PSM	ELENANDLLSATK	2233	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3487.6	39.0504	2	1496.676447	1496.675970	K	R	352	365
PSM	VEGIYTYSLSPSK	2234	sp|O95197|RTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3547.5	40.58681	2	1522.691647	1522.695642	K	V	220	233
PSM	IQEWIPPSTPYK	2235	sp|Q9UI09|NDUAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3549.4	40.6357	2	1537.716247	1537.721798	K	-	134	146
PSM	IADPEHDHTGFLTEYVATR	2236	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3475.6	38.73537	3	2330.959271	2330.961009	R	W	190	209
PSM	TSESTGSLPSPFLR	2237	sp|O95456|PSMG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3653.3	43.33177	2	1557.702247	1557.707604	K	A	177	191
PSM	LRTGDLGIPPNPEDRSPSPEPIYNSEGK	2238	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3523.6	39.98542	4	3194.432094	3194.432255	K	R	65	93
PSM	DMSPLSETEMALGK	2239	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3804.2	47.1864	2	1603.649447	1603.651077	K	D	505	519
PSM	DMSPLSETEMALGK	2240	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3951.2	50.94873	2	1603.651047	1603.651077	K	D	505	519
PSM	ASPPSGLWSPAYASH	2241	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3649.5	43.23427	2	1606.683047	1606.681724	K	-	1873	1888
PSM	IDFSSIAVPGTSSPR	2242	sp|Q5TDH0|DDI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3870.2	48.88578	3	1612.747571	1612.749803	R	Q	94	109
PSM	ATTPASTANSDVATIPTDTPLKEENEGFVK	2243	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3662.6	43.57777	4	3263.450894	3263.452382	K	V	274	304
PSM	TVQGPPTSDDIFER	2244	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3520.5	39.90372	2	1640.701647	1640.708332	K	E	33	47
PSM	FSPVTPKFTPVASK	2245	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3476.2	38.74823	3	1664.759771	1664.761628	K	F	266	280
PSM	MVIQGPSSPQGEAMVTDVLEDQK	2246	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4082.3	54.11228	3	2538.135371	2538.138307	K	E	1107	1130
PSM	NTPASASLEGLAQTAGR	2247	sp|Q96Q45|TM237_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3657.3	43.43697	3	1722.795071	1722.793793	K	R	43	60
PSM	NTLNGDLASATIPEESR	2248	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3496.2	39.27193	3	1866.830471	1866.836052	K	L	266	283
PSM	TLPLTTAPEAGEVTPSDSGGQEDSPAK	2249	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3524.5	40.00772	3	2814.178871	2814.188562	K	G	2233	2260
PSM	ALSSGGSITSPPLSPALPK	2250	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3744.4	45.68577	3	1938.9065	1938.9100	R	Y	17	36
PSM	DTMSDQALEALSASLGTR	2251	sp|P20810|ICAL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3909.2	49.88642	3	1960.844471	1960.844903	K	Q	284	302
PSM	GTDECAIESIAVAATPIPK	2252	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3745.4	45.71153	3	2021.934371	2021.938075	R	L	444	463
PSM	TIGGGDDSFNTFFSETGAGK	2253	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4002.2	52.23532	3	2086.854971	2086.852096	K	H	41	61
PSM	LGLQEGSNNSSPVDFVNNK	2254	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3578.4	41.3933	3	2097.934871	2097.936829	K	R	56	75
PSM	DQPAFTPSGILTPHALGSR	2255	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3919.5	50.15722	3	2123.938271	2123.944237	R	N	428	447
PSM	VDAAPGIPPAVESIQDSPLPK	2256	sp|Q15814|TBCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3803.3	47.1606	3	2180.074571	2180.076617	K	K	152	173
PSM	IIEVAPQVATQNVNPTPGATS	2257	sp|P49903|SPS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3582.3	41.49015	3	2186.058671	2186.062029	R	-	372	393
PSM	DNLTLWTSDQQDDDGGEGNN	2258	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3867.4	48.81423	3	2192.866871	2192.873028	R	-	228	248
PSM	QQPPEPEWIGDGESTSPSDK	2259	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3467.6	38.5256	3	2262.925271	2262.931803	K	V	7	27
PSM	DTPENNPDTPFDFTPENYK	2260	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3861.2	48.65063	3	2319.914171	2319.920904	R	R	43	62
PSM	SGSSSPDSEITELKFPSINHD	2261	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3865.4	48.762	3	2325.992171	2326.000217	R	-	571	592
