MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000150 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617204740166495^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_21_K2_5.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	53.0	null	2-UNIMOD:1,19-UNIMOD:21,479-UNIMOD:21,601-UNIMOD:21,628-UNIMOD:4,4-UNIMOD:21	0.10	53.0	5	3	2
PRT	sp|Q9UBV2|SE1L1_HUMAN	Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	96-UNIMOD:21	0.03	45.0	2	1	0
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	202-UNIMOD:21,204-UNIMOD:21,207-UNIMOD:21,198-UNIMOD:21,17-UNIMOD:21,312-UNIMOD:21,368-UNIMOD:21,310-UNIMOD:35,286-UNIMOD:21	0.18	43.0	23	6	2
PRT	sp|Q9NS69|TOM22_HUMAN	Mitochondrial import receptor subunit TOM22 homolog OS=Homo sapiens OX=9606 GN=TOMM22 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	null	2-UNIMOD:1,15-UNIMOD:21	0.15	43.0	4	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	16-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	232-UNIMOD:21,241-UNIMOD:21	0.04	42.0	4	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	235-UNIMOD:35	0.17	42.0	6	3	2
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	79-UNIMOD:4,83-UNIMOD:21,117-UNIMOD:21,210-UNIMOD:21,251-UNIMOD:21,255-UNIMOD:4,113-UNIMOD:21,249-UNIMOD:21,254-UNIMOD:21,58-UNIMOD:21,120-UNIMOD:35,104-UNIMOD:4	0.37	42.0	19	7	4
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	28-UNIMOD:21	0.16	42.0	6	2	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	118-UNIMOD:21,101-UNIMOD:21,27-UNIMOD:21,120-UNIMOD:21	0.23	41.0	10	4	2
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	263-UNIMOD:21,205-UNIMOD:21,26-UNIMOD:21,229-UNIMOD:21,19-UNIMOD:21,27-UNIMOD:21,72-UNIMOD:21,79-UNIMOD:21,272-UNIMOD:21,336-UNIMOD:21,337-UNIMOD:4,339-UNIMOD:4,40-UNIMOD:21,41-UNIMOD:21,14-UNIMOD:21	0.35	41.0	28	13	7
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	575-UNIMOD:21,210-UNIMOD:21,216-UNIMOD:4,581-UNIMOD:21,573-UNIMOD:21,578-UNIMOD:21	0.07	40.0	8	5	3
PRT	sp|P13807|GYS1_HUMAN	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	720-UNIMOD:21,727-UNIMOD:21,721-UNIMOD:21	0.04	40.0	3	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	447-UNIMOD:4,455-UNIMOD:21,113-UNIMOD:21,225-UNIMOD:21,231-UNIMOD:21,447-UNIMOD:385,206-UNIMOD:21,70-UNIMOD:21,114-UNIMOD:21,175-UNIMOD:21,159-UNIMOD:21,232-UNIMOD:21,163-UNIMOD:21,164-UNIMOD:21,237-UNIMOD:4,158-UNIMOD:28,61-UNIMOD:21	0.29	39.0	42	15	7
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	287-UNIMOD:21,295-UNIMOD:21,444-UNIMOD:21,595-UNIMOD:21,548-UNIMOD:21	0.11	39.0	11	5	3
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	373-UNIMOD:4,377-UNIMOD:21,386-UNIMOD:21,64-UNIMOD:21,136-UNIMOD:21,171-UNIMOD:21,179-UNIMOD:4,385-UNIMOD:21,289-UNIMOD:21,381-UNIMOD:21	0.18	39.0	14	6	4
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	39.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35,303-UNIMOD:21,300-UNIMOD:21,305-UNIMOD:35,106-UNIMOD:21	0.16	39.0	14	3	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	691-UNIMOD:21,695-UNIMOD:21,435-UNIMOD:21,494-UNIMOD:21,504-UNIMOD:21,712-UNIMOD:21,716-UNIMOD:4,1324-UNIMOD:4,1328-UNIMOD:21,1715-UNIMOD:21,1103-UNIMOD:21,1031-UNIMOD:21,1032-UNIMOD:21,498-UNIMOD:21,669-UNIMOD:4,672-UNIMOD:21,983-UNIMOD:21,1138-UNIMOD:21,601-UNIMOD:21	0.14	38.0	23	13	8
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	15-UNIMOD:21,26-UNIMOD:21,20-UNIMOD:35	0.06	38.0	6	2	0
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	37-UNIMOD:21,32-UNIMOD:21,139-UNIMOD:21,150-UNIMOD:21	0.09	37.0	3	2	1
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	226-UNIMOD:21,159-UNIMOD:21	0.09	37.0	2	2	2
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	629-UNIMOD:21,637-UNIMOD:21,631-UNIMOD:21,692-UNIMOD:21	0.05	37.0	6	2	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	237-UNIMOD:4	0.10	37.0	4	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	54-UNIMOD:21,251-UNIMOD:21,320-UNIMOD:21,326-UNIMOD:21,325-UNIMOD:21,327-UNIMOD:35	0.24	36.0	12	6	4
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	2410-UNIMOD:21	0.00	36.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	67-UNIMOD:21,60-UNIMOD:21,63-UNIMOD:21	0.13	36.0	6	4	3
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	438-UNIMOD:21,114-UNIMOD:21,123-UNIMOD:4,177-UNIMOD:21	0.10	36.0	5	3	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	643-UNIMOD:21,460-UNIMOD:21,85-UNIMOD:21,62-UNIMOD:21,86-UNIMOD:21,65-UNIMOD:21,69-UNIMOD:21,91-UNIMOD:21	0.17	36.0	17	9	5
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,14-UNIMOD:21,17-UNIMOD:4,16-UNIMOD:35	0.05	36.0	4	1	0
PRT	sp|O95295|SNAPN_HUMAN	SNARE-associated protein Snapin OS=Homo sapiens OX=9606 GN=SNAPIN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,14-UNIMOD:21	0.16	36.0	1	1	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	35.0	null	30-UNIMOD:21,168-UNIMOD:21,28-UNIMOD:21	0.14	35.0	6	2	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	145-UNIMOD:21,139-UNIMOD:21,136-UNIMOD:21,303-UNIMOD:21	0.14	35.0	11	4	1
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	157-UNIMOD:21	0.09	35.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	237-UNIMOD:21,234-UNIMOD:21,104-UNIMOD:4,125-UNIMOD:21	0.23	35.0	8	4	2
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	74-UNIMOD:21,76-UNIMOD:21	0.08	35.0	9	4	1
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	88-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	79-UNIMOD:21,64-UNIMOD:21,51-UNIMOD:21	0.46	35.0	10	6	4
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	122-UNIMOD:21	0.04	35.0	7	4	2
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	51-UNIMOD:21,54-UNIMOD:21	0.05	35.0	4	1	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	47-UNIMOD:21	0.18	35.0	6	3	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	64-UNIMOD:21,74-UNIMOD:21,79-UNIMOD:21,16-UNIMOD:21	0.47	35.0	4	2	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	221-UNIMOD:21,314-UNIMOD:21,333-UNIMOD:4,52-UNIMOD:21	0.13	34.0	5	3	2
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	41-UNIMOD:21,46-UNIMOD:21	0.19	34.0	2	1	0
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	199-UNIMOD:21	0.02	34.0	3	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	2272-UNIMOD:21,1318-UNIMOD:21,1329-UNIMOD:21,1048-UNIMOD:21,1014-UNIMOD:21,1016-UNIMOD:4,424-UNIMOD:21,2367-UNIMOD:21,2388-UNIMOD:21,2335-UNIMOD:21,2343-UNIMOD:21,1003-UNIMOD:21,2104-UNIMOD:21,2694-UNIMOD:21,983-UNIMOD:21,994-UNIMOD:21,848-UNIMOD:21,864-UNIMOD:21,2100-UNIMOD:21,2102-UNIMOD:21	0.08	34.0	17	13	10
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	286-UNIMOD:21,283-UNIMOD:21,285-UNIMOD:21,640-UNIMOD:21,1391-UNIMOD:21,1399-UNIMOD:4,1407-UNIMOD:4,470-UNIMOD:4,483-UNIMOD:21	0.05	34.0	13	6	4
PRT	sp|P32004|L1CAM_HUMAN	Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1248-UNIMOD:21,701-UNIMOD:21	0.04	34.0	2	2	2
PRT	sp|P55209|NP1L1_HUMAN	Nucleosome assembly protein 1-like 1 OS=Homo sapiens OX=9606 GN=NAP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	62-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	38-UNIMOD:21	0.15	34.0	9	2	1
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	62-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,442-UNIMOD:21,67-UNIMOD:21,469-UNIMOD:21,471-UNIMOD:4	0.13	34.0	5	3	2
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1,16-UNIMOD:21	0.08	34.0	2	1	0
PRT	sp|O75496|GEMI_HUMAN	Geminin OS=Homo sapiens OX=9606 GN=GMNN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	64-UNIMOD:21	0.12	33.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	3-UNIMOD:4,11-UNIMOD:21,7-UNIMOD:21,13-UNIMOD:21	0.09	33.0	4	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	863-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	722-UNIMOD:21	0.03	33.0	4	1	0
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	210-UNIMOD:21,211-UNIMOD:21	0.07	33.0	8	2	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	241-UNIMOD:4,243-UNIMOD:21,295-UNIMOD:21	0.08	33.0	2	2	2
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	289-UNIMOD:21,295-UNIMOD:35,366-UNIMOD:21,77-UNIMOD:21	0.13	33.0	7	3	1
PRT	sp|Q8NDC0|MISSL_HUMAN	MAPK-interacting and spindle-stabilizing protein-like OS=Homo sapiens OX=9606 GN=MAPK1IP1L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,15-UNIMOD:21	0.07	33.0	2	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	66-UNIMOD:21,163-UNIMOD:21,633-UNIMOD:21	0.16	32.0	6	6	6
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	40-UNIMOD:21,33-UNIMOD:35,94-UNIMOD:21,41-UNIMOD:21,165-UNIMOD:21	0.18	32.0	7	3	2
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	223-UNIMOD:21,227-UNIMOD:21,207-UNIMOD:21,211-UNIMOD:21,142-UNIMOD:21,322-UNIMOD:21,328-UNIMOD:21,129-UNIMOD:21	0.07	32.0	7	7	7
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	11-UNIMOD:4,25-UNIMOD:4,28-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	743-UNIMOD:21,758-UNIMOD:4,751-UNIMOD:21	0.04	32.0	5	1	0
PRT	sp|Q9BVK6|TMED9_HUMAN	Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	80-UNIMOD:21,72-UNIMOD:28,85-UNIMOD:35	0.11	32.0	6	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	156-UNIMOD:21,160-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,139-UNIMOD:4,8-UNIMOD:21	0.32	32.0	9	4	2
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	14-UNIMOD:21,211-UNIMOD:21	0.10	32.0	4	2	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	488-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21	0.05	32.0	3	2	1
PRT	sp|Q9Y6I3|EPN1_HUMAN	Epsin-1 OS=Homo sapiens OX=9606 GN=EPN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	454-UNIMOD:21,460-UNIMOD:21	0.04	32.0	3	1	0
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	219-UNIMOD:21,81-UNIMOD:21,722-UNIMOD:21,499-UNIMOD:21,708-UNIMOD:28	0.09	32.0	6	6	6
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	40-UNIMOD:21,42-UNIMOD:4,47-UNIMOD:4,27-UNIMOD:4,29-UNIMOD:21	0.18	31.0	4	2	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	9-UNIMOD:21	0.17	31.0	4	2	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	444-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	160-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	443-UNIMOD:21,437-UNIMOD:21,434-UNIMOD:35,456-UNIMOD:21,131-UNIMOD:28,136-UNIMOD:21,141-UNIMOD:21,120-UNIMOD:21	0.18	31.0	15	7	4
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1129-UNIMOD:4,1131-UNIMOD:21,1139-UNIMOD:21,1923-UNIMOD:21,2221-UNIMOD:4,2223-UNIMOD:21,2231-UNIMOD:21,1111-UNIMOD:21	0.02	31.0	6	4	2
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	663-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	779-UNIMOD:21,778-UNIMOD:21,1251-UNIMOD:21	0.02	31.0	3	2	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	511-UNIMOD:21,5763-UNIMOD:21,41-UNIMOD:21,4564-UNIMOD:21,3426-UNIMOD:21,5099-UNIMOD:21,93-UNIMOD:21,177-UNIMOD:21,4092-UNIMOD:21,3417-UNIMOD:35,502-UNIMOD:35	0.03	31.0	16	9	4
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	8-UNIMOD:21	0.10	31.0	2	2	2
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	246-UNIMOD:21,251-UNIMOD:21,237-UNIMOD:21,242-UNIMOD:4	0.08	31.0	4	2	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	394-UNIMOD:21,415-UNIMOD:21	0.07	31.0	3	2	1
PRT	sp|Q16740|CLPP_HUMAN	ATP-dependent Clp protease proteolytic subunit, mitochondrial OS=Homo sapiens OX=9606 GN=CLPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	231-UNIMOD:21,233-UNIMOD:35	0.06	31.0	2	1	0
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	298-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	641-UNIMOD:21,668-UNIMOD:21	0.04	31.0	3	2	1
PRT	sp|P48960|CD97_HUMAN	CD97 antigen OS=Homo sapiens OX=9606 GN=CD97 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	44-UNIMOD:4,57-UNIMOD:21,62-UNIMOD:4,68-UNIMOD:4,70-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|Q96TA1|NIBA2_HUMAN	Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	638-UNIMOD:21,646-UNIMOD:21,691-UNIMOD:21,696-UNIMOD:21,692-UNIMOD:21,665-UNIMOD:21,681-UNIMOD:21	0.12	31.0	9	3	1
PRT	sp|O43399|TPD54_HUMAN	Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,12-UNIMOD:21,1-UNIMOD:35,149-UNIMOD:21,104-UNIMOD:21	0.22	31.0	8	4	3
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	145-UNIMOD:28,155-UNIMOD:21,160-UNIMOD:21,162-UNIMOD:21,159-UNIMOD:21	0.07	31.0	9	3	1
PRT	sp|P51148|RAB5C_HUMAN	Ras-related protein Rab-5C OS=Homo sapiens OX=9606 GN=RAB5C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	122-UNIMOD:28,124-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|Q9BRP8|PYM1_HUMAN	Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|Q6P582|MZT2A_HUMAN	Mitotic-spindle organizing protein 2A OS=Homo sapiens OX=9606 GN=MZT2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,12-UNIMOD:21	0.14	31.0	1	1	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	144-UNIMOD:21,148-UNIMOD:21	0.14	30.0	3	1	0
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	926-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	623-UNIMOD:21,1027-UNIMOD:4,1028-UNIMOD:21,1034-UNIMOD:21,612-UNIMOD:21,608-UNIMOD:21,1023-UNIMOD:21,618-UNIMOD:21,625-UNIMOD:21	0.03	30.0	8	4	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	278-UNIMOD:35,280-UNIMOD:21,507-UNIMOD:21,2-UNIMOD:1,14-UNIMOD:21,358-UNIMOD:21,585-UNIMOD:21,514-UNIMOD:35,11-UNIMOD:21	0.09	30.0	11	5	2
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	453-UNIMOD:21,859-UNIMOD:21	0.03	30.0	3	2	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	37-UNIMOD:21,34-UNIMOD:21,39-UNIMOD:21,170-UNIMOD:21	0.16	30.0	8	3	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	28-UNIMOD:21,34-UNIMOD:21,30-UNIMOD:21,38-UNIMOD:35	0.03	30.0	6	1	0
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	190-UNIMOD:21,193-UNIMOD:21	0.05	30.0	6	2	1
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	172-UNIMOD:21,166-UNIMOD:21,164-UNIMOD:35,168-UNIMOD:21	0.03	30.0	9	1	0
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	405-UNIMOD:21,418-UNIMOD:21,209-UNIMOD:21,172-UNIMOD:21,332-UNIMOD:21,401-UNIMOD:21,156-UNIMOD:21,411-UNIMOD:21,135-UNIMOD:21,331-UNIMOD:21,440-UNIMOD:21	0.24	30.0	14	8	6
PRT	sp|O00267|SPT5H_HUMAN	Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	666-UNIMOD:21,1034-UNIMOD:21,665-UNIMOD:35	0.03	30.0	3	2	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	143-UNIMOD:21,147-UNIMOD:21,265-UNIMOD:21,276-UNIMOD:21	0.15	30.0	3	2	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	202-UNIMOD:21,37-UNIMOD:21,41-UNIMOD:21,205-UNIMOD:21,152-UNIMOD:4	0.10	30.0	12	4	2
PRT	sp|P30084|ECHM_HUMAN	Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	88-UNIMOD:21,277-UNIMOD:21	0.10	30.0	2	2	2
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	332-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	237-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|Q9BXK5|B2L13_HUMAN	Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	426-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	370-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P00966|ASSY_HUMAN	Argininosuccinate synthase OS=Homo sapiens OX=9606 GN=ASS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	219-UNIMOD:21	0.05	30.0	5	4	3
PRT	sp|Q9NQC3|RTN4_HUMAN	Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,7-UNIMOD:21,64-UNIMOD:21,70-UNIMOD:21,11-UNIMOD:21,449-UNIMOD:21	0.07	30.0	10	3	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35	0.05	30.0	8	2	1
PRT	sp|O00418|EF2K_HUMAN	Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,18-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	1-UNIMOD:1,14-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	363-UNIMOD:21,367-UNIMOD:21,368-UNIMOD:21	0.04	29.0	5	1	0
PRT	sp|P55809|SCOT1_HUMAN	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	504-UNIMOD:4,509-UNIMOD:21,161-UNIMOD:21,170-UNIMOD:21	0.08	29.0	3	2	1
PRT	sp|Q15642|CIP4_HUMAN	Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	495-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	692-UNIMOD:21,181-UNIMOD:21	0.06	29.0	3	2	1
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	57-UNIMOD:21,65-UNIMOD:4,160-UNIMOD:21,161-UNIMOD:4	0.09	29.0	3	2	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21	0.31	29.0	2	2	2
PRT	sp|Q8WW12|PCNP_HUMAN	PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	139-UNIMOD:21,142-UNIMOD:21	0.10	29.0	5	2	0
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	313-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	81-UNIMOD:21,216-UNIMOD:21,284-UNIMOD:21,283-UNIMOD:35	0.10	29.0	8	5	4
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	108-UNIMOD:4,118-UNIMOD:21	0.03	29.0	2	1	0
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	27-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.06	29.0	4	3	2
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	791-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	816-UNIMOD:21,234-UNIMOD:4,835-UNIMOD:21	0.05	29.0	4	3	2
PRT	sp|Q13409-2|DC1I2_HUMAN	Isoform 2B of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	73-UNIMOD:21,81-UNIMOD:21,70-UNIMOD:21,80-UNIMOD:35,83-UNIMOD:21,67-UNIMOD:35	0.04	29.0	4	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	552-UNIMOD:21,641-UNIMOD:21,645-UNIMOD:4,169-UNIMOD:21,165-UNIMOD:21	0.10	29.0	7	6	5
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	164-UNIMOD:21	0.10	29.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	317-UNIMOD:21,505-UNIMOD:21,391-UNIMOD:21	0.07	29.0	6	4	2
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	674-UNIMOD:21,680-UNIMOD:21,394-UNIMOD:21,638-UNIMOD:21,227-UNIMOD:21,676-UNIMOD:21,325-UNIMOD:21,324-UNIMOD:21,401-UNIMOD:21,332-UNIMOD:21,213-UNIMOD:35	0.14	29.0	14	5	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	352-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,14-UNIMOD:21,6-UNIMOD:21,1-UNIMOD:1,1-UNIMOD:35	0.09	29.0	5	2	0
PRT	sp|P09496-2|CLCA_HUMAN	Isoform Non-brain of Clathrin light chain A OS=Homo sapiens OX=9606 GN=CLTA	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	175-UNIMOD:21,176-UNIMOD:21	0.10	29.0	2	1	0
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	62-UNIMOD:21	0.03	29.0	3	1	0
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	29.0	2	1	0
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	174-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	384-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	163-UNIMOD:4,161-UNIMOD:21,167-UNIMOD:21	0.05	28.0	3	3	3
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1183-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9BQE4|SELS_HUMAN	Selenoprotein S OS=Homo sapiens OX=9606 GN=SELENOS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	140-UNIMOD:21,144-UNIMOD:21	0.10	28.0	1	1	1
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	492-UNIMOD:21,494-UNIMOD:21,537-UNIMOD:21,442-UNIMOD:4,444-UNIMOD:21,534-UNIMOD:21,532-UNIMOD:21	0.09	28.0	6	3	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	242-UNIMOD:4,250-UNIMOD:21,254-UNIMOD:4,270-UNIMOD:4,272-UNIMOD:21,274-UNIMOD:4,113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.22	28.0	10	3	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	210-UNIMOD:21,215-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	737-UNIMOD:21,744-UNIMOD:4,680-UNIMOD:4,688-UNIMOD:21,692-UNIMOD:4,547-UNIMOD:21,898-UNIMOD:21,886-UNIMOD:21	0.06	28.0	7	6	5
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	272-UNIMOD:21,274-UNIMOD:4,277-UNIMOD:4,305-UNIMOD:21,185-UNIMOD:21	0.14	28.0	4	3	2
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	145-UNIMOD:21,190-UNIMOD:21	0.22	28.0	6	4	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	761-UNIMOD:21,765-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21,13-UNIMOD:21	0.04	28.0	3	2	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	57-UNIMOD:21,58-UNIMOD:21,65-UNIMOD:21,28-UNIMOD:21,93-UNIMOD:21	0.32	28.0	4	3	2
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	160-UNIMOD:21	0.08	28.0	2	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	174-UNIMOD:21,184-UNIMOD:21,80-UNIMOD:28,82-UNIMOD:21,83-UNIMOD:21	0.25	28.0	9	3	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	31-UNIMOD:21,96-UNIMOD:21,103-UNIMOD:21,153-UNIMOD:4,155-UNIMOD:21,14-UNIMOD:21	0.25	28.0	5	4	3
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	152-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	51-UNIMOD:21,80-UNIMOD:21,94-UNIMOD:21,56-UNIMOD:21,334-UNIMOD:21	0.25	28.0	10	6	3
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	253-UNIMOD:4,254-UNIMOD:21,209-UNIMOD:21,205-UNIMOD:21	0.05	28.0	3	3	3
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	293-UNIMOD:21,297-UNIMOD:4,303-UNIMOD:21,291-UNIMOD:21,110-UNIMOD:21,221-UNIMOD:21,204-UNIMOD:21,207-UNIMOD:4,350-UNIMOD:21	0.16	28.0	7	5	4
PRT	sp|Q86TS9|RM52_HUMAN	39S ribosomal protein L52, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	118-UNIMOD:21	0.10	27.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	104-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	341-UNIMOD:21,359-UNIMOD:4,361-UNIMOD:21	0.11	27.0	2	2	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	133-UNIMOD:21,137-UNIMOD:21,72-UNIMOD:21,107-UNIMOD:21,114-UNIMOD:21	0.36	27.0	4	3	2
PRT	sp|O60245|PCDH7_HUMAN	Protocadherin-7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	989-UNIMOD:21,1000-UNIMOD:21,1011-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	861-UNIMOD:21	0.05	27.0	4	3	2
PRT	sp|Q15599|NHRF2_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=SLC9A3R2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	43-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	128-UNIMOD:21,90-UNIMOD:21,130-UNIMOD:21	0.09	27.0	4	2	0
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	9-UNIMOD:21,50-UNIMOD:21	0.06	27.0	2	2	2
PRT	sp|Q01650|LAT1_HUMAN	Large neutral amino acids transporter small subunit 1 OS=Homo sapiens OX=9606 GN=SLC7A5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	31-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	23-UNIMOD:21,19-UNIMOD:21	0.06	27.0	2	1	0
PRT	sp|O95182|NDUA7_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 OS=Homo sapiens OX=9606 GN=NDUFA7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	78-UNIMOD:21,85-UNIMOD:21	0.17	27.0	2	1	0
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	106-UNIMOD:21,108-UNIMOD:4,303-UNIMOD:21,85-UNIMOD:21	0.10	27.0	3	3	3
PRT	sp|Q9NZT2|OGFR_HUMAN	Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	403-UNIMOD:21,315-UNIMOD:21,484-UNIMOD:21,378-UNIMOD:21	0.14	27.0	7	5	3
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	22-UNIMOD:21,335-UNIMOD:4,18-UNIMOD:21	0.09	27.0	4	2	1
PRT	sp|O94925|GLSK_HUMAN	Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	95-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	214-UNIMOD:21,202-UNIMOD:21,138-UNIMOD:35	0.18	27.0	9	4	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	620-UNIMOD:21,626-UNIMOD:21,621-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	591-UNIMOD:4,595-UNIMOD:21,779-UNIMOD:21,567-UNIMOD:4,502-UNIMOD:21,41-UNIMOD:4	0.08	27.0	5	5	5
PRT	sp|Q7Z434-4|MAVS_HUMAN	Isoform 4 of Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	24-UNIMOD:21,11-UNIMOD:21	0.07	27.0	2	1	0
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	745-UNIMOD:21,747-UNIMOD:4,756-UNIMOD:21,743-UNIMOD:28,395-UNIMOD:21,393-UNIMOD:21	0.05	27.0	4	3	2
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	319-UNIMOD:21,18-UNIMOD:21	0.20	27.0	10	6	4
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	320-UNIMOD:21,162-UNIMOD:21,164-UNIMOD:4,303-UNIMOD:21	0.19	27.0	8	5	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	212-UNIMOD:21,192-UNIMOD:21,87-UNIMOD:21	0.06	27.0	4	3	2
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	315-UNIMOD:21,322-UNIMOD:21,629-UNIMOD:21	0.04	27.0	6	2	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	25-UNIMOD:21,38-UNIMOD:21,16-UNIMOD:21	0.20	27.0	18	4	0
PRT	sp|Q92734|TFG_HUMAN	Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	183-UNIMOD:21,197-UNIMOD:21	0.06	27.0	4	1	0
PRT	sp|Q9H8Y8|GORS2_HUMAN	Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	222-UNIMOD:21,225-UNIMOD:21,433-UNIMOD:21,418-UNIMOD:21,219-UNIMOD:35	0.15	27.0	6	4	3
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	10-UNIMOD:21	0.09	27.0	1	1	1
PRT	sp|Q8NBJ5|GT251_HUMAN	Procollagen galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=COLGALT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	612-UNIMOD:21,616-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|P31350|RIR2_HUMAN	Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	33-UNIMOD:21,38-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	309-UNIMOD:4,320-UNIMOD:21,323-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	49-UNIMOD:21	0.03	27.0	3	2	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	117-UNIMOD:21,131-UNIMOD:4,99-UNIMOD:4,104-UNIMOD:4,115-UNIMOD:21	0.09	27.0	2	2	2
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,13-UNIMOD:21,27-UNIMOD:21,10-UNIMOD:35,25-UNIMOD:21	0.03	27.0	6	3	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q86VR2|RETR3_HUMAN	Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,10-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	311-UNIMOD:21,143-UNIMOD:21,146-UNIMOD:21,568-UNIMOD:21,308-UNIMOD:21	0.07	26.0	7	3	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.18	26.0	2	2	2
PRT	sp|Q9NVM9|INT13_HUMAN	Integrator complex subunit 13 OS=Homo sapiens OX=9606 GN=INTS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	626-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	427-UNIMOD:4,431-UNIMOD:21,308-UNIMOD:21,310-UNIMOD:21	0.07	26.0	4	3	2