PSM	VAASPKSPTAALNESLVECPK	2262	sp|Q53EZ4|CEP55_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3547.6	40.59015	3	2328.044471	2328.047382	K	C	422	443
PSM	IADPEHDHTGFLTEYVATR	2263	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3542.4	40.4526	3	2330.961971	2330.961009	R	W	190	209
PSM	FVEWLQNAEEESESEGEEN	2264	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4150.4	55.39217	3	2333.884571	2333.884913	K	-	401	420
PSM	NSSTPGLQVPVSPTVPIQNQK	2265	sp|Q03164|KMT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3660.4	43.51837	3	2350.094471	2350.097109	R	Y	3025	3046
PSM	AAVPSGASTGIYEALELRDNDK	2266	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3987.3	51.85337	3	2436.057071	2436.061117	R	T	33	55
PSM	AVFVDLEPTVIDEVRTGTYR	2267	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4188.3	56.0646	3	2439.108671	2439.112424	R	Q	65	85
PSM	NALFPEVFSPTPDENSDQNSR	2268	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4125.4	54.90832	3	2443.027871	2443.032914	R	S	567	588
PSM	DNLTLWTADNAGEEGGEAPQEPQS	2269	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3854.4	48.47515	3	2528.084471	2528.093920	R	-	225	249
PSM	VLENAEGARTTPSVVAFTADGER	2270	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3471.4	38.62377	3	2549.118371	2549.120029	K	L	77	100
PSM	DLGLPTEAYISVEEVHDDGTPTSK	2271	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3986.3	51.83742	3	2652.183371	2652.184389	K	T	130	154
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	2272	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3476.6	38.76157	3	2654.181071	2654.189112	K	K	453	479
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	2273	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.3976.5	51.57689	3	2763.126071	2763.129259	K	D	208	233
PSM	RPPEPTTPWQEDPEPEDENLYEK	2274	sp|Q9NX14|NDUBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3450.6	38.0813	3	2875.217171	2875.222566	K	N	47	70
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	2275	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3540.6	40.4071	4	3642.452494	3642.458229	K	V	60	92
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	2276	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4521.2	60.90118	4	3720.685294	3720.684901	K	G	621	655
PSM	QSKPVTTPEEIAQVATISANGDK	2277	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3495.5	39.25588	3	2544.154871	2543.155746	K	E	158	181
PSM	EITALAPSTMK	2278	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3036.3	27.368	2	1256.574247	1256.572356	K	I	318	329
PSM	FNEEHIPDSPFVVPVASPSGDARR	2279	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3705.5	44.68443	4	2782.2104	2782.2148	K	L	2311	2335
PSM	NGSLDSPGKQDTEEDEEEDEK	2280	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2853.6	22.66163	3	2430.911171	2429.923149	K	D	134	155
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	2281	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2799.6	21.30892	4	3025.343294	3024.356099	K	S	145	174
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	2282	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,9-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3287.4	33.88455	4	2898.2802	2897.2582	K	L	281	308
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2283	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4007.3	52.34527	3	2830.1932	2829.1962	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2284	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3857.6	48.55938	3	2749.2235	2749.2301	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2285	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3863.2	48.70262	4	2750.2272	2749.2302	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2286	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3865.6	48.76867	3	2749.2235	2749.2301	-	Y	1	25
PSM	ASGVAVSDGVIK	2287	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3408.3	36.9821	2	1223.5776	1223.5794	M	V	2	14
PSM	AESSESFTMASSPAQRR	2288	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3249.3	32.89578	3	1963.8152	1962.8142	M	R	2	19
PSM	QGAIVAVTGDGVNDSPALK	2289	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=1.1.3822.5	47.66335	2	1873.8791	1873.8817	R	K	708	727
PSM	WLKSPTTPIDPEK	2290	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	35.8957	3	1670.7350	1670.7353	K	Q	859	872
PSM	SSAPTTPPSVDKVDGFSRK	2291	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3299.4	34.195	3	2096.9728	2096.9774	M	S	2	21
PSM	SSAPTTPPSVDKVDGFSR	2292	sp|Q16537|2A5E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3480.2	38.85347	3	1968.8816	1968.8825	M	K	2	20
PSM	AADVSVTHRPPLSPK	2293	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3147.2	30.23957	3	1695.8332	1695.8340	M	S	2	17
PSM	GEPNVSYICSR	2294	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3116.5	29.43935	2	1360.546047	1360.548267	R	Y	273	284
PSM	NWACFTGK	2295	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3372.2	36.07862	2	1062.393447	1062.399418	R	K	133	141
PSM	IYQEEEMPESGAGSEFNRK	2296	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3206.6	31.7943	3	2279.9402	2279.9401	K	L	56	75
PSM	ESMCSTPAFPVSPETPYVK	2297	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	3-UNIMOD:35,4-UNIMOD:4,6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3732.5	45.37522	3	2301.8900	2301.8971	K	T	839	858
PSM	DQPPFGDSDDSVEADKSSPGIHLER	2298	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3453.4	38.1537	4	2778.174094	2777.181763	K	S	488	513
PSM	DQPPFGDSDDSVEADKSSPGIHLER	2299	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3445.3	37.94028	4	2778.174094	2777.181763	K	S	488	513
PSM	RGSLSNAGDPEIVKSPSDPK	2300	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2933.3	24.72287	4	2134.011694	2133.010328	R	Q	92	112
PSM	MEPSSLELPADTVQR	2301	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3946.2	50.81635	3	1793.7905	1793.7902	-	I	1	16
PSM	SRLTPVSPESSSTEEK	2302	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2854.4	22.68068	3	1893.791471	1892.780585	R	S	266	282
PSM	MNLLPNIESPVTRQEK	2303	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.3831.3	47.88845	3	2005.9487	2005.9539	-	M	1	17
PSM	DGFPSGTPALNAK	2304	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3289.2	33.93038	2	1354.597447	1353.596597	K	G	148	161
PSM	GVLLFGPPGTGK	2305	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3842.2	48.17173	2	1221.611447	1221.615876	K	T	211	223
PSM	ENDFDRLVLQYAPSA	2306	sp|O14579|COPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4312.2	58.30428	3	1816.8041	1816.8028	K	-	294	309
PSM	ELQSAVPRDVEDVPITVE	2307	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3927.2	50.33838	3	2074.983071	2074.982382	R	-	420	438
PSM	TAHNSEADLEESFNEHELEPSSPK	2308	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3427.3	37.47588	4	2776.148894	2776.150129	K	S	134	158
PSM	LNSPTDSTPALLSATVTPQK	2309	sp|Q9H4X1|RGCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3729.3	45.28973	3	2199.996971	2200.006562	K	A	95	115
PSM	LADMEHSSGESSFESTGTGLSR	2310	sp|P31629|ZEP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	4-UNIMOD:35,21-UNIMOD:21	ms_run[1]:scan=1.1.3527.2	40.07025	4	2380.9532	2379.9522	R	S	944	966
PSM	GGLSPFHAPAQSPGLHGGAAGSR	2311	sp|A0A0B4J2F2|SIK1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	34.26463	4	2287.988894	2287.988896	R	E	623	646
PSM	EKEEHTQEEGTVPSRTIEEEK	2312	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2521.2	17.29135	5	2565.128118	2564.127937	R	G	399	420
PSM	ALSRQEMQEVQSSR	2313	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2695.5	18.95733	3	1743.760871	1743.761113	K	S	187	201
PSM	EATNTTSEPSAPSQDLLDLSPSPR	2314	sp|O75674|TM1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3744.6	45.69243	3	2592.153371	2592.159237	K	M	302	326
PSM	GNPTVEVDLFTSK	2315	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3881.5	49.18105	2	1565.636647	1565.641572	R	G	16	29
PSM	KSMETHIMHTFK	2316	sp|Q969G6|RIFK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,3-UNIMOD:35	ms_run[1]:scan=1.1.4009.4	52.39392	2	1584.685847	1584.682986	K	E	76	88
PSM	ESAEYRCSVLSSAGNK	2317	sp|Q92854-2|SEM4D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4124.2	54.88238	3	1916.751371	1916.737675	R	T	671	687