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	118-UNIMOD:4,124-UNIMOD:21,644-UNIMOD:21,643-UNIMOD:21,811-UNIMOD:4,813-UNIMOD:21,818-UNIMOD:21,928-UNIMOD:21	0.06	26.0	6	5	4
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	65-UNIMOD:21,89-UNIMOD:21	0.11	26.0	4	3	2
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	286-UNIMOD:21	0.07	26.0	4	2	0
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	235-UNIMOD:21,237-UNIMOD:21	0.06	26.0	2	2	2
PRT	sp|Q96MH2|HEXI2_HUMAN	Protein HEXIM2 OS=Homo sapiens OX=9606 GN=HEXIM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	76-UNIMOD:21,80-UNIMOD:4,71-UNIMOD:21,29-UNIMOD:21,32-UNIMOD:21,46-UNIMOD:21	0.23	26.0	5	3	2
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	498-UNIMOD:21,787-UNIMOD:21	0.02	26.0	2	2	2
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	559-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|P17544|ATF7_HUMAN	Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	51-UNIMOD:21,53-UNIMOD:21,132-UNIMOD:21,138-UNIMOD:4,139-UNIMOD:21,136-UNIMOD:21	0.10	26.0	8	3	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	17-UNIMOD:21	0.21	26.0	1	1	1
PRT	sp|Q86W56|PARG_HUMAN	Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	137-UNIMOD:21,302-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	228-UNIMOD:21,225-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|Q96C36|P5CR2_HUMAN	Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	304-UNIMOD:21,294-UNIMOD:21,301-UNIMOD:21,303-UNIMOD:21	0.06	26.0	6	2	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	2032-UNIMOD:21,2029-UNIMOD:21,1261-UNIMOD:21	0.01	26.0	3	2	1
PRT	sp|O60353|FZD6_HUMAN	Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	615-UNIMOD:4,620-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	2805-UNIMOD:21,1894-UNIMOD:21,1760-UNIMOD:21,1890-UNIMOD:21,2807-UNIMOD:21,2813-UNIMOD:35	0.02	26.0	5	3	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1469-UNIMOD:21,1697-UNIMOD:21,1165-UNIMOD:21	0.02	26.0	4	3	2
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	110-UNIMOD:21,113-UNIMOD:21,183-UNIMOD:21,187-UNIMOD:21,567-UNIMOD:21,119-UNIMOD:21,123-UNIMOD:21,306-UNIMOD:21,335-UNIMOD:21,120-UNIMOD:21	0.13	26.0	10	6	3
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	910-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	112-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	38-UNIMOD:21,45-UNIMOD:21,631-UNIMOD:21	0.06	26.0	5	3	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	468-UNIMOD:21,462-UNIMOD:21,467-UNIMOD:21,412-UNIMOD:4	0.11	26.0	8	6	5
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	221-UNIMOD:21,242-UNIMOD:21	0.18	26.0	6	3	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	561-UNIMOD:21,565-UNIMOD:21,540-UNIMOD:4,542-UNIMOD:21,551-UNIMOD:21	0.05	26.0	3	2	1
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	182-UNIMOD:21	0.17	26.0	2	2	2
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	111-UNIMOD:21,594-UNIMOD:21	0.04	26.0	6	3	2
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	207-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9ULH7|MRTFB_HUMAN	Myocardin-related transcription factor B OS=Homo sapiens OX=9606 GN=MRTFB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	921-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	433-UNIMOD:21,439-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	6032-UNIMOD:21,4521-UNIMOD:21	0.00	26.0	2	2	2
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	147-UNIMOD:21,2-UNIMOD:1,3-UNIMOD:21	0.13	26.0	2	2	2
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1141-UNIMOD:21,1144-UNIMOD:4,1151-UNIMOD:4,1153-UNIMOD:4,643-UNIMOD:4,658-UNIMOD:21,1162-UNIMOD:4,1237-UNIMOD:21	0.04	26.0	4	4	4
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	2-UNIMOD:1,8-UNIMOD:21,302-UNIMOD:21	0.05	26.0	3	2	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	2-UNIMOD:1,13-UNIMOD:21	0.09	26.0	2	2	2
PRT	sp|A1KXE4|F168B_HUMAN	Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	1-UNIMOD:1,6-UNIMOD:21,1-UNIMOD:35	0.10	26.0	2	1	0
PRT	sp|P62310|LSM3_HUMAN	U6 snRNA-associated Sm-like protein LSm3 OS=Homo sapiens OX=9606 GN=LSM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,10-UNIMOD:21	0.22	26.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	104-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	36-UNIMOD:21,9-UNIMOD:21,37-UNIMOD:21,39-UNIMOD:21,124-UNIMOD:21,125-UNIMOD:21	0.19	25.0	10	4	1
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	346-UNIMOD:21,338-UNIMOD:21	0.03	25.0	5	2	0
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	426-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P85037|FOXK1_HUMAN	Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	420-UNIMOD:21,428-UNIMOD:21,247-UNIMOD:21,254-UNIMOD:4,257-UNIMOD:21,416-UNIMOD:21	0.06	25.0	3	2	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	60-UNIMOD:21,98-UNIMOD:21,42-UNIMOD:21	0.24	25.0	4	3	2
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	121-UNIMOD:4,128-UNIMOD:4,129-UNIMOD:21,247-UNIMOD:4,254-UNIMOD:4,255-UNIMOD:21	0.09	25.0	2	2	2
PRT	sp|O75179|ANR17_HUMAN	Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	2042-UNIMOD:21,2045-UNIMOD:21,2044-UNIMOD:21,2047-UNIMOD:21	0.01	25.0	3	1	0
PRT	sp|O95684|FR1OP_HUMAN	FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	160-UNIMOD:21	0.07	25.0	3	2	1
PRT	sp|Q13033|STRN3_HUMAN	Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	229-UNIMOD:21	0.02	25.0	4	2	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	671-UNIMOD:21,667-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1000-UNIMOD:21,1006-UNIMOD:21,996-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q53H80|AKIR2_HUMAN	Akirin-2 OS=Homo sapiens OX=9606 GN=AKIRIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	18-UNIMOD:21,21-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	445-UNIMOD:21,450-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q12792|TWF1_HUMAN	Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	143-UNIMOD:21,140-UNIMOD:21,148-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	22-UNIMOD:21,7-UNIMOD:28	0.02	25.0	4	1	0
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	44-UNIMOD:21,51-UNIMOD:21	0.08	25.0	3	1	0
PRT	sp|Q8WXI9|P66B_HUMAN	Transcriptional repressor p66-beta OS=Homo sapiens OX=9606 GN=GATAD2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	120-UNIMOD:21,135-UNIMOD:21,112-UNIMOD:21	0.05	25.0	3	2	1
PRT	sp|P50542|PEX5_HUMAN	Peroxisomal targeting signal 1 receptor OS=Homo sapiens OX=9606 GN=PEX5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	317-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1012-UNIMOD:4,1014-UNIMOD:21,777-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	229-UNIMOD:4,237-UNIMOD:21	0.16	25.0	3	2	1
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	8-UNIMOD:4,12-UNIMOD:21,17-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,9-UNIMOD:21,13-UNIMOD:21	0.14	25.0	3	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	167-UNIMOD:28,181-UNIMOD:21,186-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	105-UNIMOD:4,34-UNIMOD:21,53-UNIMOD:21	0.10	24.0	5	4	3
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	537-UNIMOD:21,542-UNIMOD:21,566-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1019-UNIMOD:21	0.01	24.0	2	2	2
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	460-UNIMOD:21,456-UNIMOD:4	0.03	24.0	2	2	2
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	161-UNIMOD:4	0.15	24.0	3	3	3
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	460-UNIMOD:21,834-UNIMOD:21,539-UNIMOD:21,552-UNIMOD:21,72-UNIMOD:21	0.10	24.0	4	4	4
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	294-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	460-UNIMOD:21,463-UNIMOD:21	0.03	24.0	5	1	0
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	142-UNIMOD:21	0.10	24.0	2	1	0
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	285-UNIMOD:21,332-UNIMOD:21,259-UNIMOD:21	0.09	24.0	3	3	3
PRT	sp|P32322|P5CR1_HUMAN	Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	294-UNIMOD:21,301-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	248-UNIMOD:21,253-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	158-UNIMOD:21,145-UNIMOD:28	0.11	24.0	3	2	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	780-UNIMOD:21,785-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	244-UNIMOD:21,249-UNIMOD:21,133-UNIMOD:21	0.10	24.0	3	2	1
PRT	sp|P00533|EGFR_HUMAN	Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1057-UNIMOD:21,1058-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P0C1Z6|TFPT_HUMAN	TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	249-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	100-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	292-UNIMOD:4,303-UNIMOD:21,185-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|P08651|NFIC_HUMAN	Nuclear factor 1 C-type OS=Homo sapiens OX=9606 GN=NFIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	323-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9HCN4|GPN1_HUMAN	GPN-loop GTPase 1 OS=Homo sapiens OX=9606 GN=GPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	314-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|O15014|ZN609_HUMAN	Zinc finger protein 609 OS=Homo sapiens OX=9606 GN=ZNF609 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	804-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1029-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	52-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|O15446|RPA34_HUMAN	DNA-directed RNA polymerase I subunit RPA34 OS=Homo sapiens OX=9606 GN=CD3EAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	285-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q6UUV7|CRTC3_HUMAN	CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	412-UNIMOD:21,411-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	607-UNIMOD:21,403-UNIMOD:21,296-UNIMOD:21,404-UNIMOD:21,408-UNIMOD:21	0.11	24.0	7	4	2
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	49-UNIMOD:21,242-UNIMOD:21,256-UNIMOD:21,247-UNIMOD:21	0.17	24.0	5	2	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	248-UNIMOD:21	0.10	24.0	3	1	0
PRT	sp|O15371|EIF3D_HUMAN	Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens OX=9606 GN=EIF3D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	308-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|O15400|STX7_HUMAN	Syntaxin-7 OS=Homo sapiens OX=9606 GN=STX7 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,4-UNIMOD:21,79-UNIMOD:21	0.12	24.0	2	2	2
PRT	sp|P78344|IF4G2_HUMAN	Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens OX=9606 GN=EIF4G2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1,3-UNIMOD:21,32-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	233-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	270-UNIMOD:21	0.06	23.0	2	1	0
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	85-UNIMOD:21	0.05	23.0	3	2	1
PRT	sp|Q8N8S7|ENAH_HUMAN	Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	481-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|O00115|DNS2A_HUMAN	Deoxyribonuclease-2-alpha OS=Homo sapiens OX=9606 GN=DNASE2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	70-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	207-UNIMOD:21,212-UNIMOD:4,2198-UNIMOD:21,2202-UNIMOD:4,827-UNIMOD:21,831-UNIMOD:21	0.02	23.0	5	3	2
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	55-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	370-UNIMOD:21	0.10	23.0	10	6	3
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	39-UNIMOD:21,36-UNIMOD:21,53-UNIMOD:21,49-UNIMOD:21	0.43	23.0	6	2	1
PRT	sp|Q96S66|CLCC1_HUMAN	Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	438-UNIMOD:21,55-UNIMOD:21,60-UNIMOD:4,67-UNIMOD:4	0.06	23.0	2	2	2
PRT	sp|P55327|TPD52_HUMAN	Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	171-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	200-UNIMOD:21,199-UNIMOD:21	0.11	23.0	3	2	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	490-UNIMOD:21,362-UNIMOD:21	0.04	23.0	2	2	2
PRT	sp|Q07020|RL18_HUMAN	60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	158-UNIMOD:21,130-UNIMOD:21	0.15	23.0	2	2	2
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	198-UNIMOD:21,341-UNIMOD:21,201-UNIMOD:21,259-UNIMOD:21,225-UNIMOD:21,193-UNIMOD:35,344-UNIMOD:21,199-UNIMOD:21	0.28	23.0	10	5	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	9-UNIMOD:21	0.13	23.0	1	1	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1094-UNIMOD:21,1088-UNIMOD:35	0.01	23.0	2	1	0
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	187-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9Y6G9|DC1L1_HUMAN	Cytoplasmic dynein 1 light intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1LI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	512-UNIMOD:21,516-UNIMOD:21,515-UNIMOD:21,518-UNIMOD:21,513-UNIMOD:21	0.04	23.0	5	2	1
PRT	sp|Q96EK9|KTI12_HUMAN	Protein KTI12 homolog OS=Homo sapiens OX=9606 GN=KTI12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	184-UNIMOD:21,189-UNIMOD:21	0.06	23.0	2	1	0
PRT	sp|P35658|NU214_HUMAN	Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	434-UNIMOD:21,437-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	296-UNIMOD:4,313-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	301-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	47-UNIMOD:21,221-UNIMOD:21	0.15	23.0	4	2	1
PRT	sp|Q8WWC4|MAIP1_HUMAN	m-AAA protease-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=MAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	262-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	226-UNIMOD:21,229-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	385-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O95197|RTN3_HUMAN	Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	246-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	215-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	325-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	509-UNIMOD:21,513-UNIMOD:4,1113-UNIMOD:21,1114-UNIMOD:21,1430-UNIMOD:21,1094-UNIMOD:21,1101-UNIMOD:21,265-UNIMOD:21	0.05	23.0	6	5	4
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	111-UNIMOD:21,120-UNIMOD:4,107-UNIMOD:28	0.03	23.0	4	1	0
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	2083-UNIMOD:21,2054-UNIMOD:21,569-UNIMOD:21,125-UNIMOD:21,129-UNIMOD:21	0.03	23.0	6	4	2
PRT	sp|Q8TAQ2|SMRC2_HUMAN	SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	347-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9H4M9|EHD1_HUMAN	EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	456-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	115-UNIMOD:21,119-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	62-UNIMOD:4,65-UNIMOD:21,60-UNIMOD:35,77-UNIMOD:21	0.34	22.0	3	2	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	248-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P05997|CO5A2_HUMAN	Collagen alpha-2(V) chain OS=Homo sapiens OX=9606 GN=COL5A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1284-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	265-UNIMOD:21,281-UNIMOD:21,279-UNIMOD:21	0.07	22.0	5	2	0
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2138-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	91-UNIMOD:21,253-UNIMOD:21	0.06	22.0	3	2	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	973-UNIMOD:21,1117-UNIMOD:21	0.04	22.0	3	2	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	2	2	2
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	52-UNIMOD:21,50-UNIMOD:21	0.04	22.0	3	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	20-UNIMOD:21,23-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	94-UNIMOD:21,82-UNIMOD:21	0.06	22.0	4	2	0
PRT	sp|Q13045|FLII_HUMAN	Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	856-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	301-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	56-UNIMOD:21	0.07	22.0	2	2	2
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	792-UNIMOD:21,776-UNIMOD:35,779-UNIMOD:21,1980-UNIMOD:21,2105-UNIMOD:21	0.02	22.0	4	4	4
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	400-UNIMOD:21,575-UNIMOD:21	0.06	22.0	3	2	1
PRT	sp|Q9BX68|HINT2_HUMAN	Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=HINT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	47-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	862-UNIMOD:21,864-UNIMOD:21,1319-UNIMOD:21,673-UNIMOD:21,675-UNIMOD:4,865-UNIMOD:21	0.03	22.0	4	3	2
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	143-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	273-UNIMOD:21,270-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	473-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	241-UNIMOD:4,242-UNIMOD:21,243-UNIMOD:21,419-UNIMOD:21	0.09	22.0	3	3	3
PRT	sp|P04920|B3A2_HUMAN	Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	118-UNIMOD:21,144-UNIMOD:21,148-UNIMOD:21,173-UNIMOD:21	0.06	22.0	3	3	3
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	73-UNIMOD:21,36-UNIMOD:21,45-UNIMOD:21	0.13	22.0	2	2	2
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	333-UNIMOD:21	0.03	22.0	3	1	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	297-UNIMOD:21,300-UNIMOD:21	0.02	22.0	3	1	0
PRT	sp|O95359|TACC2_HUMAN	Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2246-UNIMOD:21,2256-UNIMOD:21,2317-UNIMOD:21,2321-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	30-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13310|PABP4_HUMAN	Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	315-UNIMOD:21,322-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	242-UNIMOD:21,249-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q7Z434|MAVS_HUMAN	Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	222-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	115-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	9-UNIMOD:21	0.15	22.0	1	1	1
PRT	sp|P13804|ETFA_HUMAN	Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	192-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	2155-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	7-UNIMOD:21	0.18	22.0	1	1	1
PRT	sp|O94855|SC24D_HUMAN	Protein transport protein Sec24D OS=Homo sapiens OX=9606 GN=SEC24D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	266-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	90-UNIMOD:21,204-UNIMOD:21,206-UNIMOD:4	0.16	22.0	4	3	2
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	414-UNIMOD:21,412-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	83-UNIMOD:21,154-UNIMOD:21,53-UNIMOD:4	0.27	22.0	3	3	3
PRT	sp|P62877|RBX1_HUMAN	E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens OX=9606 GN=RBX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,9-UNIMOD:21	0.19	22.0	2	2	2
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	146-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	104-UNIMOD:21,232-UNIMOD:4,234-UNIMOD:21	0.10	21.0	4	3	2
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	305-UNIMOD:21,311-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	338-UNIMOD:21,6-UNIMOD:21,368-UNIMOD:21,261-UNIMOD:21	0.24	21.0	5	5	5
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	109-UNIMOD:21,455-UNIMOD:21	0.06	21.0	2	2	2
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1405-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	69-UNIMOD:21	0.09	21.0	2	1	0
PRT	sp|O75449|KTNA1_HUMAN	Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	170-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|O95466|FMNL1_HUMAN	Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1031-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	1453-UNIMOD:4,1459-UNIMOD:21,2319-UNIMOD:21,2327-UNIMOD:21,1453-UNIMOD:385,2032-UNIMOD:21	0.02	21.0	5	3	1
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	370-UNIMOD:21,344-UNIMOD:21,394-UNIMOD:21,382-UNIMOD:35,395-UNIMOD:21,387-UNIMOD:21,384-UNIMOD:21	0.13	21.0	7	4	3
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	110-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q9UPQ9|TNR6B_HUMAN	Trinucleotide repeat-containing gene 6B protein OS=Homo sapiens OX=9606 GN=TNRC6B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	385-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	263-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q9NTJ3|SMC4_HUMAN	Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	22-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q96BD0|SO4A1_HUMAN	Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	37-UNIMOD:21,40-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	21.0	2	2	2
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	125-UNIMOD:21	0.10	21.0	2	1	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1264-UNIMOD:21,1268-UNIMOD:21,1255-UNIMOD:21,399-UNIMOD:21	0.04	21.0	6	3	1
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	149-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|O95299|NDUAA_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFA10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	340-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	460-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	217-UNIMOD:21,213-UNIMOD:21,216-UNIMOD:21	0.02	21.0	3	1	0
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	523-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	293-UNIMOD:21,208-UNIMOD:21	0.08	21.0	2	2	2
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1314-UNIMOD:21,1316-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|O15439|MRP4_HUMAN	Multidrug resistance-associated protein 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	646-UNIMOD:21	0.01	21.0	2	2	2
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	519-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	46-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	68-UNIMOD:21,65-UNIMOD:21,63-UNIMOD:21	0.02	21.0	3	1	0
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	583-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	234-UNIMOD:21,232-UNIMOD:21,394-UNIMOD:21	0.12	21.0	6	5	4
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	173-UNIMOD:4,183-UNIMOD:21	0.16	21.0	2	2	2
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	120-UNIMOD:21	0.06	21.0	2	1	0
PRT	sp|Q86X55|CARM1_HUMAN	Histone-arginine methyltransferase CARM1 OS=Homo sapiens OX=9606 GN=CARM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	463-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1294-UNIMOD:21,2728-UNIMOD:21,1677-UNIMOD:4,1682-UNIMOD:21	0.01	21.0	3	3	3
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	256-UNIMOD:4,258-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|Q96T76|MMS19_HUMAN	MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1027-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|O60831|PRAF2_HUMAN	PRA1 family protein 2 OS=Homo sapiens OX=9606 GN=PRAF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	19-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	198-UNIMOD:21,1117-UNIMOD:21,1231-UNIMOD:21	0.03	21.0	7	3	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	688-UNIMOD:21,255-UNIMOD:21	0.04	21.0	3	2	1
PRT	sp|P52569|CTR2_HUMAN	Cationic amino acid transporter 2 OS=Homo sapiens OX=9606 GN=SLC7A2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	647-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q13405|RM49_HUMAN	39S ribosomal protein L49, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	129-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q6VY07|PACS1_HUMAN	Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens OX=9606 GN=PACS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	430-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1721-UNIMOD:21,1724-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P20339|RAB5A_HUMAN	Ras-related protein Rab-5A OS=Homo sapiens OX=9606 GN=RAB5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	123-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	2169-UNIMOD:4,2172-UNIMOD:21,2176-UNIMOD:21,2161-UNIMOD:21,1616-UNIMOD:21,1619-UNIMOD:4	0.02	21.0	3	3	3
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	345-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	179-UNIMOD:21,183-UNIMOD:21,182-UNIMOD:21,303-UNIMOD:21,308-UNIMOD:21,270-UNIMOD:21,274-UNIMOD:21,259-UNIMOD:21,267-UNIMOD:21,344-UNIMOD:21	0.15	21.0	10	5	3
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	939-UNIMOD:21,946-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	471-UNIMOD:21,475-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H4X1|RGCC_HUMAN	Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	101-UNIMOD:21,107-UNIMOD:21	0.15	21.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	89-UNIMOD:21	0.17	21.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1299-UNIMOD:21,1302-UNIMOD:4,146-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	103-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q99598|TSNAX_HUMAN	Translin-associated protein X OS=Homo sapiens OX=9606 GN=TSNAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	33-UNIMOD:21,36-UNIMOD:35,165-UNIMOD:21	0.13	21.0	4	2	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	36-UNIMOD:4,38-UNIMOD:21,36-UNIMOD:385	0.06	20.0	3	1	0
PRT	sp|P08174|DAF_HUMAN	Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	98-UNIMOD:4,106-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	87-UNIMOD:21,70-UNIMOD:21,76-UNIMOD:21	0.12	20.0	4	3	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	47-UNIMOD:4,177-UNIMOD:21,44-UNIMOD:21,91-UNIMOD:4	0.24	20.0	4	3	2
PRT	sp|P37275|ZEB1_HUMAN	Zinc finger E-box-binding homeobox 1 OS=Homo sapiens OX=9606 GN=ZEB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	645-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	738-UNIMOD:21,734-UNIMOD:21	0.02	20.0	4	1	0
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	461-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	330-UNIMOD:35	0.03	20.0	2	1	0
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	700-UNIMOD:21,708-UNIMOD:4,662-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|Q6UW78|UQCC3_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 3 OS=Homo sapiens OX=9606 GN=UQCC3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	81-UNIMOD:35,92-UNIMOD:21	0.17	20.0	3	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	51-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	173-UNIMOD:4,177-UNIMOD:21,194-UNIMOD:4	0.10	20.0	1	1	1
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	17-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	201-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	211-UNIMOD:21	0.09	20.0	2	2	2
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	269-UNIMOD:21,272-UNIMOD:21,266-UNIMOD:21	0.04	20.0	2	2	2
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	20.0	2	1	0
PRT	sp|O60784|TOM1_HUMAN	Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	462-UNIMOD:21,461-UNIMOD:21,473-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|P40763|STAT3_HUMAN	Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	687-UNIMOD:4,701-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q53EZ4|CEP55_HUMAN	Centrosomal protein of 55 kDa OS=Homo sapiens OX=9606 GN=CEP55 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	425-UNIMOD:21,428-UNIMOD:21,440-UNIMOD:4,430-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	360-UNIMOD:4,362-UNIMOD:21,366-UNIMOD:4,81-UNIMOD:21	0.12	20.0	4	4	4
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	608-UNIMOD:21,249-UNIMOD:21,902-UNIMOD:21	0.05	20.0	3	3	3
PRT	sp|Q8IWS0-2|PHF6_HUMAN	Isoform 2 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	156-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	529-UNIMOD:21,174-UNIMOD:4,175-UNIMOD:21	0.03	20.0	2	2	2
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	144-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	164-UNIMOD:21,166-UNIMOD:4,95-UNIMOD:21,99-UNIMOD:21	0.13	20.0	2	2	2
PRT	sp|Q9BTL3|RAMAC_HUMAN	RNA guanine-N7 methyltransferase activating subunit OS=Homo sapiens OX=9606 GN=RAMAC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	36-UNIMOD:21	0.14	20.0	1	1	1
PRT	sp|Q00587|BORG5_HUMAN	Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	106-UNIMOD:21,113-UNIMOD:21,99-UNIMOD:35	0.05	20.0	3	1	0
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	239-UNIMOD:21,241-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96KB5|TOPK_HUMAN	Lymphokine-activated killer T-cell-originated protein kinase OS=Homo sapiens OX=9606 GN=PBK PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	22-UNIMOD:4,26-UNIMOD:21,32-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P42224|STAT1_HUMAN	Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	727-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9BYC8|RM32_HUMAN	39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	164-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	617-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	151-UNIMOD:21	0.13	20.0	1	1	1
PRT	sp|Q93015-2|NAA80_HUMAN	Isoform 2 of N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1,7-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	201-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P17980|PRS6A_HUMAN	26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:21,12-UNIMOD:21	0.04	20.0	3	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	71-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P54819|KAD2_HUMAN	Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	89-UNIMOD:21,92-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P31153|METK2_HUMAN	S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	374-UNIMOD:21,247-UNIMOD:21	0.07	19.0	2	2	2
PRT	sp|Q8TC07|TBC15_HUMAN	TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	675-UNIMOD:21,686-UNIMOD:4,689-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	224-UNIMOD:21	0.06	19.0	2	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	76-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	226-UNIMOD:21,275-UNIMOD:21,292-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|P08237|PFKAM_HUMAN	ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	667-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	21-UNIMOD:21,2-UNIMOD:1,150-UNIMOD:21	0.21	19.0	6	4	2
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	19.0	null	173-UNIMOD:21	0.01	19.0	3	1	0
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	55-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	101-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	178-UNIMOD:21,181-UNIMOD:21	0.00	19.0	4	1	0
PRT	sp|Q5THK1|PR14L_HUMAN	Protein PRR14L OS=Homo sapiens OX=9606 GN=PRR14L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1027-UNIMOD:4,1029-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	171-UNIMOD:4,181-UNIMOD:21	0.05	19.0	3	2	1
PRT	sp|Q8N357|S35F6_HUMAN	Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	363-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	376-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	422-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	779-UNIMOD:4,780-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	117-UNIMOD:21,427-UNIMOD:21,432-UNIMOD:21	0.05	19.0	2	2	2
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	110-UNIMOD:21,105-UNIMOD:21,130-UNIMOD:4	0.18	19.0	3	2	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.18	19.0	2	1	0
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	269-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2000-UNIMOD:21,1830-UNIMOD:21,1757-UNIMOD:21	0.03	19.0	3	3	3
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	144-UNIMOD:21,150-UNIMOD:21	0.07	19.0	2	1	0
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	163-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	97-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q92879|CELF1_HUMAN	CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	177-UNIMOD:4,179-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P18850|ATF6A_HUMAN	Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	94-UNIMOD:21,104-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q92804|RBP56_HUMAN	TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	295-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	106-UNIMOD:21	0.02	19.0	3	2	1
PRT	sp|Q9BZE2|PUS3_HUMAN	tRNA pseudouridine(38/39) synthase OS=Homo sapiens OX=9606 GN=PUS3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	453-UNIMOD:4,466-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q15311|RBP1_HUMAN	RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	101-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1727-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	143-UNIMOD:21,176-UNIMOD:21	0.10	19.0	3	3	3
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	300-UNIMOD:21	0.06	19.0	2	2	2
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	274-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	127-UNIMOD:21	0.09	19.0	2	1	0
PRT	sp|Q9C0E8|LNP_HUMAN	Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	182-UNIMOD:21,194-UNIMOD:21,179-UNIMOD:21	0.06	19.0	2	1	0
PRT	sp|O14773|TPP1_HUMAN	Tripeptidyl-peptidase 1 OS=Homo sapiens OX=9606 GN=TPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	73-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	81-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	262-UNIMOD:21,669-UNIMOD:4,672-UNIMOD:21,681-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	115-UNIMOD:21,245-UNIMOD:21	0.09	19.0	2	2	2
PRT	sp|O95456|PSMG1_HUMAN	Proteasome assembly chaperone 1 OS=Homo sapiens OX=9606 GN=PSMG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	186-UNIMOD:21	0.05	19.0	3	1	0
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	411-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	97-UNIMOD:21,100-UNIMOD:4	0.08	19.0	1	1	1
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	275-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q7Z3T8|ZFY16_HUMAN	Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	939-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	624-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P54750|PDE1A_HUMAN	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	482-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P84095|RHOG_HUMAN	Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	44-UNIMOD:21,138-UNIMOD:21	0.20	19.0	2	2	2
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	73-UNIMOD:4,75-UNIMOD:21,79-UNIMOD:35,2-UNIMOD:1,9-UNIMOD:21,22-UNIMOD:4	0.30	19.0	2	2	2
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	113-UNIMOD:21,47-UNIMOD:21,80-UNIMOD:21	0.19	19.0	3	3	3
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1,4-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	27-UNIMOD:21	0.07	19.0	1	1	1
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	157-UNIMOD:21,159-UNIMOD:4	0.03	18.0	2	1	0
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	293-UNIMOD:21	0.05	18.0	2	2	2
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	413-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.26	18.0	3	3	3
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1037-UNIMOD:21,1038-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	955-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q14137|BOP1_HUMAN	Ribosome biogenesis protein BOP1 OS=Homo sapiens OX=9606 GN=BOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	106-UNIMOD:21,108-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	972-UNIMOD:4,974-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	119-UNIMOD:21	0.09	18.0	2	1	0
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	407-UNIMOD:21,272-UNIMOD:4,273-UNIMOD:21,378-UNIMOD:21	0.04	18.0	3	3	3
PRT	sp|Q86TM6|SYVN1_HUMAN	E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	613-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2889-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P10586|PTPRF_HUMAN	Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1000-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q99576-3|T22D3_HUMAN	Isoform 2 of TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	42-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	25-UNIMOD:21	0.15	18.0	3	2	1
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	50-UNIMOD:21,96-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1915-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	70-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1414-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	155-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|O43765|SGTA_HUMAN	Small glutamine-rich tetratricopeptide repeat-containing protein alpha OS=Homo sapiens OX=9606 GN=SGTA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	71-UNIMOD:35,77-UNIMOD:21,81-UNIMOD:21	0.08	18.0	3	1	0
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	191-UNIMOD:21,198-UNIMOD:21,53-UNIMOD:21	0.07	18.0	3	3	3
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	275-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P46087|NOP2_HUMAN	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NOP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	732-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q6PID6|TTC33_HUMAN	Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	197-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P28066|PSA5_HUMAN	Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	55-UNIMOD:21,172-UNIMOD:21	0.15	18.0	2	2	2
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	203-UNIMOD:4,210-UNIMOD:21,208-UNIMOD:21	0.06	18.0	2	1	0
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	56-UNIMOD:21	0.06	18.0	1	1	1
PRT	sp|P34897|GLYM_HUMAN	Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	412-UNIMOD:4,417-UNIMOD:21,420-UNIMOD:21,432-UNIMOD:21,90-UNIMOD:21,91-UNIMOD:4	0.08	18.0	5	4	3
PRT	sp|Q15007|FL2D_HUMAN	Pre-mRNA-splicing regulator WTAP OS=Homo sapiens OX=9606 GN=WTAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	306-UNIMOD:21,305-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	62-UNIMOD:4,64-UNIMOD:21,417-UNIMOD:4,420-UNIMOD:4	0.06	18.0	2	2	2
PRT	sp|P18827|SDC1_HUMAN	Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	233-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	149-UNIMOD:21,153-UNIMOD:21	0.07	18.0	2	1	0
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	317-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	108-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	129-UNIMOD:21	0.22	18.0	1	1	1
PRT	sp|Q96Q45|TM237_HUMAN	Transmembrane protein 237 OS=Homo sapiens OX=9606 GN=TMEM237 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	49-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q92890|UFD1_HUMAN	Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	129-UNIMOD:21,245-UNIMOD:21,247-UNIMOD:21	0.10	18.0	3	2	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	328-UNIMOD:35,330-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|P30307|MPIP3_HUMAN	M-phase inducer phosphatase 3 OS=Homo sapiens OX=9606 GN=CDC25C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	168-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	11-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O43633|CHM2A_HUMAN	Charged multivesicular body protein 2a OS=Homo sapiens OX=9606 GN=CHMP2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	203-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	147-UNIMOD:4,150-UNIMOD:21,151-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	1297-UNIMOD:4,1298-UNIMOD:21,1309-UNIMOD:21,1300-UNIMOD:21,1444-UNIMOD:28,1448-UNIMOD:21,496-UNIMOD:4,498-UNIMOD:4,502-UNIMOD:21	0.04	18.0	4	3	2
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	146-UNIMOD:21	0.17	18.0	2	2	2
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	614-UNIMOD:21,1064-UNIMOD:21,1065-UNIMOD:4,1057-UNIMOD:21,1112-UNIMOD:21,1107-UNIMOD:28,619-UNIMOD:21,209-UNIMOD:21	0.04	18.0	8	4	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1208-UNIMOD:21,1211-UNIMOD:21,1205-UNIMOD:21,1219-UNIMOD:21,1215-UNIMOD:21	0.02	18.0	3	1	0
PRT	sp|Q13158|FADD_HUMAN	FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	194-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|Q8N1Q1|CAH13_HUMAN	Carbonic anhydrase 13 OS=Homo sapiens OX=9606 GN=CA13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	30-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q92665|RT31_HUMAN	28S ribosomal protein S31, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS31 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	274-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	88-UNIMOD:21,93-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	842-UNIMOD:4,843-UNIMOD:21,853-UNIMOD:21,840-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	365-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q15773|MLF2_HUMAN	Myeloid leukemia factor 2 OS=Homo sapiens OX=9606 GN=MLF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	238-UNIMOD:21	0.06	18.0	3	2	1
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	46-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	275-UNIMOD:21,250-UNIMOD:4,256-UNIMOD:21	0.07	17.0	2	2	2
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	9-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	228-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	795-UNIMOD:21	0.01	17.0	2	1	0
PRT	sp|P17174|AATC_HUMAN	Aspartate aminotransferase, cytoplasmic OS=Homo sapiens OX=9606 GN=GOT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	93-UNIMOD:21	0.03	17.0	2	1	0
PRT	sp|Q8IYB8|SUV3_HUMAN	ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens OX=9606 GN=SUPV3L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	721-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P07686|HEXB_HUMAN	Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	307-UNIMOD:21,309-UNIMOD:4	0.02	17.0	2	1	0
PRT	sp|Q15771|RAB30_HUMAN	Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	185-UNIMOD:21	0.09	17.0	1	1	1
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	244-UNIMOD:21	0.03	17.0	3	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	154-UNIMOD:21	0.03	17.0	3	1	0
PRT	sp|Q9BUL5|PHF23_HUMAN	PHD finger protein 23 OS=Homo sapiens OX=9606 GN=PHF23 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	126-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q14BN4|SLMAP_HUMAN	Sarcolemmal membrane-associated protein OS=Homo sapiens OX=9606 GN=SLMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	452-UNIMOD:21,454-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|O75410|TACC1_HUMAN	Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	361-UNIMOD:21,267-UNIMOD:21,276-UNIMOD:21,275-UNIMOD:21	0.05	17.0	3	2	1
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	116-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9NW08|RPC2_HUMAN	DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	815-UNIMOD:4,816-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P07711|CATL1_HUMAN	Cathepsin L1 OS=Homo sapiens OX=9606 GN=CTSL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	322-UNIMOD:4,326-UNIMOD:21	0.05	17.0	2	1	0
PRT	sp|Q9UJZ1|STML2_HUMAN	Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	327-UNIMOD:21	0.05	17.0	2	1	0
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	193-UNIMOD:21,220-UNIMOD:21	0.06	17.0	3	2	1
PRT	sp|Q9H078|CLPB_HUMAN	Caseinolytic peptidase B protein homolog OS=Homo sapiens OX=9606 GN=CLPB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	663-UNIMOD:21,668-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	462-UNIMOD:21,428-UNIMOD:21	0.08	17.0	3	3	3
PRT	sp|P51991|ROA3_HUMAN	Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	364-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	389-UNIMOD:21,65-UNIMOD:21	0.08	17.0	2	2	2
PRT	sp|Q8NBR6|MINY2_HUMAN	Ubiquitin carboxyl-terminal hydrolase MINDY-2 OS=Homo sapiens OX=9606 GN=MINDY2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	94-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	13-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	57-UNIMOD:21	0.12	17.0	3	1	0
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	120-UNIMOD:21,134-UNIMOD:4	0.18	17.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	164-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	361-UNIMOD:21,364-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q99459|CDC5L_HUMAN	Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	385-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O60333|KIF1B_HUMAN	Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	649-UNIMOD:21,652-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	183-UNIMOD:21	0.06	17.0	2	2	2
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	188-UNIMOD:21,194-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	104-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q15155|NOMO1_HUMAN	Nodal modulator 1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	825-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	232-UNIMOD:21,224-UNIMOD:21,222-UNIMOD:28,177-UNIMOD:21	0.12	17.0	4	3	2
PRT	sp|Q7Z6M1|RABEK_HUMAN	Rab9 effector protein with kelch motifs OS=Homo sapiens OX=9606 GN=RABEPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	133-UNIMOD:21,137-UNIMOD:21,132-UNIMOD:21	0.04	17.0	3	1	0
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	280-UNIMOD:21,46-UNIMOD:21	0.08	17.0	2	2	2
PRT	sp|P56945|BCAR1_HUMAN	Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	18-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	196-UNIMOD:21	0.10	17.0	1	1	1
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	113-UNIMOD:4,115-UNIMOD:21	0.13	17.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	17.0	null	654-UNIMOD:21,336-UNIMOD:21	0.05	17.0	2	2	2
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	223-UNIMOD:21,235-UNIMOD:4,551-UNIMOD:21	0.02	17.0	2	2	2
PRT	sp|Q9Y6M5|ZNT1_HUMAN	Zinc transporter 1 OS=Homo sapiens OX=9606 GN=SLC30A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	466-UNIMOD:21,469-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q7Z5J4|RAI1_HUMAN	Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	683-UNIMOD:21,696-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	102-UNIMOD:21,223-UNIMOD:21	0.26	17.0	3	2	1
PRT	sp|Q9Y6Q9|NCOA3_HUMAN	Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	716-UNIMOD:4,728-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O00154-2|BACH_HUMAN	Isoform 2 of Cytosolic acyl coenzyme A thioester hydrolase OS=Homo sapiens OX=9606 GN=ACOT7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,8-UNIMOD:21,15-UNIMOD:4	0.07	17.0	2	1	0
PRT	sp|Q9Y5A9|YTHD2_HUMAN	YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	39-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	650-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P07919|QCR6_HUMAN	Cytochrome b-c1 complex subunit 6, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	53-UNIMOD:4,58-UNIMOD:21	0.13	16.0	1	1	1
PRT	sp|P49585|PCY1A_HUMAN	Choline-phosphate cytidylyltransferase A OS=Homo sapiens OX=9606 GN=PCYT1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	315-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	264-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P42892|ECE1_HUMAN	Endothelin-converting enzyme 1 OS=Homo sapiens OX=9606 GN=ECE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	733-UNIMOD:21,755-UNIMOD:4,759-UNIMOD:21,767-UNIMOD:4	0.05	16.0	3	3	3
PRT	sp|Q9NZB2|F120A_HUMAN	Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	991-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q96HC4|PDLI5_HUMAN	PDZ and LIM domain protein 5 OS=Homo sapiens OX=9606 GN=PDLIM5 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	111-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9UMX5|NENF_HUMAN	Neudesin OS=Homo sapiens OX=9606 GN=NENF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	77-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	549-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	488-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	295-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q08357|S20A2_HUMAN	Sodium-dependent phosphate transporter 2 OS=Homo sapiens OX=9606 GN=SLC20A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	268-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	193-UNIMOD:21,182-UNIMOD:21	0.03	16.0	2	2	2
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	97-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	317-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	116-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9Y6I9|TX264_HUMAN	Testis-expressed protein 264 OS=Homo sapiens OX=9606 GN=TEX264 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	244-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q16875|F263_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	467-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	85-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	196-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1942-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9NYB0|TE2IP_HUMAN	Telomeric repeat-binding factor 2-interacting protein 1 OS=Homo sapiens OX=9606 GN=TERF2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	203-UNIMOD:21,206-UNIMOD:21	0.04	16.0	2	1	0
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	819-UNIMOD:21,823-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	240-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q96PC5|MIA2_HUMAN	Melanoma inhibitory activity protein 2 OS=Homo sapiens OX=9606 GN=MIA2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1236-UNIMOD:4,1239-UNIMOD:21,1243-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9UBK8|MTRR_HUMAN	Methionine synthase reductase OS=Homo sapiens OX=9606 GN=MTRR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	171-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	16.0	3	2	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	720-UNIMOD:21,47-UNIMOD:21,53-UNIMOD:4	0.05	16.0	2	2	2
PRT	sp|Q9NVA1|UQCC1_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 1 OS=Homo sapiens OX=9606 GN=UQCC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	294-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|Q02218|ODO1_HUMAN	2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	95-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|O95628|CNOT4_HUMAN	CCR4-NOT transcription complex subunit 4 OS=Homo sapiens OX=9606 GN=CNOT4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	430-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	47-UNIMOD:21	0.13	16.0	1	1	1
PRT	sp|O95067|CCNB2_HUMAN	G2/mitotic-specific cyclin-B2 OS=Homo sapiens OX=9606 GN=CCNB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	392-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	119-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	9-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	190-UNIMOD:21,194-UNIMOD:4	0.07	16.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P62191|PRS4_HUMAN	26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	434-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1670-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q14320|FA50A_HUMAN	Protein FAM50A OS=Homo sapiens OX=9606 GN=FAM50A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	64-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1697-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	190-UNIMOD:21,186-UNIMOD:35,193-UNIMOD:21	0.03	16.0	2	1	0
PRT	sp|Q9BW91|NUDT9_HUMAN	ADP-ribose pyrophosphatase, mitochondrial OS=Homo sapiens OX=9606 GN=NUDT9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	118-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P49721|PSB2_HUMAN	Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	76-UNIMOD:21	0.08	16.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	2249-UNIMOD:4,2260-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	26-UNIMOD:21,30-UNIMOD:21,189-UNIMOD:21	0.03	16.0	3	2	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9Y6M9|NDUB9_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens OX=9606 GN=NDUFB9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	85-UNIMOD:21	0.11	16.0	1	1	1
PRT	sp|Q96QU8|XPO6_HUMAN	Exportin-6 OS=Homo sapiens OX=9606 GN=XPO6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	204-UNIMOD:21,210-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	16.0	1	1	1
PRT	sp|Q01433|AMPD2_HUMAN	AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	97-UNIMOD:21	0.01	16.0	2	1	0
PRT	sp|P15336|ATF2_HUMAN	Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	69-UNIMOD:21,71-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9BVC5|ASHWN_HUMAN	Ashwin OS=Homo sapiens OX=9606 GN=C2orf49 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	184-UNIMOD:21,193-UNIMOD:21	0.09	16.0	1	1	1
PRT	sp|Q8NHM5|KDM2B_HUMAN	Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	221-UNIMOD:35,223-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	172-UNIMOD:21,174-UNIMOD:21	0.10	16.0	1	1	1
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	107-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P53634|CATC_HUMAN	Dipeptidyl peptidase 1 OS=Homo sapiens OX=9606 GN=CTSC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	136-UNIMOD:4,138-UNIMOD:21,448-UNIMOD:4,458-UNIMOD:21	0.06	15.0	2	2	2
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.08	15.0	1	1	1
PRT	sp|P27144|KAD4_HUMAN	Adenylate kinase 4, mitochondrial OS=Homo sapiens OX=9606 GN=AK4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	16-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	534-UNIMOD:21,437-UNIMOD:21	0.05	15.0	3	2	1
PRT	sp|Q92871|PMM1_HUMAN	Phosphomannomutase 1 OS=Homo sapiens OX=9606 GN=PMM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	239-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	18-UNIMOD:21,24-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	303-UNIMOD:21	0.03	15.0	2	1	0
PRT	sp|O75822|EIF3J_HUMAN	Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	109-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	265-UNIMOD:21,269-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8TCS8|PNPT1_HUMAN	Polyribonucleotide nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PNPT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	754-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	218-UNIMOD:21,227-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	34-UNIMOD:21,37-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O43572|AKA10_HUMAN	A-kinase anchor protein 10, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	187-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	246-UNIMOD:21,248-UNIMOD:21	0.02	15.0	2	1	0
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	332-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q7KZI7-2|MARK2_HUMAN	Isoform 2 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	482-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	135-UNIMOD:21	0.10	15.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	17-UNIMOD:21	0.14	15.0	1	1	1
PRT	sp|Q96EE3|SEH1_HUMAN	Nucleoporin SEH1 OS=Homo sapiens OX=9606 GN=SEH1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	179-UNIMOD:21,190-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	83-UNIMOD:21	0.13	15.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	159-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|O00429|DNM1L_HUMAN	Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	616-UNIMOD:21,586-UNIMOD:21	0.05	15.0	2	2	2
PRT	sp|P15559|NQO1_HUMAN	NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	82-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	774-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q01804|OTUD4_HUMAN	OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1006-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q13637|RAB32_HUMAN	Ras-related protein Rab-32 OS=Homo sapiens OX=9606 GN=RAB32 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	154-UNIMOD:21,162-UNIMOD:4	0.07	15.0	1	1	1
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	803-UNIMOD:21,308-UNIMOD:21,311-UNIMOD:21,326-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|P25054|APC_HUMAN	Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	2676-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	731-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P40855|PEX19_HUMAN	Peroxisomal biogenesis factor 19 OS=Homo sapiens OX=9606 GN=PEX19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	35-UNIMOD:21	0.07	15.0	1	1	1
PRT	sp|Q9UJF2|NGAP_HUMAN	Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	954-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	658-UNIMOD:4,660-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	38-UNIMOD:21	0.07	15.0	2	2	2
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	715-UNIMOD:4,718-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P49116|NR2C2_HUMAN	Nuclear receptor subfamily 2 group C member 2 OS=Homo sapiens OX=9606 GN=NR2C2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	219-UNIMOD:21,224-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P04181|OAT_HUMAN	Ornithine aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=OAT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	39-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	260-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q8WU79|SMAP2_HUMAN	Stromal membrane-associated protein 2 OS=Homo sapiens OX=9606 GN=SMAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	219-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	628-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	43-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P51610|HCFC1_HUMAN	Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1205-UNIMOD:21,1216-UNIMOD:21	0.01	15.0	2	2	2
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	128-UNIMOD:21,140-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	237-UNIMOD:4,238-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|Q14012|KCC1A_HUMAN	Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	354-UNIMOD:4,355-UNIMOD:4,363-UNIMOD:21	0.05	15.0	1	1	1
PRT	sp|Q92585|MAML1_HUMAN	Mastermind-like protein 1 OS=Homo sapiens OX=9606 GN=MAML1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	314-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P42702|LIFR_HUMAN	Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1059-UNIMOD:21,1061-UNIMOD:4,903-UNIMOD:4,904-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|Q9UQR1|ZN148_HUMAN	Zinc finger protein 148 OS=Homo sapiens OX=9606 GN=ZNF148 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	412-UNIMOD:21,784-UNIMOD:21	0.05	15.0	2	2	2
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	62-UNIMOD:21,67-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1492-UNIMOD:21,1494-UNIMOD:21	0.02	15.0	2	1	0
PRT	sp|Q04760|LGUL_HUMAN	Lactoylglutathione lyase OS=Homo sapiens OX=9606 GN=GLO1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,8-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4	0.15	15.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	630-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P41440|S19A1_HUMAN	Reduced folate transporter OS=Homo sapiens OX=9606 GN=SLC19A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	1-UNIMOD:1,5-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,12-UNIMOD:21	0.01	15.0	2	1	0
PRT	sp|Q9UM00|TMCO1_HUMAN	Calcium load-activated calcium channel OS=Homo sapiens OX=9606 GN=TMCO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	224-UNIMOD:28,235-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|O14929|HAT1_HUMAN	Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	361-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	168-UNIMOD:21	0.06	14.0	2	2	2
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	545-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	220-UNIMOD:21,370-UNIMOD:21	0.06	14.0	2	2	2
PRT	sp|Q7L8L6|FAKD5_HUMAN	FAST kinase domain-containing protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=FASTKD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	95-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q96D46|NMD3_HUMAN	60S ribosomal export protein NMD3 OS=Homo sapiens OX=9606 GN=NMD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	256-UNIMOD:4,258-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1713-UNIMOD:21	0.02	14.0	2	2	2
PRT	sp|P11171|41_HUMAN	Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	712-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	61-UNIMOD:21	0.03	14.0	3	1	0
PRT	sp|P56385|ATP5I_HUMAN	ATP synthase subunit e, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5ME PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	66-UNIMOD:21	0.16	14.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	793-UNIMOD:21	0.01	14.0	2	1	0
PRT	sp|Q9NWT8|AKIP_HUMAN	Aurora kinase A-interacting protein OS=Homo sapiens OX=9606 GN=AURKAIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	191-UNIMOD:21	0.06	14.0	2	1	0
PRT	sp|Q69YN4|VIR_HUMAN	Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1579-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9NYL2|M3K20_HUMAN	Mitogen-activated protein kinase kinase kinase 20 OS=Homo sapiens OX=9606 GN=MAP3K20 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	636-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P62333|PRS10_HUMAN	26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	170-UNIMOD:4,178-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	268-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|Q6IN85|P4R3A_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	737-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q6VMQ6|MCAF1_HUMAN	Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	109-UNIMOD:4,113-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9UMZ2|SYNRG_HUMAN	Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	null	580-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1047-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9Y6Y0|NS1BP_HUMAN	Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	274-UNIMOD:4,277-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	508-UNIMOD:4,512-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	410-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9NXH9|TRM1_HUMAN	tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens OX=9606 GN=TRMT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	614-UNIMOD:4,620-UNIMOD:4,621-UNIMOD:4,628-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	60-UNIMOD:21	0.10	14.0	1	1	1
PRT	sp|O00180|KCNK1_HUMAN	Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	329-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	153-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q5T6F2|UBAP2_HUMAN	Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	432-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	287-UNIMOD:21	0.02	14.0	2	1	0
PRT	sp|Q8WUD4|CCD12_HUMAN	Coiled-coil domain-containing protein 12 OS=Homo sapiens OX=9606 GN=CCDC12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	152-UNIMOD:21	0.11	14.0	1	1	1
PRT	sp|Q5T1V6|DDX59_HUMAN	Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	156-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	623-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q08AM6|VAC14_HUMAN	Protein VAC14 homolog OS=Homo sapiens OX=9606 GN=VAC14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	11-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	89-UNIMOD:21	0.14	14.0	1	1	1
PRT	sp|Q9Y4F1|FARP1_HUMAN	FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	510-UNIMOD:21,514-UNIMOD:21,522-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q9BSY4|CHCH5_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 5 OS=Homo sapiens OX=9606 GN=CHCHD5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	89-UNIMOD:4,101-UNIMOD:21	0.24	14.0	1	1	1
PRT	sp|P84157|MXRA7_HUMAN	Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	127-UNIMOD:21	0.15	14.0	1	1	1
PRT	sp|Q6ZRI6|CO039_HUMAN	Uncharacterized protein C15orf39 OS=Homo sapiens OX=9606 GN=C15orf39 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	299-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|O43598|DNPH1_HUMAN	2'-deoxynucleoside 5'-phosphate N-hydrolase 1 OS=Homo sapiens OX=9606 GN=DNPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	169-UNIMOD:21	0.11	14.0	1	1	1
PRT	sp|Q16881|TRXR1_HUMAN	Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TXNRD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	413-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	508-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q5T8D3-2|ACBD5_HUMAN	Isoform 2 of Acyl-CoA-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ACBD5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	137-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	533-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q14694|UBP10_HUMAN	Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	209-UNIMOD:4,226-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	14.0	null	209-UNIMOD:21,257-UNIMOD:21	0.14	14.0	2	2	2
PRT	sp|Q8WWH5|TRUB1_HUMAN	Probable tRNA pseudouridine synthase 1 OS=Homo sapiens OX=9606 GN=TRUB1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,11-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,9-UNIMOD:21,24-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1-UNIMOD:1,7-UNIMOD:21,10-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	149-UNIMOD:21	0.08	14.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,3-UNIMOD:21,12-UNIMOD:4	0.08	14.0	1	1	1
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	1-UNIMOD:1,3-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P54136|SYRC_HUMAN	Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	103-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P18433|PTPRA_HUMAN	Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	384-UNIMOD:4,391-UNIMOD:35,392-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P05062|ALDOB_HUMAN	Fructose-bisphosphate aldolase B OS=Homo sapiens OX=9606 GN=ALDOB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	240-UNIMOD:4,241-UNIMOD:21,245-UNIMOD:21,255-UNIMOD:21	0.08	14.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	2	2	2
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	69-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	481-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	809-UNIMOD:21,557-UNIMOD:21	0.06	13.0	2	2	2
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	43-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	13-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|O95834|EMAL2_HUMAN	Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	590-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	178-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q9Y4P8|WIPI2_HUMAN	WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens OX=9606 GN=WIPI2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	413-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O96019|ACL6A_HUMAN	Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	86-UNIMOD:21,233-UNIMOD:21	0.06	13.0	2	2	2
PRT	sp|Q00341|VIGLN_HUMAN	Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1234-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q5VZ89|DEN4C_HUMAN	DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	975-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P60953|CDC42_HUMAN	Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	157-UNIMOD:4,158-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|P16278|BGAL_HUMAN	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	426-UNIMOD:4,434-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1213-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	48-UNIMOD:21,54-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9Y320|TMX2_HUMAN	Thioredoxin-related transmembrane protein 2 OS=Homo sapiens OX=9606 GN=TMX2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	282-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	14-UNIMOD:4,16-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q6ZW49|PAXI1_HUMAN	PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	235-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P78310|CXAR_HUMAN	Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	329-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	335-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	69-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	62-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|P17813|EGLN_HUMAN	Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	516-UNIMOD:4,521-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O95139|NDUB6_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 OS=Homo sapiens OX=9606 GN=NDUFB6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	29-UNIMOD:21	0.13	13.0	3	1	0
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	457-UNIMOD:4,459-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O94966-2|UBP19_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	202-UNIMOD:4,210-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	474-UNIMOD:21,479-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|P63173|RL38_HUMAN	60S ribosomal protein L38 OS=Homo sapiens OX=9606 GN=RPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	14-UNIMOD:21	0.11	13.0	1	1	1
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1310-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	103-UNIMOD:21	0.10	13.0	1	1	1
PRT	sp|Q9UJX2|CDC23_HUMAN	Cell division cycle protein 23 homolog OS=Homo sapiens OX=9606 GN=CDC23 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	596-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9Y519|T184B_HUMAN	Transmembrane protein 184B OS=Homo sapiens OX=9606 GN=TMEM184B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	403-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q8IYT4|KATL2_HUMAN	Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens OX=9606 GN=KATNAL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	298-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1079-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q8NFD5|ARI1B_HUMAN	AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	487-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P51149|RAB7A_HUMAN	Ras-related protein Rab-7a OS=Homo sapiens OX=9606 GN=RAB7A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	155-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q9HDC9|APMAP_HUMAN	Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	190-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9Y4W2|LAS1L_HUMAN	Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	504-UNIMOD:4,523-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	890-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9BVG9|PTSS2_HUMAN	Phosphatidylserine synthase 2 OS=Homo sapiens OX=9606 GN=PTDSS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	485-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	406-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9Y5Q8|TF3C5_HUMAN	General transcription factor 3C polypeptide 5 OS=Homo sapiens OX=9606 GN=GTF3C5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	200-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	523-UNIMOD:21,526-UNIMOD:4,528-UNIMOD:21,524-UNIMOD:21	0.02	13.0	2	1	0
PRT	sp|O00429-2|DNM1L_HUMAN	Isoform 4 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	575-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9BWT1|CDCA7_HUMAN	Cell division cycle-associated protein 7 OS=Homo sapiens OX=9606 GN=CDCA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null		0.05	13.0	1	1	1
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,3-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O60762|DPM1_HUMAN	Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,9-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	302-UNIMOD:35	0.05	13.0	1	1	1
PRT	sp|Q9Y680|FKBP7_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP7 OS=Homo sapiens OX=9606 GN=FKBP7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	210-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q8IVH4|MMAA_HUMAN	Methylmalonic aciduria type A protein, mitochondrial OS=Homo sapiens OX=9606 GN=MMAA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	197-UNIMOD:35,204-UNIMOD:35,207-UNIMOD:21,211-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	596-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|A6NI72|NCF1B_HUMAN	Putative neutrophil cytosol factor 1B OS=Homo sapiens OX=9606 GN=NCF1B PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	134-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q10571|MN1_HUMAN	Transcriptional activator MN1 OS=Homo sapiens OX=9606 GN=MN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1007-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|A6ND36|FA83G_HUMAN	Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	760-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	62-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	293-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	144-UNIMOD:21	0.09	12.0	1	1	1
PRT	sp|Q9NYZ3|GTSE1_HUMAN	G2 and S phase-expressed protein 1 OS=Homo sapiens OX=9606 GN=GTSE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	536-UNIMOD:21,539-UNIMOD:4	0.02	12.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	12.0	null	556-UNIMOD:21,243-UNIMOD:21,246-UNIMOD:4	0.02	12.0	2	2	2
PRT	sp|Q7KZI7|MARK2_HUMAN	Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	456-UNIMOD:21,619-UNIMOD:21	0.04	12.0	2	2	2
PRT	sp|P45983-2|MK08_HUMAN	Isoform 1 of Mitogen-activated protein kinase 8 OS=Homo sapiens OX=9606 GN=MAPK8	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	377-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	715-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q86VS8|HOOK3_HUMAN	Protein Hook homolog 3 OS=Homo sapiens OX=9606 GN=HOOK3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	238-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q6NVY1|HIBCH_HUMAN	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	356-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q92520|FAM3C_HUMAN	Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	194-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1001-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q5JTJ3|COA6_HUMAN	Cytochrome c oxidase assembly factor 6 homolog OS=Homo sapiens OX=9606 GN=COA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	125-UNIMOD:21	0.14	12.0	1	1	1
PRT	sp|Q9UHY1|NRBP_HUMAN	Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	524-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	24-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	71-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q68EM7|RHG17_HUMAN	Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	560-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|O95169|NDUB8_HUMAN	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFB8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	44-UNIMOD:21	0.08	12.0	1	1	1
PRT	sp|Q16643|DREB_HUMAN	Drebrin OS=Homo sapiens OX=9606 GN=DBN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	346-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	237-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	369-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	341-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.07	12.0	1	1	1
PRT	sp|Q9BUB5|MKNK1_HUMAN	MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MKNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	219-UNIMOD:4,221-UNIMOD:21,226-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	188-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.04	12.0	1	1	1
PRT	sp|P04150|GCR_HUMAN	Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	267-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q9NVS9|PNPO_HUMAN	Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	241-UNIMOD:21,247-UNIMOD:21	0.10	12.0	1	1	1
PRT	sp|Q96KP4|CNDP2_HUMAN	Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	439-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	296-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P17544-2|ATF7_HUMAN	Isoform 1 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	101-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|Q13895|BYST_HUMAN	Bystin OS=Homo sapiens OX=9606 GN=BYSL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	null	423-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	355-UNIMOD:21,363-UNIMOD:4	0.04	12.0	1	1	1
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	235-UNIMOD:21,238-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9H2V7|SPNS1_HUMAN	Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	2-UNIMOD:1,24-UNIMOD:21	0.07	12.0	1	1	1
PRT	sp|Q92567|F168A_HUMAN	Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	1-UNIMOD:1,6-UNIMOD:21	0.08	12.0	1	1	1
PRT	sp|P62873|GBB1_HUMAN	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens OX=9606 GN=GNB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	204-UNIMOD:4,207-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|O00178|GTPB1_HUMAN	GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	17-UNIMOD:21,25-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	683-UNIMOD:35,687-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	63-UNIMOD:21	0.08	12.0	1	1	1
PRT	sp|Q8NDV7|TNR6A_HUMAN	Trinucleotide repeat-containing gene 6A protein OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1044-UNIMOD:21,1047-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q05397|FAK1_HUMAN	Focal adhesion kinase 1 OS=Homo sapiens OX=9606 GN=PTK2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	910-UNIMOD:21,914-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	186-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|Q9ULD8|KCNH3_HUMAN	Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens OX=9606 GN=KCNH3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	812-UNIMOD:35,821-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q8N187|CARTF_HUMAN	Calcium-responsive transcription factor OS=Homo sapiens OX=9606 GN=CARF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	513-UNIMOD:35	0.03	12.0	1	1	1
PRT	sp|Q9HCD6|TANC2_HUMAN	Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	162-UNIMOD:4,169-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	330-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	2047-UNIMOD:21	0.00	12.0	1	1	1
PRT	sp|O15357|SHIP2_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	958-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|O75947|ATP5H_HUMAN	ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	39-UNIMOD:21	0.06	12.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	90-UNIMOD:21	0.06	12.0	1	1	1
PRT	sp|O95785|WIZ_HUMAN	Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1012-UNIMOD:21,1017-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1162-UNIMOD:21	0.00	12.0	1	1	1
PRT	sp|A6NCI8|CB078_HUMAN	Uncharacterized protein C2orf78 OS=Homo sapiens OX=9606 GN=C2orf78 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	818-UNIMOD:21,820-UNIMOD:4,830-UNIMOD:21,833-UNIMOD:21	0.02	12.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3746.4	37.7256	3	2508.0892	2508.0762	M	R	2	32
PSM	SQEGESVTEDISFLESPNPENK	2	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4182.3	48.86278	3	2515.077071	2515.063940	K	D	81	103
PSM	IADPEHDHTGFLTEYVATR	3	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	38.33192	3	2330.972171	2330.961009	R	W	190	209
PSM	AAAVAAAGAGEPQSPDELLPK	4	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	43.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4397.2	53.6736	3	2083.9919	2083.9822	M	G	2	23
PSM	APVQPQQSPAAAPGGTDEKPSGK	5	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3014.2	19.10003	4	2297.073294	2297.068906	K	E	9	32
PSM	SSSPAPADIAQTVQEDLR	6	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4250.2	50.58353	3	1963.899971	1963.888816	K	T	230	248
PSM	DNLTLWTSDMQGDGEEQNK	7	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.3981.2	43.80212	3	2179.938971	2179.932792	R	E	226	245
PSM	VPADTEVVCAPPTAYIDFAR	8	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4326.2	52.23563	3	2271.042671	2271.028287	K	Q	71	91
PSM	DNLTLWTSDTQGDEAEAGEGGEN	9	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.4073.3	46.12967	3	2408.002871	2407.988786	R	-	223	246
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	10	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3531.5	32.1731	3	2994.276071	2994.261530	K	A	106	138
PSM	DATNVGDEGGFAPNILENK	11	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.3950.2	42.99773	3	1959.924971	1959.917400	K	E	203	222
PSM	SSSPAPADIAQTVQEDLR	12	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4241.2	50.37503	3	1963.899971	1963.888816	K	T	230	248
PSM	SGSSSPDSEITELKFPSINHD	13	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4105.2	46.95907	3	2326.015271	2326.000217	R	-	571	592
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	14	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3703.6	36.61094	4	3265.418494	3265.402471	K	-	708	738
PSM	AAAVAAAGAGEPQSPDELLPK	15	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4413.2	53.8932	3	2083.9919	2083.9822	M	G	2	23
PSM	CIPALDSLTPANEDQK	16	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3805.3	39.22495	3	1850.814071	1850.812146	R	I	447	463
PSM	ILATPPQEDAPSVDIANIR	17	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4247.2	50.50985	3	2179.008371	2178.996332	K	M	284	303
PSM	VPPAPVPCPPPSPGPSAVPSSPK	18	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3737.6	37.4973	3	2378.088371	2378.078288	K	S	366	389
PSM	DDDIAALVVDNGSGMCK	19	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4674.2	57.94945	3	1900.7666	1900.7579	M	A	2	19
PSM	WLDDLLASPPPSGGGAR	20	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4771.2	59.0271	3	1867.796171	1867.790696	R	R	684	701
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	21	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.4110.3	47.07913	4	3013.356094	3013.339266	K	V	8	36
PSM	AAAVAAAGAGEPQSPDELLPK	22	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4378.2	53.25045	3	2083.9919	2083.9822	M	G	2	23
PSM	KPAAAAAPGTAEKLSPK	23	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3036.2	19.57895	3	1686.874571	1686.870587	K	A	23	40
PSM	GEPAAAAAPEAGASPVEK	24	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3178.4	23.05107	3	1701.764771	1701.761096	K	E	88	106
PSM	KPAAAAAPGTAEKLSPK	25	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3055.5	20.00732	3	1766.839571	1766.836918	K	A	23	40
PSM	NHSDSSTSESEVSSVSPLK	26	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3229.3	24.35797	3	2055.870371	2055.863389	K	N	211	230
PSM	WLDDLLASPPPSGGGAR	27	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4751.2	58.82102	3	1867.796171	1867.790696	R	R	684	701
PSM	VPPAPVPCPPPSPGPSAVPSSPK	28	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3745.4	37.69988	3	2378.088371	2378.078288	K	S	366	389
PSM	DYEIESQNPLASPTNTLLGSAK	29	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4391.5	53.56877	3	2427.134171	2427.120667	K	E	618	640
PSM	DNLTLWTSDSAGEECDAAEGAEN	30	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4107.5	47.01117	3	2453.991671	2453.976507	R	-	223	246
PSM	DDDIAALVVDNGSGMCK	31	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4414.2	53.91857	3	1916.7596	1916.7528	M	A	2	19
PSM	HQGVMVGMGQKDSYVGDEAQSK	32	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	27.00043	4	2430.036894	2430.034511	R	R	42	64
PSM	GKEDEGEEAASPMLQIQR	33	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3492.4	31.15217	3	2066.901371	2066.898001	K	D	2400	2418
PSM	IRYESLTDPSKLDSGK	34	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3469.2	30.56517	3	1887.902171	1887.897924	K	E	54	70
PSM	SGKYDLDFKSPDDPSR	35	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3409.3	29.01123	3	1905.818171	1905.814588	R	Y	254	270
PSM	DGARPDVTESESGSPEYR	36	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3155.6	22.462	3	2030.821871	2030.821859	K	Q	425	443
PSM	LYGSAGPPPTGEEDTAEKDEL	37	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3624.6	34.58832	3	2254.959671	2254.951870	K	-	634	655
PSM	VPADTEVVCAPPTAYIDFAR	38	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4316.2	52.0143	3	2271.042671	2271.028287	K	Q	71	91
PSM	EEEIAALVIDNGSGMCK	39	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5448.2	65.16527	3	1956.8282	1956.8205	M	A	2	19
PSM	AGAGSAAVSGAGTPVAGPTGR	40	sp|O95295|SNAPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	29.08597	3	1832.8460	1832.8413	M	D	2	23
PSM	KKPRPPPALGPEETSASAGLPK	41	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3305.2	26.30182	4	2307.1968941913206	2307.1987970448195	K	K	14	36
PSM	NGSLDSPGKQDTEEDEEEDEKDK	42	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2970.2	18.1491	4	2673.046094	2673.045055	K	G	134	157
PSM	KAEAGAGSATEFQFR	43	sp|Q9NQ39|RS10L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3433.2	29.63477	3	1648.724171	1648.724651	K	G	150	165
PSM	TPKTPKGPSSVEDIK	44	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3127.2	21.74377	3	1662.825671	1662.822968	K	A	234	249
PSM	FSEGVLQSPSQDQEK	45	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3439.4	29.79783	3	1757.753471	1757.750926	R	L	428	443
PSM	ADLNQGIGEPQSPSRR	46	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3181.3	23.1252	3	1803.831971	1803.826490	R	V	63	79
PSM	EFQDAGEQVVSSPADVAEK	47	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3600.2	33.9477	3	2084.897471	2084.893961	K	A	77	96
PSM	VTNGAFTGEISPGMIK	48	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3974.2	43.61632	3	1700.787671	1700.784474	K	D	107	123
PSM	VLLPEYGGTKVVLDDK	49	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3877.3	41.1133	3	1824.932771	1824.927433	K	D	71	87
PSM	KYEQGFITDPVVLSPK	50	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3921.3	42.24977	3	1899.944471	1899.938332	K	D	109	125
PSM	LDNVPHTPSSYIETLPK	51	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3905.3	41.8311	3	1989.948371	1989.944874	R	A	45	62
PSM	ILATPPQEDAPSVDIANIR	52	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4243.2	50.4078	4	2179.002894	2178.996332	K	M	284	303
PSM	DNLTLWTSENQGDEGDAGEGEN	53	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4006.3	44.41938	3	2349.958871	2349.946922	R	-	225	247
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	54	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3677.3	35.923	5	2853.391118	2853.390968	K	K	62	95
PSM	DDDIAALVVDNGSGMCK	55	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4419.2	53.9801	3	1820.7997	1820.7915	M	A	2	19
PSM	IADPEHDHTGFLTEYVATR	56	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3779.6	38.56158	3	2330.972171	2330.961009	R	W	190	209
PSM	VAAETQSPSLFGSTK	57	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3542.2	32.4389	3	1601.732171	1601.733819	K	L	215	230
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	58	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3427.4	29.48458	4	2612.326494	2612.322435	R	Q	24	52
PSM	NGNGGPGPYVGQAGTATLPR	59	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3544.4	32.497	3	1962.896471	1962.894904	K	N	185	205
PSM	TPAAAAAMNLASPR	60	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3533.3	32.21783	2	1420.653847	1420.653400	R	T	2261	2275
PSM	SAESPTSPVTSETGSTFKK	61	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3303.6	26.2629	3	2019.904271	2019.903797	K	F	280	299
PSM	NGSLDSPGKQDTEEDEEEDEK	62	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3037.2	19.61292	3	2429.928371	2429.923149	K	D	134	155
PSM	LVQDVANNTNEEAGDGTTTATVLAR	63	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3605.6	34.09208	3	2639.220371	2639.207584	K	S	97	122
PSM	EAAGGNDSSGATSPINPAVALE	64	sp|P32004|L1CAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4033.4	45.09677	3	2106.920171	2106.910674	K	-	1236	1258
PSM	KYEQGFITDPVVLSPKDR	65	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3750.5	37.82672	3	2171.072471	2171.066387	K	V	109	127
PSM	LDGLVETPTGYIESLPR	66	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4576.2	56.71252	3	1938.945071	1938.933975	R	V	56	73
PSM	DNLTLWTSDQQDDDGGEGNN	67	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4016.2	44.65563	3	2192.883671	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	68	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4007.3	44.44357	3	2192.883671	2192.873028	R	-	228	248
PSM	VPPAPVPCPPPSPGPSAVPSSPK	69	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3729.2	37.27507	4	2378.079694	2378.078288	K	S	366	389
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	70	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3684.3	36.1054	5	3562.503118	3562.491898	K	V	60	92
PSM	EEEIAALVIDNGSGMCK	71	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4985.2	61.49042	3	1972.8239	1972.8154	M	A	2	19
PSM	SSIGTGYDLSASTFSPDGR	72	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.4241.3	50.38503	3	2038.8590	2038.8516	M	V	2	21
PSM	HRNDHLTSTTSSPGVIVPESSENK	73	sp|O75496|GEMI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3248.2	24.83398	4	2671.233294	2671.223903	K	N	53	77
PSM	PCSEETPAISPSK	74	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3131.6	21.85983	2	1482.6122	1481.6102	M	R	2	15
PSM	SVTEQGAELSNEER	75	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3209.5	23.85773	2	1627.679847	1627.672675	K	N	28	42
PSM	VLDTSSLTQSAPASPTNK	76	sp|Q8N122|RPTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3479.3	30.81863	3	1895.892371	1895.887753	R	G	850	868
PSM	RADLNQGIGEPQSPSRR	77	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3100.5	21.09305	3	1959.933071	1959.927602	R	V	62	79
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	78	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4018.4	44.71093	4	2881.112094	2881.094982	K	T	701	725
PSM	GALQNIIPASTGAAK	79	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3766.4	38.23423	2	1490.752447	1490.749409	R	A	201	216
PSM	WLDDLLASPPPSGGGAR	80	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4729.2	58.6063	3	1867.796171	1867.790696	R	R	684	701
PSM	WLDDLLASPPPSGGGAR	81	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4707.2	58.39502	3	1867.796171	1867.790696	R	R	684	701
PSM	DNLTLWTSDMQGDGEEQNK	82	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3972.4	43.57338	3	2179.938971	2179.932792	R	E	226	245
PSM	VPADTEVVCAPPTAYIDFAR	83	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.4336.2	52.42985	3	2271.042671	2271.028287	K	Q	71	91
PSM	EGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGK	84	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	29-UNIMOD:4,31-UNIMOD:21	ms_run[1]:scan=1.1.4440.2	54.34392	4	3681.670894	3681.639334	K	K	213	250
PSM	EEEIAALVIDNGSGMCK	85	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.5430.2	64.96122	3	1956.8282	1956.8205	M	A	2	19
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	86	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3562.4	32.9656	4	2898.296494	2898.290225	K	L	281	308
PSM	AAAVAAAGAGEPQSPDELLPK	87	sp|Q9NS69|TOM22_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4387.2	53.45528	3	2083.9919	2083.9822	M	G	2	23
PSM	SSIGTGYDLSASTFSPDGR	88	sp|P25788|PSA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,15-UNIMOD:21	ms_run[1]:scan=1.1.4233.2	50.17703	3	2038.8590	2038.8516	M	V	2	21
PSM	SDEFSLADALPEHSPAK	89	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4212.2	49.63577	3	1934.8358	1934.8294	M	T	2	19
PSM	NQVAMNPTNTVFDAK	90	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3617.4	34.3982	3	1728.756971	1728.754237	K	R	57	72
PSM	IDEMPEAAVKSTANK	91	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3273.3	25.47067	3	1682.761271	1682.758653	R	Y	30	45
PSM	EFQDAGEQVVSSPADVAEK	92	sp|P31937|3HIDH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3592.4	33.74935	3	2084.897471	2084.893961	K	A	77	96
PSM	KLSSWDQAETPGHTPSLR	93	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3476.2	30.74145	4	2168.932894	2168.929315	K	W	214	232
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	94	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3539.6	32.37725	3	2994.276071	2994.261530	K	A	106	138
PSM	HCDSINSDFGSESGGCGDSSPGPSASQGPR	95	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:4,16-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3338.5	27.16628	4	3088.166094	3088.156036	R	A	10	40
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	96	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3465.5	30.4753	4	3093.286494	3093.277137	R	-	738	768
PSM	QREEYQPATPGLGMFVEVKDPEDK	97	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3966.3	43.42052	4	2842.297694	2842.288477	K	V	72	96
PSM	GALQNIIPASTGAAK	98	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3774.3	38.43185	2	1490.752447	1490.749409	R	A	201	216
PSM	LGGSAVISLEGKPL	99	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4342.3	52.5862	2	1499.711447	1499.703779	K	-	153	167
PSM	NQYDNDVTVWSPQGR	100	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3701.2	36.54538	3	1857.769271	1857.768307	R	I	4	19
PSM	DSGPLPTPPGVSLLGEPPK	101	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4528.2	55.81132	3	1936.961771	1936.954711	K	D	482	501
PSM	ILATPPQEDAPSVDIANIR	102	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4238.3	50.29728	3	2179.008371	2178.996332	K	M	284	303
PSM	GSLAEAVGSPPPAATPTPTPPTR	103	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3676.5	35.9034	3	2331.062171	2331.054910	R	K	446	469
PSM	VDNSSLTGESEPQTRSPDFTNENPLETR	104	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3789.3	38.8077	4	3199.406494	3199.394275	K	N	213	241
PSM	DDDIAALVVDNGSGMCK	105	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4690.2	58.15032	3	1900.7666	1900.7579	M	A	2	19
PSM	NGSLDSPGKQDTEEDEEEDEKDK	106	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2999.4	18.76117	4	2673.046094	2673.045055	K	G	134	157
PSM	EVNVSPCPTQPCQLSK	107	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3385.3	28.38417	3	1922.829071	1922.826750	K	G	36	52
PSM	GVQVETISPGDGR	108	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3337.4	27.13703	2	1393.6261	1393.6233	M	T	2	15
PSM	SGSSSPDSEITELK	109	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3511.4	31.64767	2	1515.636447	1515.634164	R	F	571	585
PSM	VAAETQSPSLFGSTK	110	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3546.4	32.54917	2	1601.736247	1601.733819	K	L	215	230
PSM	GEPAAAAAPEAGASPVEK	111	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3186.2	23.25007	3	1701.764771	1701.761096	K	E	88	106
PSM	KVPQVSTPTLVEVSR	112	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3599.2	33.92152	3	1718.896871	1718.896802	K	N	438	453
PSM	SSTPLPTISSSAENTR	113	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3447.3	30.00332	3	1726.778771	1726.777475	R	Q	158	174
PSM	MDATANDVPSPYEVR	114	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3571.5	33.20469	2	1743.724647	1743.717517	K	G	434	449
PSM	RADLNQGIGEPQSPSR	115	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3169.2	22.81187	4	1803.828094	1803.826490	R	R	62	78
PSM	IRYESLTDPSKLDSGK	116	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3461.3	30.365	3	1887.902171	1887.897924	K	E	54	70
PSM	IACKSPPPESVDTPTSTK	117	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3103.2	21.16997	3	2073.877871	2073.873106	K	Q	1127	1145
PSM	NGVIQHTGAAAEEFNDDTD	118	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3458.4	30.2904	3	2082.822971	2082.816773	R	-	646	665
PSM	LYGSAGPPPTGEEDTAEKDEL	119	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3632.4	34.79177	3	2254.959671	2254.951870	K	-	634	655
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	120	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3523.5	31.96458	3	2994.276071	2994.261530	K	A	106	138
PSM	HSGGFLSSPADFSQENK	121	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3681.2	36.0246	3	1886.786771	1886.783623	R	A	772	789
PSM	ISMQDVDLSLGSPK	122	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4086.4	46.46457	2	1568.722847	1568.715726	K	L	500	514
PSM	SPAGLQVLNDYLADK	123	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4495.2	55.29322	3	1682.795471	1682.791668	K	S	8	23
PSM	SESVPPVTDWAWYK	124	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4386.2	53.43955	3	1743.762371	1743.754554	K	I	244	258
PSM	DVAEAKPELSLLGDGDH	125	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3804.2	39.19538	3	1764.855671	1764.853008	R	-	232	249
PSM	ASLGSLEGEAEAEASSPK	126	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3766.2	38.22757	3	1811.785271	1811.782620	K	G	5748	5766
PSM	VSHVSTGGGASLELLEGK	127	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3715.2	36.91135	3	1819.875671	1819.871709	K	V	389	407
PSM	LDNVPHTPSSYIETLPK	128	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3897.2	41.6195	3	1989.948371	1989.944874	R	A	45	62
PSM	DRYMSPMEAQEFGILDK	129	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4130.2	47.59777	3	2108.903771	2108.894829	R	V	227	244
PSM	KYEQGFITDPVVLSPKDR	130	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3742.2	37.61472	4	2171.065694	2171.066387	K	V	109	127
PSM	DGYADIVDVLNSPLEGPDQK	131	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4842.3	59.69425	3	2224.006571	2223.993675	K	S	287	307
PSM	TPEELDDSDFETEDFDVR	132	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4126.3	47.49313	3	2237.864171	2237.852550	R	S	634	652
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	133	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3695.6	36.40188	4	3265.418494	3265.402471	K	-	708	738
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	134	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4,14-UNIMOD:21,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4552.3	56.22005	4	3537.401694	3537.370051	R	V	44	74
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	135	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4953.2	61.0805	4	3720.720894	3720.684901	K	G	621	655
PSM	MDSAGQDINLNSPNK	136	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3760.6	38.08605	2	1724.7160	1724.7072	-	G	1	16
PSM	ASGVAVSDGVIK	137	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	39.09203	2	1223.5782	1223.5794	M	V	2	14
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	138	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3137.6	21.99627	4	3087.3062	3087.2952	K	S	145	174
PSM	QASPNIVIALAGNK	139	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4614.2	57.20298	2	1457.7331	1457.7274	R	A	122	136
PSM	MEAAGSPAATETGK	140	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2994.2	18.65465	2	1457.5737	1457.5740	-	Y	1	15
PSM	AAQGVGPGPGSAAPPGLEAAR	141	sp|Q6P582|MZT2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3811.3	39.38215	3	1951.9193	1951.9148	M	Q	2	23
PSM	GHASAPYFGKEEPSVAPSSTGK	142	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3307.5	26.36402	4	2283.019294	2283.020893	K	T	131	153
PSM	VVESPDFSKDEDYLGK	143	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3650.2	35.22597	3	1906.825871	1906.823756	K	V	923	939
PSM	DSENLASPSEYPENGER	144	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3393.2	28.58923	3	1972.771271	1972.768760	R	F	617	634
PSM	DMESPTKLDVTLAK	145	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3555.3	32.78003	3	1642.753571	1642.752506	K	D	277	291
PSM	GEPAAAAAPEAGASPVEK	146	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	22.84108	3	1701.764771	1701.761096	K	E	88	106
PSM	HVPDSGATATAYLCGVK	147	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3615.3	34.34272	3	1825.809671	1825.807001	K	G	110	127
PSM	SPAVATSTAAPPPPSSPLPSK	148	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3404.3	28.8805	3	2039.002871	2038.997638	K	S	439	460
PSM	SPAVATSTAAPPPPSSPLPSK	149	sp|Q14157|UBP2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3412.5	29.09597	3	2039.002871	2038.997638	K	S	439	460
PSM	GDRSEDFGVNEDLADSDAR	150	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3481.5	30.87457	3	2066.887571	2066.877720	K	A	186	205
PSM	IADPEHDHTGFLTEYVATR	151	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3662.3	35.53175	3	2251.002371	2250.994678	R	W	190	209
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	152	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3066.4	20.25152	4	3024.365294	3024.356099	K	S	145	174
PSM	TLTIVDTGIGMTK	153	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4139.2	47.84353	3	1508.660171	1508.659865	R	A	28	41
PSM	KIFVGGLSPDTPEEK	154	sp|Q14103|HNRPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3784.2	38.67372	3	1775.779871	1775.778400	K	I	183	198
PSM	IMNTFSVVPSPK	155	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3908.5	41.91607	2	1398.662247	1398.661840	R	V	163	175
PSM	GYISPYFINTSK	156	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4071.3	46.08072	2	1468.670047	1468.663948	R	G	222	234
PSM	GYISPYFINTSK	157	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4206.3	49.4914	2	1548.636447	1548.630279	R	G	222	234
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	158	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3988.3	43.96307	4	3385.536494	3385.515651	K	A	399	429
PSM	DVTNFTVGGFAPMSPR	159	sp|O00267|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4338.2	52.49098	3	1774.782971	1774.774972	R	I	653	669
PSM	RIDFIPVSPAPSPTR	160	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4088.2	46.50285	3	1811.841971	1811.837252	K	G	136	151
PSM	GADFLVTEVENGGSLGSK	161	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4131.2	47.62074	3	1858.839071	1858.834990	K	K	189	207
PSM	TFEEDPAVGAIVLTGGDK	162	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4039.2	45.24517	3	1897.877771	1897.871041	K	A	75	93
PSM	GSLESPATDVFGSTEEGEK	163	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3909.3	41.93535	3	2018.837471	2018.835777	K	R	331	350
PSM	DLFSLDSEDPSPASPPLR	164	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4484.2	55.02875	3	2021.908571	2021.898318	R	S	224	242
PSM	DATNVGDEGGFAPNILENK	165	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4082.2	46.35017	3	2039.890571	2039.883731	K	E	203	222
PSM	EINAREESLVEELSPASEK	166	sp|Q9BXK5|B2L13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3722.4	37.10118	3	2209.019171	2209.015139	K	K	413	432
PSM	DLYANTVLSGGTTMYPGIADR	167	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4352.3	52.79818	3	2294.041271	2294.029015	K	M	292	313
PSM	EGEEAGPGDPLLEAVPKTGDEK	168	sp|Q16543|CDC37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3766.5	38.23757	3	2317.045871	2317.036268	K	D	353	375
PSM	SGSSSPDSEITELKFPSINHD	169	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4113.2	47.16778	3	2326.015271	2326.000217	R	-	571	592
PSM	IADPEHDHTGFLTEYVATR	170	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3781.2	38.59727	4	2330.964494	2330.961009	R	W	190	209
PSM	TQDPAKAPNTPDILEIEFKK	171	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3845.2	40.27094	4	2334.154894	2334.150844	K	G	210	230
PSM	CIPALDSLTPANEDQK	172	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4858.2	59.88042	3	1833.7910	1833.7851	R	I	447	463
PSM	MDSAGQDINLNSPNK	173	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3448.2	30.02615	3	1740.7037	1740.7021	-	G	1	16
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	174	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.4125.4	47.47721	3	2749.2532	2749.2302	-	Y	1	25
PSM	MEGPLSVFGDR	175	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5194.2	63.1545	2	1328.5527	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	176	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4439.2	54.3184	2	1344.5477	1344.5416	-	S	1	12
PSM	ADEDLIFRLEGVDGGQSPR	177	sp|O00418|EF2K_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.4882.2	60.14973	3	2195.0002	2194.9892	M	A	2	21
PSM	MEDLVQDGVASPATPGTGK	178	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4255.2	50.7197	3	1993.8779	1993.8699	-	S	1	20
PSM	GHTDTEGRPPSPPPTSTPEK	179	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2992.3	18.5981	4	2246.928094	2246.924624	R	C	353	373
PSM	STGCDFAVSPK	180	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3306.4	26.33458	2	1247.489247	1247.489355	K	L	501	512
PSM	HARPPDPPASAPPDSSSNSASQDTK	181	sp|Q15642|CIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2990.3	18.5482	4	2596.120494	2596.119103	R	E	486	511
PSM	TFDQLTPDESK	182	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3331.5	26.98447	2	1359.562047	1359.559543	K	E	71	82
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	183	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3451.5	30.11433	4	2987.325694	2987.319929	R	-	684	712
PSM	KISPFEHQTYCQR	184	sp|P28482|MK01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3237.2	24.56235	3	1772.772071	1772.770556	K	T	55	68
PSM	RADLNQGIGEPQSPSR	185	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3173.3	22.91863	3	1803.828371	1803.826490	R	R	62	78
PSM	DLEAEHVEVEDTTLNR	186	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3533.2	32.2145	3	1868.878271	1868.875201	R	C	15	31
PSM	NIGRDTPTSAGPNSFNK	187	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3251.4	24.9134	3	1934.796671	1934.792487	K	G	134	151
PSM	SAESPTSPVTSETGSTFK	188	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3656.3	35.37842	3	1971.779771	1971.775165	K	K	280	298
PSM	KQEETAVLEEDSADWEK	189	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3534.3	32.2431	3	2085.885971	2085.877977	K	E	302	319
PSM	ALRTDYNASVSVPDSSGPER	190	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3433.5	29.64477	3	2199.984671	2199.979756	K	I	67	87
PSM	YRDVAECGPQQELDLNSPR	191	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3567.4	33.09645	3	2326.012271	2326.004926	K	N	102	121
PSM	DYEIESQNPLASPTNTLLGSAK	192	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4390.2	53.54296	4	2427.127694	2427.120667	K	E	618	640
PSM	EVYELLDSPGK	193	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3760.4	38.07938	2	1328.593047	1328.590115	K	V	20	31
PSM	DSGFTIVSPLDI	194	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.6050.2	69.5874	2	1342.612447	1342.605765	K	-	784	796
PSM	IHVSDQELQSANASVDDSRLEELK	195	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3706.3	36.67918	4	2762.287294	2762.275998	K	A	807	831
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	196	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.5431.2	64.98582	4	2952.350094	2952.330281	R	S	59	86
PSM	GVVDSDDLPLNVSR	197	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3764.4	38.18202	2	1484.747847	1484.747087	K	E	435	449
PSM	VEEQEPELTSTPNFVVEVIKNDDGKK	198	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4174.2	48.66063	4	3023.454894	3023.437644	K	A	155	181
PSM	GYISPYFINTSK	199	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4214.5	49.69788	2	1548.636447	1548.630279	R	G	222	234
PSM	SLTNDWEDHLAVK	200	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3853.2	40.48167	3	1606.703171	1606.702853	K	H	315	328
PSM	DMESPTKLDVTLAK	201	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3727.2	37.22278	3	1626.758171	1626.757591	K	D	277	291
PSM	ASLGSLEGEAEAEASSPK	202	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3758.2	38.02103	3	1811.785271	1811.782620	K	G	5748	5766
PSM	SESVPPVTDWAWYK	203	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4613.2	57.17765	3	1823.723471	1823.720885	K	I	244	258
PSM	SESVPPVTDWAWYK	204	sp|P35613|BASI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4592.2	56.93675	3	1823.727371	1823.720885	K	I	244	258
PSM	DGKTLNDELEIIEGMK	205	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4404.2	53.8116	3	1883.863571	1883.858761	K	F	203	219
PSM	DDGVFVQEVTQNSPAAR	206	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3768.2	38.27977	3	1911.842471	1911.836387	R	T	29	46
PSM	AAPEASSPPASPLQHLLPGK	207	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4083.3	46.37873	3	2126.988671	2126.980288	K	A	686	706
PSM	DGYADIVDVLNSPLEGPDQK	208	sp|Q86TX2|ACOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4859.3	59.90536	3	2224.006571	2223.993675	K	S	287	307
PSM	KGEQTSSGTLSAFASYFNSK	209	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4462.2	54.70525	3	2268.950771	2268.934126	R	V	670	690
PSM	GSPLNAAPYGIESMSQDTEVR	210	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4025.4	44.88883	3	2301.003971	2300.998443	K	S	351	372
PSM	IADPEHDHTGFLTEYVATR	211	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3727.6	37.23612	3	2330.968571	2330.961009	R	W	190	209
PSM	MEGPLSVFGDR	212	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5171.2	62.95287	2	1328.5527	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	213	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5214.2	63.35457	2	1328.5527	1328.5467	-	S	1	12
PSM	MEGPLSVFGDR	214	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.5235.2	63.56087	2	1328.5527	1328.5467	-	S	1	12
PSM	TEWETAAPAVAETPDIK	215	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4201.2	49.34715	3	1949.8720	1949.8654	M	L	2	19
PSM	AAEEAFVNDIDESSPGTEWER	216	sp|P09496-2|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4063.4	45.8787	3	2430.996371	2430.985295	R	V	163	184
PSM	MEAAGSPAATETGK	217	sp|Q9BRP8|PYM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.3290.6	25.92433	2	1441.5807	1441.5791	-	Y	1	15
PSM	NVSSFPDDATSPLQENR	218	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3657.3	35.40313	3	1956.828971	1955.826216	R	N	52	69
PSM	CNTPTYCDLGK	219	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3537.5	32.32443	2	1449.5317	1449.5300	M	A	2	13
PSM	TAAKGEAAAERPGEAAVASSPSK	220	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2979.3	18.31727	4	2235.055294	2235.053256	K	A	8	31
PSM	GLGKPGGQGDAIQLSPK	221	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3389.2	28.48477	3	1701.846971	1701.845101	K	L	160	177
PSM	MDATANDVPSPYEVR	222	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3565.2	33.03743	3	1743.720971	1743.717517	K	G	434	449
PSM	SSPNPFVGSPPK	223	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3439.6	29.8045	2	1292.582047	1292.580219	K	G	393	405
PSM	NAPAAVDEGSISPR	224	sp|P28715|ERCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3242.4	24.69482	2	1462.648447	1462.645338	R	T	373	387
PSM	NRVIGSGCNLDSAR	225	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3108.2	21.26573	3	1517.736671	1517.736873	K	F	156	170
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	226	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3506.5	31.52043	4	3173.254494	3173.243468	R	-	738	768
PSM	GRTVIIEQSWGSPK	227	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	32.70255	3	1636.796471	1636.797422	K	V	59	73
PSM	GARPPAAGPGGDEDEDEEDTAPESALDTSLDK	228	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3636.5	34.89558	4	3291.377694	3291.357615	R	S	1160	1192
PSM	HVPDSGATATAYLCGVK	229	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3623.2	34.549	3	1825.809671	1825.807001	K	G	110	127
PSM	NIGRDTPTSAGPNSFNK	230	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	24.12468	3	1854.827171	1854.826156	K	G	134	151
PSM	NIGRDTPTSAGPNSFNK	231	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3260.3	25.1364	3	1934.796671	1934.792487	K	G	134	151
PSM	KPQEEDSPGPSTSSVLK	232	sp|Q9BQE4|SELS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3173.6	22.92863	3	1944.815771	1944.811885	K	R	134	151
PSM	VTAEADSSSPTGILATSESK	233	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3594.3	33.7968	3	2029.914971	2029.909277	K	S	486	506
PSM	SAESPTSPVTSETGSTFKK	234	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3452.4	30.13698	3	2099.875571	2099.870128	K	F	280	299
PSM	LVQDVANNTNEEAGDGTTTATVLAR	235	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3613.6	34.30012	3	2639.220371	2639.207584	K	S	97	122
PSM	GISCMNTTLSESPFKCDPDAAR	236	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3780.2	38.5726	4	2536.046494	2536.043362	K	A	239	261
PSM	SILSPGGSCGPIK	237	sp|P78347|GTF2I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3698.6	36.48043	2	1351.623447	1351.620704	R	V	207	220
PSM	LDIDSPPITAR	238	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3796.3	38.99158	2	1356.573447	1356.572764	R	N	33	44
PSM	ERPTPSLNNNCTTSEDSLVLYNR	239	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3710.4	36.787	4	2759.229294	2759.222189	K	V	734	757
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	240	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.5172.2	62.97797	4	2996.327294	2996.305323	R	E	492	521
PSM	VEEQEPELTSTPNFVVEVIKNDDGKK	241	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4183.4	48.88278	4	3023.454894	3023.437644	K	A	155	181
PSM	SACGNCYLGDAFR	242	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3809.5	39.33662	2	1569.580447	1569.574164	K	C	272	285
PSM	AIVDALPPPCESACTVPTDVDK	243	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3926.4	42.38385	3	2434.092071	2434.079730	R	W	261	283
PSM	DDGLFSGDPNWFPK	244	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4906.2	60.4095	2	1673.686447	1673.676304	R	K	140	154
PSM	VVLAYEPVWAIGTGK	245	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4423.2	54.05648	3	1681.854671	1681.848061	K	T	198	213
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	246	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3979.4	43.7467	4	3385.536494	3385.515651	K	A	399	429
PSM	KYEMFAQTLQQSR	247	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3683.2	36.07656	3	1788.731771	1788.730738	R	G	754	767
PSM	DRSSFYVNGLTLGGQK	248	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3885.2	41.30562	3	1820.849171	1820.845829	K	C	55	71
PSM	AEEYEFLTPVEEAPK	249	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3990.2	44.00895	3	1830.802271	1830.796479	R	G	153	168
PSM	AEEYEFLTPVEEAPK	250	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3998.2	44.21347	3	1830.802271	1830.796479	R	G	153	168
PSM	NQYDNDVTVWSPQGR	251	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3709.3	36.75732	3	1857.769271	1857.768307	R	I	4	19
PSM	LATQSNEITIPVTFESR	252	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4224.2	49.94215	3	1984.956371	1984.950688	K	A	172	189
PSM	FSGWYDADLSPAGHEEAK	253	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3818.2	39.56205	3	2058.843971	2058.836052	R	R	22	40
PSM	LATQSNEITIPVTFESR	254	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4372.3	53.11258	3	2064.926771	2064.917019	K	A	172	189
PSM	DALGDSLQVPVSPSSTTSSR	255	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3887.2	41.3579	3	2082.951671	2082.947059	R	C	141	161
PSM	TIGGGDDSFNTFFSETGAGK	256	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4258.2	50.7975	3	2086.863671	2086.852096	K	H	41	61
PSM	AAPEASSPPASPLQHLLPGK	257	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4074.3	46.15415	3	2126.988671	2126.980288	K	A	686	706
PSM	STAALSGEAASCSPIIMPYK	258	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3915.2	42.08968	3	2132.958371	2132.952345	K	A	242	262
PSM	DNLTLWTSDMQGDGEEQNK	259	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3996.5	44.17128	3	2179.942571	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	260	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4033.5	45.1001	3	2192.881271	2192.873028	R	-	228	248
PSM	TPEELDDSDFETEDFDVR	261	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4118.2	47.28467	3	2237.864171	2237.852550	R	S	634	652
PSM	SSVSRVPCNVEGISPELEK	262	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3723.4	37.12698	3	2245.977071	2245.969131	K	V	290	309
PSM	DLYANTVLSGGTTMYPGIADR	263	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4367.2	53.00102	3	2294.041271	2294.029015	K	M	292	313
PSM	QSKPVTTPEEIAQVATISANGDK	264	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3729.6	37.2884	3	2463.199871	2463.189415	K	E	158	181
PSM	QSKPVTTPEEIAQVATISANGDK	265	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3777.2	38.51342	3	2543.167871	2543.155746	K	E	158	181
PSM	DDDIAALVVDNGSGMCK	266	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4661.2	57.73042	3	1900.7666	1900.7579	M	A	2	19
PSM	EEEIAALVIDNGSGMCK	267	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4969.2	61.27597	3	1972.8239	1972.8154	M	A	2	19
PSM	SQIFSTASDNQPTVTIK	268	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3733.2	37.3796	3	1915.896671	1915.892839	K	V	448	465
PSM	MDSAGQDINLNSPNK	269	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3752.2	37.86648	3	1724.7104	1724.7072	-	G	1	16
PSM	GASLKSPLPSQ	270	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3337.2	27.13037	2	1163.558647	1163.558755	K	-	113	124
PSM	HTGPNSPDTANDGFVR	271	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3188.5	23.3124	3	1763.729471	1763.726442	K	L	99	115
PSM	THSTSSSLGSGESPFSR	272	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3235.3	24.5138	3	1802.748371	1802.747237	R	S	329	346
PSM	NAGVEGSLIVEK	273	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3405.2	28.90328	2	1214.649847	1214.650667	K	I	482	494
PSM	DQVANSAFVER	274	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3274.4	25.4999	2	1234.593847	1234.594215	K	L	500	511
PSM	IGRIEDVTPIPSDSTR	275	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3549.3	32.62432	3	1914.849671	1914.848939	K	R	126	142
PSM	LDIDSPPITAR	276	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3670.4	35.74333	2	1276.608047	1276.606433	R	N	33	44
PSM	EALQDVEDENQ	277	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3268.3	25.3408	2	1288.544047	1288.541905	K	-	245	256
PSM	SVNGGPGSPDLAR	278	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3149.2	22.29382	2	1305.575847	1305.571445	R	H	982	995
PSM	DNNQFASASLDR	279	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3333.4	27.03297	2	1336.601247	1336.600757	K	T	154	166
PSM	TPKGPSSVEDIK	280	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3160.5	22.5886	2	1336.628847	1336.627563	K	A	237	249
PSM	RVEPGSPAEAAALR	281	sp|Q15599|NHRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3269.2	25.3637	3	1502.724371	1502.724257	R	A	38	52
PSM	SAMPFTASPASSTTAR	282	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3586.2	33.58615	3	1661.712971	1661.712038	R	V	123	139
PSM	KYEMFAQTLQQSR	283	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3604.3	34.056	3	1708.764671	1708.764407	R	G	754	767
PSM	PENVAPRSGATAGAAGGR	284	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2951.2	17.86438	3	1717.7915	1717.7892	M	G	2	20
PSM	SADGSAPAGEGEGVTLQR	285	sp|Q01650|LAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3309.2	26.40578	3	1780.767071	1780.762887	K	N	31	49
PSM	LGAGGGSPEKSPSAQELK	286	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3124.4	21.67385	3	1791.842171	1791.840409	R	E	13	31
PSM	ALVSGKPAESSAVAATEK	287	sp|O95182|NDUA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3296.3	26.06937	3	1794.876671	1794.876460	K	K	75	93
PSM	RADLNQGIGEPQSPSR	288	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3165.5	22.7182	3	1803.828371	1803.826490	R	R	62	78
PSM	TSSVSNPQDSVGSPCSR	289	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3088.2	20.78615	3	1843.741571	1843.740772	K	V	94	111
PSM	VPSEGPKETPSSANGPSR	290	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2962.2	18.04322	3	1875.837971	1875.836387	R	E	54	72
PSM	EQPPTEPGPQSASEVEK	291	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3191.5	23.39058	3	1888.811171	1888.809169	R	I	393	410
PSM	LSLEGDHSTPPSAYGSVK	292	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3482.3	30.8927	3	1923.865571	1923.861539	K	A	11	29
PSM	GSTHPQPGVSPPAAPAAPGPK	293	sp|O94925|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3283.2	25.72807	3	1999.953971	1999.951691	K	D	86	107
PSM	TPSPKEEDEEPESPPEK	294	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3017.3	19.1689	3	2003.826671	2003.824878	K	K	202	219
PSM	SHSPSSPDPDTPSPVGDSR	295	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3101.4	21.11488	3	2080.782971	2080.777625	R	A	616	635
PSM	ETVSEESNVLCLSKSPNK	296	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3538.3	32.3425	3	2099.948771	2099.944617	R	H	581	599
PSM	DYHFKVDNDENEHQLSLR	297	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3472.2	30.64057	4	2258.038094	2258.035223	K	T	28	46
PSM	GHASAPYFGKEEPSVAPSSTGK	298	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3330.2	26.94862	4	2283.023294	2283.020893	K	T	131	153
PSM	PVQETQAPESPGENSEQALQTLSPR	299	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3642.3	35.03347	4	2772.2687	2772.2598	M	A	2	27
PSM	QFTPCQLLADHANSPNKK	300	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3697.2	36.4409	4	2227.954094	2227.948671	K	F	743	761
PSM	SADTLWGIQK	301	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3843.2	40.21833	2	1197.544847	1197.543105	K	E	319	329
PSM	SADTLWDIQK	302	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3916.2	42.11573	2	1255.550047	1255.548584	K	D	320	330
PSM	DAGQISGLNVLR	303	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3985.2	43.88617	2	1321.640647	1321.639131	K	V	207	219
PSM	DSGFTIVSPLDI	304	sp|Q92609|TBCD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.6019.2	69.38458	2	1342.612447	1342.605765	K	-	784	796
PSM	EFSPFGTITSAK	305	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4273.2	51.14833	2	1443.578047	1443.572430	K	V	313	325
PSM	IMNTFSVVPSPK	306	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4060.3	45.7969	2	1478.634647	1478.628171	R	V	163	175
PSM	DMSPLSETEMALGK	307	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4264.3	50.95358	2	1587.664247	1587.656162	K	D	505	519
PSM	RASGQAFELILSPR	308	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3927.2	42.40307	3	1623.816071	1623.813407	K	S	14	28
PSM	DDGLFSGDPNWFPK	309	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4886.2	60.2138	2	1673.686447	1673.676304	R	K	140	154
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	310	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4469.3	54.82777	3	2540.105771	2540.089049	K	S	180	204
PSM	VGIDTPDIDIHGPEGK	311	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3682.2	36.0508	3	1741.793171	1741.792396	K	L	4560	4576
PSM	DISSDAFTALDPLGDK	312	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4679.2	58.03908	2	1743.773647	1743.760428	K	E	631	647
PSM	NQLTSNPENTVFDAK	313	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3725.5	37.18188	2	1756.773247	1756.766910	K	R	82	97
PSM	ISLPGQMAGTPITPLK	314	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4231.2	50.11165	3	1782.845171	1782.839226	K	D	213	229
PSM	DDGLFSGDPNWFPKK	315	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4244.4	50.43815	3	1801.779671	1801.771267	R	S	140	155
PSM	CIPALDSLTPANEDQK	316	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3813.3	39.43415	3	1850.814071	1850.812146	R	I	447	463
PSM	SLSTSGESLYHVLGLDK	317	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4479.2	54.95424	3	1884.895571	1884.887025	R	N	8	25
PSM	NSDVLQSPLDSAARDEL	318	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4083.2	46.3754	3	1908.853271	1908.846617	K	-	606	623
PSM	GLSLVDKENTPPALSGTR	319	sp|P31350|RIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3721.4	37.07507	3	2013.923471	2013.917353	K	V	24	42
PSM	ATESGAQSAPLPMEGVDISPK	320	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3938.3	42.69347	3	2163.982271	2163.975917	K	Q	8	29
PSM	ILATPPQEDAPSVDIANIR	321	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4230.2	50.08575	3	2179.008371	2178.996332	K	M	284	303
PSM	SCEGQNPELLPKTPISPLK	322	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3895.3	41.57068	3	2267.038571	2267.031003	K	T	308	327
PSM	APLNIPGTPVLEDFPQNDDEK	323	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4353.2	52.82402	3	2388.103271	2388.088638	K	E	42	63
PSM	DYEIESQNPLASPTNTLLGSAK	324	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4383.2	53.362	3	2427.134171	2427.120667	K	E	618	640
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	325	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4266.2	50.99148	4	2540.100894	2540.089049	K	S	180	204
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	326	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4943.2	60.90255	3	2620.074671	2620.055380	K	S	180	204
PSM	SASYKYSEEANNLIEECEQAER	327	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3893.4	41.52197	4	2699.116094	2699.105821	K	L	115	137
PSM	TLTIVDTGIGMTK	328	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3937.3	42.66735	2	1428.695847	1428.693534	R	A	28	41
PSM	GVVDSEDLPLNISR	329	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3882.4	41.23594	2	1512.783647	1512.778387	R	E	387	401
PSM	CIPALDSLTPANEDQK	330	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4841.2	59.67572	2	1833.7972	1833.7852	R	I	447	463
PSM	DDDIAALVVDNGSGMCK	331	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,13-UNIMOD:21,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4398.2	53.70272	3	1916.7596	1916.7528	M	A	2	19
PSM	ADLNQGIGEPQSPSR	332	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3275.4	25.52605	3	1648.740671	1647.725379	R	R	63	78
PSM	AESSESFTMASSPAQR	333	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3663.6	35.56772	2	1806.7193	1806.7126	M	R	2	18
PSM	MEGPLSVFGDR	334	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4453.2	54.5304	2	1344.5477	1344.5416	-	S	1	12
PSM	MDEPSPLAQPLELNQHSR	335	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3897.4	41.62617	3	2198.9689	2198.9662	-	F	1	19
PSM	NVSSFPDDATSPLQENR	336	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3648.2	35.17643	3	1956.828971	1955.826216	R	N	52	69
PSM	AEAEGVPTTPGPASGSTFR	337	sp|Q86VR2|RETR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3760.3	38.07605	3	1952.8556	1952.8512	M	G	2	21
PSM	WNSVSPASAGK	338	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3193.4	23.43925	2	1182.506847	1182.507054	K	R	304	315
PSM	DGNGYISAAELR	339	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3570.4	33.1753	2	1264.604447	1264.604780	K	H	96	108
PSM	GKEELAEAEIIKDSPDSPEPPNK	340	sp|Q9NVM9|INT13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3511.2	31.641	4	2572.198494	2572.194560	R	K	610	633
PSM	NSLDCEIVSAK	341	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3411.3	29.06315	2	1314.555247	1314.552684	K	S	423	434
PSM	HSPNLSFEPNFCQDNPRSPTSSK	342	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3599.6	33.93485	4	2725.168494	2725.159194	K	E	107	130
PSM	TFDQLTPEESK	343	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3342.5	27.27013	2	1373.578247	1373.575193	K	E	60	71
PSM	TPAAAAAMNLASPR	344	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3525.4	32.01333	2	1420.653847	1420.653400	R	T	2261	2275
PSM	SSGPYGGGGQYFAK	345	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3464.5	30.44965	2	1454.589447	1454.586761	R	P	285	299
PSM	GGEIQPVSVKVGDK	346	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	27.34747	2	1491.733647	1491.733425	K	V	57	71
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	347	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3526.2	32.03285	4	2994.272094	2994.261530	K	A	106	138
PSM	VLQQKLEAIEDDSVKETDSSSASAATPSK	348	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	26-UNIMOD:21	ms_run[1]:scan=1.1.3615.5	34.34938	4	3113.476094	3113.465315	R	K	210	239
PSM	TKEVYELLDSPGK	349	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3667.3	35.6618	3	1557.733271	1557.732756	K	V	18	31
PSM	TQSPGGCSAEAVLAR	350	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3435.4	29.69375	2	1582.682647	1582.681072	R	K	74	89
PSM	GKGGEIQPVSVKVGDK	351	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3225.3	24.25398	3	1676.853971	1676.849852	K	V	55	71
PSM	IDEMPEAAVKSTANK	352	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3281.4	25.68248	3	1682.761271	1682.758653	R	Y	30	45
PSM	AVASPEATVSQTDENK	353	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3185.4	23.23113	3	1725.747071	1725.745840	K	A	495	511
PSM	EQGPYETYEGSPVSK	354	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3312.5	26.49167	2	1749.713447	1749.713477	K	G	549	564
PSM	TDSVIIADQTPTPTR	355	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3538.2	32.33917	3	1773.761171	1773.758727	R	F	42	57
PSM	MDATANDVPSPYEVR	356	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3667.4	35.66513	3	1823.689871	1823.683848	K	G	434	449
PSM	PGPTPSGTNVGSSGRSPSK	357	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2960.2	18.01263	3	1848.8411	1848.8362	M	A	2	21
PSM	SQSPLRGMPETTQPDK	358	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3289.3	25.88813	3	1850.829671	1850.823379	R	Q	134	150
PSM	LENVSQLSLDKSPTEK	359	sp|Q86W56|PARG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3496.2	31.24987	3	1866.896771	1866.897590	K	S	126	142
PSM	SFEAPATINSASLHPEK	360	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3608.4	34.16395	3	1877.858171	1877.856059	K	E	219	236
PSM	SAESPTSPVTSETGSTFK	361	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3467.3	30.51912	3	1891.812371	1891.808834	K	K	280	298
PSM	VKLESPTVSTLTPSSPGK	362	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3557.3	32.83183	3	1906.965371	1906.965275	R	L	290	308
PSM	RFSEGVLQSPSQDQEK	363	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3325.4	26.82488	3	1913.856671	1913.852037	R	L	427	443
PSM	DVDDGSGSPHSPHQLSSK	364	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2954.2	17.9381	4	1928.791294	1928.790165	R	S	2022	2040
PSM	SAESPTSPVTSETGSTFK	365	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3664.3	35.58378	3	1971.779771	1971.775165	K	K	280	298
PSM	LREQDCGEPASPAASISR	366	sp|O60353|FZD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3182.5	23.1575	3	2022.886271	2022.883019	R	L	610	628
PSM	SSVSRVPCNVEGISPELEK	367	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3663.4	35.56105	3	2166.006971	2166.002800	K	V	290	309
PSM	LYGSAGPPPTGEEDTAEKDEL	368	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3652.4	35.28237	3	2254.962671	2254.951870	K	-	634	655
PSM	SISSPSVSSETMDKPVDLSTRK	369	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3470.2	30.59012	4	2430.136494	2430.134936	K	E	2802	2824
PSM	NSVERPAEPVAGAATPSLVEQQK	370	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3474.6	30.70467	3	2457.201371	2457.190084	R	M	1455	1478
PSM	DCAVKPCQSDEVPDGIKSASYK	371	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4,7-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3383.3	28.3318	4	2533.091694	2533.086607	R	Y	98	120
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEERN	372	sp|P13807|GYS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3651.4	35.25743	4	3185.446894	3185.436140	K	-	708	738
PSM	SADTLWGIQK	373	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3835.4	40.01482	2	1197.544847	1197.543105	K	E	319	329
PSM	SESAPTLHPYSPLSPK	374	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3695.3	36.39188	3	1869.798971	1869.795113	R	G	100	116
PSM	VWSPLVTEEGK	375	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3873.3	41.01425	2	1323.613647	1323.611184	K	R	88	99
PSM	NSDVLQSPLDSAARDEL	376	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4259.2	50.82348	3	1988.823371	1988.812948	K	-	606	623
PSM	STETSDFENIESPLNER	377	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3842.5	40.20225	3	2046.849071	2046.841925	K	D	899	916
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	378	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4567.2	56.57617	4	2747.150894	2747.134344	K	D	208	233
PSM	DNALLSAIEESR	379	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4389.2	53.5171	2	1396.629447	1396.623540	K	K	107	119
PSM	VEIIANDQGNRTTPSYVAFTDTER	380	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3913.4	42.0438	4	2856.245694	2856.236850	K	L	26	50
PSM	GNPTVEVDLFTSK	381	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3982.3	43.81973	2	1485.680247	1485.675241	R	G	16	29
PSM	YHTSQSGDEMTSLSEYVSR	382	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3723.5	37.13032	3	2255.920571	2255.904208	R	M	457	476
PSM	DEILPTTPISEQK	383	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3716.5	36.94747	2	1549.731247	1549.727671	K	G	215	228
PSM	ANTTAFLTPLEIK	384	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4376.2	53.1985	2	1577.722247	1577.714343	K	A	558	571
PSM	APLATGEDDDDEVPDLVENFDEASKNEAN	385	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4619.2	57.25602	4	3198.321294	3198.303789	K	-	178	207
PSM	RASGQAFELILSPR	386	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3935.2	42.61172	3	1623.816071	1623.813407	K	S	14	28
PSM	DMESPTKLDVTLAK	387	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3719.2	37.01607	3	1626.758171	1626.757591	K	D	277	291
PSM	GPPQSPVFEGVYNNSR	388	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3726.2	37.1972	3	1826.797271	1826.798879	K	M	107	123
PSM	DDPLTNLNTAFDVAEK	389	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4384.2	53.37785	3	1841.815271	1841.808440	K	Y	199	215
PSM	WLDDLLASPPPSGGGAR	390	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4796.2	59.23097	3	1867.796171	1867.790696	R	R	684	701
PSM	SGEISLPIKEEPSPISK	391	sp|Q9ULH7|MRTFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3753.2	37.8915	3	1889.939471	1889.938726	K	M	909	926
PSM	SVPTSTVFYPSDGVATEK	392	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3850.3	40.40612	3	1963.884671	1963.881605	R	A	439	457
PSM	FDRGYISPYFINTSK	393	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4071.2	46.07738	3	1966.834871	1966.826747	K	G	219	234
PSM	DLFSLDSEDPSPASPPLR	394	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4493.2	55.24175	3	2021.908571	2021.898318	R	S	224	242
PSM	DTQSPSTCSEGLLGWSQK	395	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.4029.4	44.9929	3	2059.864571	2059.855802	K	D	709	727
PSM	DQPAFTPSGILTPHALGSR	396	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4217.2	49.76897	3	2123.953571	2123.944237	R	N	428	447
PSM	YHTSQSGDEMTSLSEYVSR	397	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3792.5	38.89328	3	2255.909471	2255.904208	R	M	457	476
PSM	DTQDIVHDLESPGIDPSIIK	398	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4456.2	54.57085	3	2271.080771	2271.067174	K	Q	6022	6042
PSM	GFGDLKSPAGLQVLNDYLADK	399	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4729.3	58.6163	3	2300.1222	2300.1082	M	S	2	23
PSM	ELSNSPLRENSFGSPLEFR	400	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4174.3	48.67064	3	2338.013471	2338.003208	K	N	1316	1335
PSM	DNLTLWTSENQGDEGDAGEGEN	401	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4015.3	44.63811	3	2349.958871	2349.946922	R	-	225	247
PSM	GGPGSAVSPYPTFNPSSDVAALHK	402	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3910.4	41.96502	3	2435.122571	2435.115856	K	A	30	54
PSM	QSKPVTTPEEIAQVATISANGDK	403	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3828.5	39.83423	3	2463.200171	2463.189415	K	E	158	181
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	404	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3824.6	39.73262	3	2988.176771	2988.155727	K	E	144	170
PSM	AESSESFTMASSPAQR	405	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3671.2	35.76272	3	1806.7180	1806.7126	M	R	2	18
PSM	GIETPQCDQSTGQCVCVEGVEGPR	406	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,7-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.3638.3	34.9471	3	2743.114571	2742.108481	R	C	1138	1162
PSM	ATGANATPLDFPSK	407	sp|Q15637|SF01_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3859.3	40.64328	2	1510.6732	1510.6700	M	K	2	16
PSM	ADQLTEEQIAEFK	408	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4088.4	46.51618	2	1562.7511	1562.7459	M	E	2	15
PSM	SGDEMIFDPTMSK	409	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4398.3	53.71272	2	1578.6067	1578.5978	M	K	2	15
PSM	MNPVYSPGSSGVPYANAK	410	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4057.2	45.715	3	1959.8495	1959.8433	-	G	1	19
PSM	ADDVDQQQTTNTVEEPLDLIR	411	sp|P62310|LSM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4944.3	60.92788	3	2521.1382	2521.1212	M	L	2	23
PSM	HSGPNSADSANDGFVR	412	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3131.4	21.85317	3	1709.683271	1709.679492	K	L	99	115
PSM	SGKYDLDFKSPDDPSR	413	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3401.4	28.80528	3	1905.818171	1905.814588	R	Y	254	270
PSM	LDIDSPPITAR	414	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3662.2	35.52842	2	1276.608047	1276.606433	R	N	33	44
PSM	DSENLASPSEYPENGER	415	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3385.4	28.3875	3	1972.771271	1972.768760	R	F	617	634
PSM	TSAALSTVGSAISR	416	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3588.4	33.64485	2	1399.671647	1399.670825	K	K	140	154
PSM	GILAADESTGSIAK	417	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3553.4	32.73177	2	1411.657847	1411.659591	K	R	29	43
PSM	GEATVSFDDPPSAK	418	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3432.6	29.62183	2	1499.621647	1499.618120	K	A	335	349
PSM	GEATVSFDDPPSAK	419	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3424.5	29.40972	2	1499.621647	1499.618120	K	A	335	349
PSM	VPSPLEGSEGDGDTD	420	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3510.6	31.62797	2	1553.579247	1553.577043	K	-	413	428
PSM	ESVPEFPLSPPKKK	421	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3569.2	33.14253	3	1661.841671	1661.842975	K	D	30	44
PSM	SAPASPTHPGLMSPR	422	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	27.85803	3	1664.676971	1664.678309	R	S	416	431
PSM	NRPTSISWDGLDSGK	423	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3624.2	34.57498	3	1711.758971	1711.756680	K	L	48	63
PSM	TPKTPKGPSSVEDIK	424	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	23.17323	3	1742.791871	1742.789299	K	A	234	249
PSM	DKVDKSAVGFEYQGK	425	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3260.2	25.13307	3	1749.798971	1749.797482	K	T	204	219
PSM	VDCTAHSDVCSAQGVR	426	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3022.3	19.26287	3	1840.726571	1840.723348	K	G	119	135
PSM	GEAAAERPGEAAVASSPSK	427	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3002.4	18.81797	3	1863.837071	1863.836387	K	A	12	31
PSM	EVNVSPCPTQPCQLSK	428	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3380.4	28.25665	3	1922.829071	1922.826750	K	G	36	52
PSM	KSQIFSTASDNQPTVTIK	429	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3528.3	32.09177	3	2043.990671	2043.987802	K	V	447	465
PSM	IACKSPPPESVDTPTSTK	430	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3095.4	20.96715	3	2073.877871	2073.873106	K	Q	1127	1145
PSM	EHYPVSSPSSPSPPAQPGGVSR	431	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3350.5	27.4772	3	2378.999171	2378.993372	K	N	2036	2058
PSM	SVTSNQSDGTQESCESPDVLDR	432	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3360.6	27.74067	3	2489.991971	2489.985372	R	H	346	368
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	433	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3381.5	28.28613	4	2712.269694	2712.264371	K	T	139	165
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	434	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3473.5	30.67605	4	3093.286494	3093.277137	R	-	738	768
PSM	FDRGYISPYFINTSK	435	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3960.2	43.25905	3	1886.864771	1886.860416	K	G	219	234
PSM	EGLELLKTAIGK	436	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	40.24482	2	1350.718847	1350.715984	K	A	222	234
PSM	LDIDSPPITAR	437	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3788.3	38.78157	2	1356.573447	1356.572764	R	N	33	44
PSM	TVIIEQSWGSPK	438	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3747.2	37.74323	2	1423.676447	1423.674847	R	V	61	73
PSM	NLEQILNGGESPK	439	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3917.3	42.14508	2	1477.684247	1477.681389	K	Q	219	232
PSM	GNPTVEVDLFTSK	440	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3973.4	43.59805	2	1485.680247	1485.675241	R	G	16	29
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	441	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3921.6	42.25977	4	3014.200894	3014.188484	K	-	661	690
PSM	DLADELALVDVIEDK	442	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.5407.2	64.77165	3	1656.853271	1656.845798	K	L	43	58
PSM	GQLTNIVSPTAATTPR	443	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3721.2	37.0684	3	1785.804671	1785.806346	K	I	993	1009
PSM	RIDFIPVSPAPSPTR	444	sp|Q96E09|F122A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4080.2	46.29996	3	1811.841971	1811.837252	K	G	136	151
PSM	RTLDFDPLLSPASPK	445	sp|Q53H80|AKIR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4319.2	52.09185	3	1815.830171	1815.820934	K	R	9	24
PSM	NSDVLQSPLDSAARDEL	446	sp|Q8NBJ5|GT251_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4074.2	46.15082	3	1908.853271	1908.846617	K	-	606	623
PSM	AEELSPAALSPSLEPIR	447	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4254.2	50.68047	3	1938.885371	1938.874092	R	C	441	458
PSM	GNDISSGTVLSDYVGSGPPK	448	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4019.2	44.7288	3	2028.908771	2028.904132	K	G	94	114
PSM	AAPEASSPPASPLQHLLPGK	449	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3906.5	41.86377	3	2047.017071	2047.013957	K	A	686	706
PSM	AAPEASSPPASPLQHLLPGK	450	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4091.3	46.58392	3	2126.988671	2126.980288	K	A	686	706
PSM	DQLIYNLLKEEQTPQNK	451	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4169.4	48.53233	3	2153.048171	2153.040566	K	I	6	23
PSM	YLLSQSSPAPLTAAEEELR	452	sp|Q12792|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4384.3	53.38785	3	2154.037871	2154.024581	K	Q	137	156
PSM	DNLTLWTSDQQDDDGGEGNN	453	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4049.3	45.5117	3	2192.881271	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	454	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4041.2	45.2969	3	2192.881271	2192.873028	R	-	228	248
PSM	QQPPEPEWIGDGESTSPSDK	455	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3708.4	36.7345	3	2262.939971	2262.931803	K	V	7	27
PSM	DTPENNPDTPFDFTPENYK	456	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4077.4	46.23143	3	2319.933971	2319.920904	R	R	43	62
PSM	GRLTPSPDIIVLSDNEASSPR	457	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.4075.4	46.18205	3	2383.095071	2383.082187	R	S	117	138
PSM	AIVDALPPPCESACTVPTDVDK	458	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3918.4	42.1811	3	2434.092071	2434.079730	R	W	261	283
PSM	DAEAHPWLSDYDDLTSATYDK	459	sp|P50542|PEX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4155.2	48.21465	3	2492.019971	2492.005696	R	G	302	323
PSM	GGPGSAVSPYPTFNPSSDVAALHK	460	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4059.5	45.77738	3	2515.094471	2515.082187	K	A	30	54
PSM	SSSSESEDEDVIPATQCLTPGIR	461	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.3902.5	41.75993	3	2557.100171	2557.089109	R	T	996	1019
PSM	VEIIANDQGNRTTPSYVAFTDTER	462	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3859.2	40.63995	4	2776.280094	2776.270519	K	L	26	50
PSM	VSTTTDSPVSPAQAASPFIPLDELSSK	463	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4892.2	60.28977	3	2904.334271	2904.308283	K	-	261	288
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	464	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3824.3	39.72262	5	3464.587118	3464.574823	K	E	218	249
PSM	PEIVDTCSLASPASVCR	465	sp|P09960|LKHA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	7-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3768.3	38.2831	3	1940.8379	1940.8368	M	T	2	19
PSM	SDAAVDTSSEITTK	466	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3374.5	28.10323	2	1465.6810	1465.6779	M	D	2	16
PSM	SCINLPTVLPGSPSK	467	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4458.2	54.62198	3	1690.8073	1690.7996	M	T	2	17
PSM	QHEAPSNRPLNELLTPQGPSPR	468	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3802.2	39.14365	4	2580.1580	2580.1518	R	T	167	189
PSM	HEQNIDCGGGYVK	469	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3053.3	19.94605	3	1475.645771	1475.646327	K	L	99	112
PSM	KPALFPEPAKTAPPASPEAR	470	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3461.2	30.36167	4	2234.058494	2234.053787	R	K	527	547
PSM	KKPRPPPALGPEETSASAGLPK	471	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3297.3	26.09547	4	2307.1968941913206	2307.1987970448195	K	K	14	36
PSM	VLLPEYGGTK	472	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	34.90967	2	1155.560247	1155.557692	K	V	71	81
PSM	DKDDLGPDRFSTLTDDPSPR	473	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3672.2	35.78882	4	2326.015694	2326.011450	K	L	1002	1022
PSM	RTEGVGPGVPGEVEMVK	474	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3574.3	33.27647	3	1819.851071	1819.853951	R	G	16	33
PSM	ADTSQEICSPRLPISASHSSK	475	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3529.3	32.1144	4	2430.030894	2430.028771	K	T	1020	1041
PSM	VDSPTVTTTLK	476	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3317.3	26.61468	2	1240.594847	1240.595200	K	N	458	469
PSM	KITIADCGQLE	477	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3436.4	29.71975	2	1246.621847	1246.622738	K	-	155	166
PSM	DLEVTCDPDSGGSQGLR	478	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3551.3	32.6766	3	1884.757571	1884.756088	R	G	1319	1336
PSM	TSVQTEDDQLIAGQSAR	479	sp|P35221|CTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3421.3	29.32455	3	1897.843871	1897.841866	R	A	654	671
PSM	LSASTASELSPK	480	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3249.2	24.8581	2	1269.587247	1269.585364	R	S	451	463
PSM	DQVANSAFVER	481	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3328.4	26.90317	2	1314.562047	1314.560546	K	L	500	511
PSM	GPSPSSPTPPAAAAPAEQAPR	482	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3301.6	26.21005	3	2035.935071	2035.936435	R	A	103	124
PSM	TPQEWAPQTAR	483	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3270.4	25.3962	2	1363.594047	1363.592180	K	I	286	297
PSM	NGEVVHTPETSV	484	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3270.6	25.40287	2	1427.538647	1427.537107	K	-	454	466
PSM	NGEVVHTPETSV	485	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3286.5	25.81643	2	1427.538647	1427.537107	K	-	454	466
PSM	AQAAAPASVPAQAPK	486	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3154.6	22.43592	2	1456.708647	1456.707544	K	R	135	150
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	487	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21,22-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3666.4	35.6394	4	3037.302094	3037.291647	K	E	117	144
PSM	FQRPGDPQSAQDK	488	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3023.2	19.28865	3	1552.665071	1552.667136	K	A	294	307
PSM	GRTVIIEQSWGSPK	489	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3544.2	32.49033	3	1636.796471	1636.797422	K	V	59	73
PSM	MDATANDVPSPYEVR	490	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3465.6	30.47863	2	1759.717047	1759.712432	K	G	434	449
PSM	TDSVIIADQTPTPTR	491	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3530.3	32.14055	3	1773.761171	1773.758727	R	F	42	57
PSM	LKGEATVSFDDPPSAK	492	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3454.2	30.18147	3	1820.760671	1820.763478	K	A	333	349
PSM	DAPTSPASVASSSSTPSSK	493	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3170.4	22.84442	3	1842.793271	1842.788433	K	T	282	301
PSM	TDYNASVSVPDSSGPER	494	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3387.2	28.43273	3	1859.760971	1859.757467	R	I	70	87
PSM	GVQVETISPGDGRTFPK	495	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3568.4	33.1231	3	1866.8909	1866.8872	M	R	2	19
PSM	VKLDSPAGTALSPSGHTK	496	sp|P32322|P5CR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3322.5	26.75055	3	1924.873571	1924.869675	K	L	290	308
PSM	ERSPALKSPLQSVVVR	497	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3625.2	34.60117	3	1924.959071	1924.953679	R	R	246	262
PSM	VTAEADSSSPTGILATSESK	498	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3586.3	33.58949	3	2029.914971	2029.909277	K	S	486	506
PSM	ATESGAQSAPLPMEGVDISPK	499	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3631.6	34.7721	3	2179.977671	2179.970832	K	Q	8	29
PSM	QEEEAAQQGPVVVSPASDYK	500	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3468.5	30.55038	3	2210.980271	2210.973274	R	D	145	165
PSM	SSSPLPTVQLHPQSPTAGKK	501	sp|O60245|PCDH7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3463.3	30.41705	4	2219.039694	2219.038866	K	H	998	1018
PSM	SQSPAASDCSSSSSSASLPSSGR	502	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3089.5	20.8089	3	2278.905971	2278.900914	R	S	171	194
PSM	KKIEEAMDGSETPQLFTVLPEK	503	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3944.2	42.8434	4	2569.241294	2569.238673	K	R	769	791
PSM	SLNILTAFQK	504	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4983.2	61.44025	2	1293.583447	1293.577121	K	K	244	254
PSM	NGLQSCPIKEDSFLQR	505	sp|P00533|EGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3763.4	38.15642	3	1970.898071	1970.892128	R	Y	1053	1069
PSM	DINTFVGTPVEK	506	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3701.3	36.54872	2	1398.645847	1398.643213	K	L	1916	1928
PSM	ESVPEFPLSPPK	507	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4035.2	45.14197	3	1405.651271	1405.653049	K	K	30	42
PSM	ESVPEFPLSPPK	508	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4026.3	44.91153	2	1405.657847	1405.653049	K	K	30	42
PSM	LLPYPTLASPASD	509	sp|P0C1Z6|TFPT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4300.2	51.69067	2	1423.670047	1423.663614	K	-	241	254
PSM	EGFSIPVSADGFK	510	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4179.2	48.78368	2	1432.633047	1432.627563	K	F	1887	1900
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	511	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3728.2	37.2489	4	2933.366494	2933.357299	K	K	62	95
PSM	NLEQILNGGESPK	512	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3924.3	42.32835	2	1477.684247	1477.681389	K	Q	219	232
PSM	GALQNIIPASTGAAK	513	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3758.5	38.03103	2	1490.752447	1490.749409	R	A	201	216
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	514	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3808.4	39.30728	4	2989.550894	2989.541321	K	G	202	228
PSM	TSDIFGSPVTATSR	515	sp|Q9H910|JUPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3733.4	37.38626	2	1517.678647	1517.676304	K	L	91	105
PSM	GNPTVEVDLFTSK	516	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4153.2	48.18145	2	1565.649847	1565.641572	R	G	16	29
PSM	GRLTPSPDIIVLSDNEASSPR	517	sp|Q8WXI9|P66B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.4067.5	45.98605	3	2383.095071	2383.082187	R	S	117	138
PSM	VSMPDVELNLKSPK	518	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3827.2	39.79787	3	1635.794471	1635.794311	K	V	3415	3429
PSM	CELLSDDSLAVSSPR	519	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3830.2	39.87682	3	1727.741471	1727.743732	K	L	292	307
PSM	NWTEDMEGGISSPVK	520	sp|P08651|NFIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3822.2	39.66693	3	1728.711971	1728.706618	R	K	312	327
PSM	DSLSPVLHPSDLILTR	521	sp|Q9HCN4|GPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4343.3	52.61212	3	1841.937371	1841.928830	K	G	311	327
PSM	IYSFTDNAPSPSIGGSSR	522	sp|O15014|ZN609_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3779.2	38.54825	3	1934.841071	1934.841138	K	L	795	813
PSM	AEELSPAALSPSLEPIR	523	sp|Q12774|ARHG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4245.3	50.46404	3	1938.885371	1938.874092	R	C	441	458
PSM	DTMSDQALEALSASLGTR	524	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4496.2	55.30583	3	1944.860471	1944.849988	K	Q	284	302
PSM	DYNPYNYSDSISPFNK	525	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4061.2	45.8198	3	2002.803071	2002.798604	R	S	1018	1034
PSM	GSLESPATDVFGSTEEGEK	526	sp|O00232|PSD12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3901.3	41.72718	3	2018.837471	2018.835777	K	R	331	350
PSM	DRDVTFSPATIENELIK	527	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4534.2	55.89235	3	2026.969571	2026.961253	K	F	46	63
PSM	FSGWYDADLSPAGHEEAK	528	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3810.2	39.35278	3	2058.843971	2058.836052	R	R	22	40
PSM	QEQINTEPLEDTVLSPTK	529	sp|O15446|RPA34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3928.4	42.43598	3	2120.992871	2120.987861	K	K	271	289
PSM	KGEQTSSGTLSAFASYFNSK	530	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4213.2	49.66503	3	2188.977371	2188.967795	R	V	670	690
PSM	AGSPRGSPLAEGPQAFFPER	531	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4135.2	47.72562	3	2229.971471	2229.960950	R	G	181	201
PSM	IADPEHDHTGFLTEYVATR	532	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3787.3	38.75542	3	2330.968871	2330.961009	R	W	190	209
PSM	QLSSTSPLAPYPTSQMVSSDR	533	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3864.3	40.7748	3	2331.054071	2331.045393	R	S	408	429
PSM	AVFVDLEPTVIDEVRTGTYR	534	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4289.4	51.46033	3	2359.161671	2359.146093	R	Q	65	85
PSM	VPPAPVPCPPPSPGPSAVPSSPK	535	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3754.6	37.93023	3	2378.088371	2378.078288	K	S	366	389
PSM	YGKDATNVGDEGGFAPNILENK	536	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3841.4	40.17238	3	2388.070871	2388.063486	K	E	200	222
PSM	ADLLLSTQPGREEGSPLELER	537	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3971.2	43.5423	3	2389.164971	2389.152635	K	L	593	614
PSM	APSEEDSLSSVPISPYKDEPWK	538	sp|Q9Y676|RT18B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3984.2	43.86177	4	2540.141694	2540.135982	K	Y	36	58
PSM	DNLTLWTADNAGEEGGEAPQEPQS	539	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4332.2	52.33567	3	2608.078871	2608.060251	R	-	225	249
PSM	DNSDFDLLTVSETANEPPQDEGNSFNSPR	540	sp|O15371|EIF3D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	27-UNIMOD:21	ms_run[1]:scan=1.1.4486.2	55.0804	4	3274.382494	3274.357556	R	N	282	311
PSM	IACRSPQPDPVGTPTIFKPQSK	541	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3652.2	35.2757	4	2583.199294	2583.195777	K	R	2219	2241
PSM	MEGPLSVFGDR	542	sp|P17987|TCPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.4425.2	54.1076	2	1344.5477	1344.5416	-	S	1	12
PSM	AADVSVTHRPPLSPK	543	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.3439.3	29.7945	3	1695.8347	1695.8340	M	S	2	17
PSM	SYTPGVGGDPAQLAQR	544	sp|O15400|STX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3836.2	40.03442	3	1737.7687	1737.7718	M	I	2	18
PSM	MESAIAEGGASR	545	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3721.3	37.07173	2	1299.5181	1299.5161	-	F	1	13
PSM	NVSIGIVGK	546	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3606.2	34.10489	2	965.490247	965.494698	K	D	209	218
PSM	SAGLFQNPK	547	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3401.2	28.79862	2	1040.468847	1040.469212	R	Q	233	242
PSM	TPSPKEEDEEPESPPEKK	548	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2937.2	17.70222	4	2131.924094	2131.919841	K	T	202	220
PSM	YNLQEVVKSPKDPSQLNSK	549	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3520.2	31.87638	4	2253.101694	2253.104229	K	Q	262	281
PSM	IDEMPEAAVKSTANK	550	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.3113.4	21.399	3	1698.759971	1698.753568	R	Y	30	45
PSM	KKPRPPPALGPEETSASAGLPK	551	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3313.3	26.51043	4	2307.1972941913205	2307.1987970448195	K	K	14	36
PSM	DPNSPLYSVK	552	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3435.2	29.68708	2	1198.527847	1198.527120	R	S	82	92
PSM	VEIIANDQGNR	553	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3158.4	22.53342	2	1227.621047	1227.620764	R	I	50	61
PSM	GSTIETEQKEDKGEDSEPVTSK	554	sp|Q8N8S7|ENAH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2978.2	18.29248	4	2473.076894	2473.074504	K	A	462	484
PSM	ALINSPEGAVGR	555	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3506.2	31.51043	2	1262.601847	1262.602017	R	S	66	78
PSM	LGMLSPEGTCK	556	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3532.2	32.18895	2	1271.529647	1271.529111	R	A	203	214
PSM	QHEAPSNRPLNELLTPQGPSPR	557	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3627.3	34.65702	4	2597.184494	2597.178881	R	T	167	189
PSM	ISVYYNEATGGK	558	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3335.4	27.08483	2	1300.629247	1300.629932	R	Y	47	59
PSM	EDQTEYLEER	559	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3240.2	24.63877	2	1310.563847	1310.562640	K	R	166	176
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	560	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3483.3	30.91778	4	2637.346094	2637.341499	R	R	31	56
PSM	TPSPKEEDEEPESPPEK	561	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3009.2	18.975	3	2003.826671	2003.824878	K	K	202	219
PSM	AVADAIRTSLGPK	562	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3405.3	28.90662	2	1377.703047	1377.701731	K	G	43	56
PSM	IIYGGSVTGATCK	563	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3365.4	27.8647	2	1405.631047	1405.631268	R	E	244	257
PSM	FQTGNKSPEVLR	564	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3204.2	23.71795	3	1454.688971	1454.691894	R	A	432	444
PSM	KLEDVKNSPTFK	565	sp|P55327|TPD52_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3112.2	21.36625	3	1484.728271	1484.727611	K	S	164	176
PSM	TPSPKEEDEEPESPPEK	566	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3015.2	19.12512	4	2003.827694	2003.824878	K	K	202	219
PSM	IKEEEPVEVDSSPPDSPASSPCSPPLK	567	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21,20-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3635.5	34.87098	4	3037.306094	3037.291647	K	E	117	144
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	568	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3511.5	31.651	4	3162.512494	3162.502310	K	E	179	210
PSM	SWHDVQVSSAYVK	569	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3550.2	32.64717	3	1584.693671	1584.697374	R	T	96	109
PSM	ETPHSPGVEDAPIAK	570	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3204.4	23.72462	3	1626.729071	1626.729068	R	V	486	501
PSM	APGTPHSHTKPYVR	571	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2845.2	16.81827	4	1626.767294	1626.766791	K	S	155	169
PSM	ALSRQEMQEVQSSR	572	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3137.3	21.98627	3	1727.770271	1727.766198	K	S	187	201
PSM	DTGKTPVEPEVAIHR	573	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3273.4	25.474	3	1727.822471	1727.824365	K	I	5	20
PSM	EQGPYETYEGSPVSK	574	sp|P23921|RIR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3304.6	26.28912	2	1749.713447	1749.713477	K	G	549	564
PSM	GVQVETISPGDGRTFPK	575	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3560.4	32.91333	3	1866.8909	1866.8872	M	R	2	19
PSM	SERPPTILMTEEPSSPK	576	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3590.2	33.69063	3	1977.913871	1977.911860	K	G	1080	1097
PSM	VKLESPTVSTLTPSSPGK	577	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3613.4	34.29345	3	2066.902271	2066.897937	R	L	290	308
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	578	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3461.5	30.37167	3	2268.874871	2268.864409	R	S	326	351
PSM	DKRPLSGPDVGTPQPAGLASGAK	579	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3407.3	28.95895	4	2298.141694	2298.136926	R	L	176	199
PSM	GSLAEAVGSPPPAATPTPTPPTR	580	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3668.4	35.69102	3	2331.062171	2331.054910	R	K	446	469
PSM	ITRKPVTVSPTTPTSPTEGEAS	581	sp|Q9Y6G9|DC1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3272.6	25.45477	3	2415.102971	2415.097168	R	-	502	524
PSM	ELEREESGAAESPALVTPDSEK	582	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3363.6	27.81895	3	2423.081171	2423.074110	K	S	173	195
PSM	NGSLDSPGKQDTEEDEEEDEK	583	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3006.3	18.91822	3	2429.928371	2429.923149	K	D	134	155
PSM	ELEREESGAAESPALVTPDSEK	584	sp|Q96EK9|KTI12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3361.3	27.75682	3	2503.048271	2503.040441	K	S	173	195
PSM	DGVVEITGKHEERQDEHGYISR	585	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3231.2	24.40655	5	2553.227118	2553.220792	K	C	115	137
PSM	QEMQEVQSSRSGRGGNFGFGDSR	586	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3441.4	29.84975	4	2675.062494	2675.058508	R	G	191	214
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	587	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3532.4	32.19562	4	2717.314094	2717.307830	R	R	31	56
PSM	ELAQRQEEEAAQQGPVVVSPASDYK	588	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3494.3	31.20105	4	2808.304094	2808.296734	K	D	140	165
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	589	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3254.5	24.99107	4	2968.368094	2968.358028	R	L	420	447
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	590	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3038.2	19.62697	4	3024.357694	3024.356099	K	S	145	174
PSM	TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	591	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3494.5	31.20772	4	3340.237294	3340.220589	R	G	294	325
PSM	ALLLLCGEDD	592	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4170.2	48.56535	2	1117.533247	1117.532526	K	-	311	321
PSM	DLNVLTPTGF	593	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4842.2	59.68758	2	1155.524647	1155.521307	R	-	296	306
PSM	DLNVLTPTGF	594	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4823.2	59.48273	2	1155.524647	1155.521307	R	-	296	306
PSM	VLPGVDALSNI	595	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4535.2	55.91807	2	1176.582647	1176.579156	K	-	407	418
PSM	SYELPDGQVITIGNER	596	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4029.3	44.98957	3	1789.888571	1789.884643	K	F	241	257
PSM	SQIFSTASDNQPTVTIK	597	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3731.3	37.33085	3	1915.896671	1915.892839	K	V	448	465
PSM	LDIDSPPITAR	598	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3733.2	37.3796	2	1276.607847	1276.606433	R	N	33	44
PSM	EVYELLDSPGK	599	sp|P22234|PUR6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3768.4	38.28643	2	1328.593047	1328.590115	K	V	20	31
PSM	GLGLSPDLVVCR	600	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.4115.2	47.20667	2	1364.656847	1364.652338	R	C	206	218
PSM	IMNTFSVVPSPK	601	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3900.3	41.70115	2	1398.662247	1398.661840	R	V	163	175
PSM	WPDPEDLLTPR	602	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4309.3	51.86798	2	1417.633447	1417.627897	R	W	39	50
PSM	IILDLISESPIK	603	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4461.2	54.66987	2	1419.768247	1419.762600	K	G	208	220
PSM	QLLSASYEFQR	604	sp|Q8WWC4|MAIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3911.3	41.9978	2	1420.635847	1420.638796	K	E	259	270
PSM	NEDGTWPRGPSTPKSPGASNFSTLPK	605	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3714.4	36.89188	4	2887.265694	2887.257920	K	I	215	241
PSM	ASGQAFELILSPR	606	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4196.3	49.2203	2	1467.720647	1467.712296	R	S	15	28
PSM	YHTSQSGDEMTSLSEYVSR	607	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3737.4	37.49063	3	2255.912171	2255.904208	R	M	457	476
PSM	NIEIDSPYEISR	608	sp|P04843|RPN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3759.4	38.05355	2	1514.669447	1514.665405	K	A	380	392
PSM	DSPESPFEVIIDK	609	sp|O95197|RTN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4341.2	52.55387	3	1554.688571	1554.685472	K	A	242	255
PSM	GALQNIIPASTGAAK	610	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3914.4	42.06997	2	1570.719247	1570.715740	R	A	201	216
PSM	DKNTPSPFIETFTEDDEASR	611	sp|P48506|GSH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4059.4	45.77405	3	2378.006171	2377.995132	K	A	210	230
PSM	AIVDALPPPCESACTVPTDVDK	612	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3934.4	42.59233	3	2434.092071	2434.079730	R	W	261	283
PSM	SAPELKTGISDVFAK	613	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3841.2	40.16572	3	1641.804971	1641.801505	K	N	319	334
PSM	RASGQAFELILSPR	614	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4158.2	48.29148	3	1703.786171	1703.779738	K	S	14	28
PSM	SSGSEGSSPNWLQALK	615	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4126.2	47.4898	3	1726.762271	1726.756345	K	L	1708	1724
PSM	NSPEDLGLSLTGDSCK	616	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3838.2	40.08672	3	1771.736471	1771.733561	K	L	499	515
PSM	YEQGFITDPVVLSPK	617	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4161.2	48.35525	3	1771.845071	1771.843369	K	D	110	125
PSM	QVPDSAATATAYLCGVK	618	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3899.2	41.6719	3	1830.824171	1830.822317	R	A	107	124
PSM	CIPALDSLTPANEDQK	619	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3797.3	39.01772	3	1850.814071	1850.812146	R	I	447	463
PSM	GADFLVTEVENGGSLGSK	620	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4202.2	49.373	3	1858.840271	1858.834990	K	K	189	207
PSM	VAPEEHPVLLTEAPLNPK	621	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3684.2	36.10207	3	1953.061571	1953.057128	R	A	96	114
PSM	SSTPPGESYFGVSSLQLK	622	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4225.4	49.96218	3	1962.906971	1962.897590	K	G	1041	1059
PSM	SVPTSTVFYPSDGVATEK	623	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3842.4	40.19892	3	1963.884671	1963.881605	R	A	439	457
PSM	ADSGPTQPPLSLSPAPETK	624	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3677.5	35.92967	3	1971.920171	1971.919054	R	R	2071	2090
PSM	DMDEPSPVPNVEEVTLPK	625	sp|Q8TAQ2|SMRC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4140.2	47.85965	3	2074.922171	2074.917005	K	T	342	360
PSM	DKPTYDEIFYTLSPVNGK	626	sp|Q9H4M9|EHD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4187.3	48.99458	3	2166.003071	2165.992219	K	I	444	462
PSM	DLLLTSSYLSDSGSTGEHTK	627	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3983.2	43.8374	3	2189.980271	2189.972940	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	628	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4025.3	44.8855	3	2192.881271	2192.873028	R	-	228	248
PSM	YLLSQSSPAPLTAAEEELR	629	sp|Q12792|TWF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4673.2	57.92457	3	2234.001371	2233.990912	K	Q	137	156
PSM	DDDIAALVVDNGSGMCK	630	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,13-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.4700.2	58.27443	2	1900.7712	1900.7582	M	A	2	19
PSM	NGRVEIIANDQGNRITPSYVAFTPEGER	631	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3860.4	40.67302	4	3183.522094	3182.514606	K	L	47	75
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	632	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3755.6	37.95625	3	2508.0892	2508.0762	M	R	2	32
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	633	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.4117.5	47.26877	3	2749.2532	2749.2302	-	Y	1	25
PSM	QVVSVVQDEEVGLPFEASPESPPPASPDGVTEIR	634	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21,26-UNIMOD:21	ms_run[1]:scan=1.1.4939.2	60.8387	4	3720.720894	3720.684901	K	G	621	655
PSM	QLSSGVSEIR	635	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	39.77153	2	1137.5035	1137.5062	R	H	80	90
PSM	TEWETAAPAVAETPDIK	636	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4285.2	51.34748	3	2029.8413	2029.8318	M	L	2	19
PSM	RIDFTPVSPAPSPTR	637	sp|Q7Z309|F122B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3696.4	36.4214	3	1799.799371	1799.800867	K	G	108	123
PSM	VTNGAFTGEISPGMIK	638	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4030.3	45.01558	3	1701.771971	1700.784474	K	D	107	123
PSM	LSDGVAVLK	639	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3352.2	27.5191	2	900.526247	900.528033	K	V	397	406
PSM	AGFAGDDAPR	640	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3072.2	20.38665	2	975.439247	975.441009	K	A	21	31
PSM	SEVQQPVHPKPLSPDSR	641	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3159.2	22.55277	4	1979.947294	1979.946606	K	A	350	367
PSM	FLMECRNSPVTK	642	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	27.18225	3	1560.682271	1560.682986	K	T	58	70
PSM	KVEEEGSPGDPDHEASTQGR	643	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2893.2	17.20572	4	2203.901294	2203.901900	R	T	309	329
PSM	YGVQADRVDKSAVGFDYQGK	644	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3504.3	31.46147	4	2282.038894	2282.036877	K	T	162	182
PSM	SAVGFDYQGK	645	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3401.3	28.80195	2	1150.470847	1150.469606	K	T	172	182
PSM	IFQKGESPVDYDGGR	646	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3316.5	26.59492	3	1746.759071	1746.761431	K	T	242	257
PSM	GNDPLTSSPGR	647	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3129.5	21.80505	2	1179.492247	1179.492132	R	S	20	31
PSM	SLSSQIETMRSPDGSK	648	sp|P05997|CO5A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3432.3	29.61183	3	1801.791371	1801.791745	K	K	1274	1290
PSM	LEGQGDVPTPK	649	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3168.3	22.78927	2	1219.550847	1219.548584	K	Q	257	268
PSM	GEQVSQNGLPAEQGSPR	650	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3192.3	23.4099	3	1832.805971	1832.805421	K	M	2124	2141
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	651	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3468.2	30.54038	4	2449.052494	2449.048187	R	A	90	114
PSM	EAESSPFVER	652	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3207.3	23.79923	2	1229.497447	1229.496549	K	L	548	558
PSM	AVEHINKTIAPALVSK	653	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3440.3	29.8204	3	1849.911071	1849.910417	K	K	65	81
PSM	NFSDNQLQEGK	654	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3156.4	22.48128	2	1278.582647	1278.584044	R	N	161	172
PSM	ASPEPQRENASPAPGTTAEEAMSR	655	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3288.4	25.86543	4	2563.103694	2563.101011	R	G	963	987
PSM	GGSGSGPTIEEVD	656	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3473.2	30.66605	2	1283.493647	1283.491857	K	-	629	642
PSM	DSAQNSVIIVDK	657	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3365.3	27.86137	2	1287.667247	1287.667045	K	N	194	206
PSM	ELISNSSDALDK	658	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3318.5	26.64743	2	1290.628247	1290.630326	R	I	47	59
PSM	SSPNPFVGSPPK	659	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3447.5	30.00998	2	1292.582047	1292.580219	K	G	393	405
PSM	AGGPTTPLSPTR	660	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3169.5	22.82187	2	1313.541847	1313.541799	R	L	15	27
PSM	DGGRSSPGGQDEGGFMAQGK	661	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3226.5	24.28627	3	2016.804671	2016.799683	R	T	298	318
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	662	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3590.3	33.69397	4	2727.239694	2727.234862	R	G	70	97
PSM	ELISNSSDALDK	663	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3428.3	29.50733	2	1370.599047	1370.596657	R	I	47	59
PSM	VLQATVVAVGSGSK	664	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3474.3	30.69467	2	1394.718447	1394.717047	K	G	41	55
PSM	NGEVVHTPETSV	665	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3278.5	25.60748	2	1427.538647	1427.537107	K	-	454	466
PSM	ERSPALKSPLQSVVVR	666	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3627.2	34.65368	4	1924.954094	1924.953679	R	R	246	262
PSM	NAEAVLQSPGLSGK	667	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3462.3	30.39098	2	1449.689047	1449.686475	R	V	849	863
PSM	VDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	668	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3629.6	34.71955	4	2925.357294	2925.350560	K	A	461	493
PSM	DVSGPMPDSYSPR	669	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3453.4	30.16262	2	1486.581447	1486.579961	K	Y	291	304
PSM	LYGSAGPPPTGEEDTAEKDEL	670	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3642.4	35.0368	3	2254.959671	2254.951870	K	-	634	655
PSM	SLYASSPGGVYATR	671	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3516.5	31.7816	2	1507.675447	1507.670825	R	S	51	65
PSM	SARDHAISLSEPR	672	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3187.3	23.27972	3	1517.697071	1517.698771	R	M	792	805
PSM	ALSSDSILSPAPDAR	673	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3668.5	35.69435	2	1578.732847	1578.729068	R	A	392	407
PSM	DMESPTKLDVTLAK	674	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3547.3	32.57197	3	1642.753571	1642.752506	K	D	277	291
PSM	AQQATPGGAAPTIFSR	675	sp|Q9BX68|HINT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3649.5	35.21118	2	1651.773847	1651.771936	K	I	43	59
PSM	ESVPEFPLSPPKKK	676	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3561.2	32.93287	3	1661.841671	1661.842975	K	D	30	44
PSM	WLKSPTTPIDPEK	677	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3639.2	34.95785	3	1670.739371	1670.735807	K	Q	859	872
PSM	IADPEHDHTGFLTEYVATR	678	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3670.2	35.73667	4	2251.002094	2250.994678	R	W	190	209
PSM	LIAPVAEEEATVPNNK	679	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3532.6	32.20228	2	1693.894847	1693.888666	K	I	8	24
PSM	EALLSSAVDHGSDEVK	680	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3574.2	33.27313	3	1735.770371	1735.766576	R	F	139	155
PSM	EQPPTEPGPQSASEVEK	681	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3199.5	23.59818	3	1888.811171	1888.809169	R	I	393	410
PSM	GPSTPKSPGASNFSTLPK	682	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3491.3	31.12278	3	1931.844671	1931.843126	R	I	223	241
PSM	SHSPSSPDPDTPSPVGDSR	683	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3067.4	20.27082	3	2000.811971	2000.811294	R	A	616	635
PSM	AQTPPGPSLSGSKSPCPQEK	684	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3151.4	22.35135	3	2131.963871	2131.960935	K	S	1001	1021
PSM	TVGTPIASVPGSTNTGTVPGSEK	685	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3574.6	33.28647	3	2236.067171	2236.062423	R	D	270	293
PSM	AGEEDEGEEDSDSDYEISAK	686	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3291.5	25.9471	3	2253.801371	2253.795823	R	A	463	483
PSM	HGGPGPGGPEPELSPITEGSEAR	687	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3564.6	33.0245	3	2307.024071	2307.016870	R	A	554	577
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDKLPR	688	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	21-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3587.5	33.62222	4	2991.339694	2991.328110	R	V	221	251
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	689	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3406.6	28.94277	4	3351.414894	3351.401211	R	A	108	139
PSM	DVQTALALAK	690	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3857.2	40.58693	2	1108.553247	1108.552941	K	G	70	80
PSM	ESAFEFLSSA	691	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4844.2	59.7322	2	1166.457447	1166.453287	K	-	325	335
PSM	NQYDNDVTVWSPQGR	692	sp|P25786|PSA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3693.3	36.3394	3	1857.769271	1857.768307	R	I	4	19
PSM	SADTLWDIQK	693	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3908.2	41.90607	2	1255.550047	1255.548584	K	D	320	330
PSM	DGPNALTPPPTTPEWIK	694	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4096.2	46.71467	3	1912.901771	1912.897196	R	F	75	92
PSM	TLTPISAAYAR	695	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3746.2	37.71893	2	1322.567647	1322.567285	K	A	295	306
PSM	TLPLTTAPEAGEVTPSDSGGQEDSPAK	696	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3830.5	39.88682	4	2814.196494	2814.188562	K	G	2233	2260
PSM	ISEEQQQLQQALAPAQASSNSSTPTR	697	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3779.4	38.55492	4	2849.327294	2849.319260	K	M	9	35
PSM	EFSPFGSITSAK	698	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4302.2	51.74178	2	1429.563247	1429.556780	K	V	313	325
PSM	GYISPYFINTSK	699	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4063.2	45.87203	3	1468.664171	1468.663948	R	G	222	234
PSM	SEPERGRLTPSPDIIVLSDNEASSPR	700	sp|Q8WXI9|P66B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3891.6	41.47635	4	2981.364094	2981.353277	R	S	112	138
PSM	ILTPLVSLDTPGK	701	sp|Q9HC38|GLOD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.5089.2	62.28022	2	1512.735647	1512.724180	K	A	240	253
PSM	GPVSPSVSFQPLAR	702	sp|Q7Z434|MAVS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3932.3	42.537	2	1520.741247	1520.738845	R	S	219	233
PSM	DMSPLSETEMALGK	703	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4256.3	50.7391	2	1587.664247	1587.656162	K	D	505	519
PSM	IIAFVGSPVEDNEK	704	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3851.5	40.4392	2	1596.750647	1596.743655	R	D	109	123
PSM	RASGQAFELILSPR	705	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3919.2	42.19413	3	1623.816071	1623.813407	K	S	14	28
PSM	NREPLMPSPQFIK	706	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3807.2	39.27431	3	1635.785771	1635.784415	K	S	246	259
PSM	NREPLMPSPQFIK	707	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3815.2	39.48314	3	1635.785771	1635.784415	K	S	246	259
PSM	APNTPDILEIEFKK	708	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3989.2	43.98428	3	1693.838171	1693.832805	K	G	216	230
PSM	DASDDLDDLNFFNQK	709	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4379.3	53.26645	3	1755.763571	1755.758774	K	K	65	80
PSM	NQLTSNPENTVFDAK	710	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3717.5	36.97372	2	1756.773247	1756.766910	K	R	82	97
PSM	DDGLFSGDPNWFPKK	711	sp|P37802|TAGL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4235.3	50.2193	3	1801.779671	1801.771267	R	S	140	155
PSM	QVPDSAATATAYLCGVK	712	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3891.4	41.46968	3	1830.824171	1830.822317	R	A	107	124
PSM	VVVAENFDEIVNNENK	713	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3855.3	40.53762	3	1831.897571	1831.895208	K	D	380	396
PSM	AQSPGAVEEILDRENK	714	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3763.2	38.14975	3	1834.848671	1834.846223	R	R	7	23
PSM	ASSTSPVEISEWLDQK	715	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4297.2	51.60253	3	1855.828571	1855.824091	K	L	188	204
PSM	DRSSFYVNGLTLGGQK	716	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4017.2	44.67988	3	1900.819871	1900.812160	K	C	55	71
PSM	TDGFAEAIHSPQVAGVPR	717	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3726.3	37.20053	3	1930.896671	1930.893842	R	F	2146	2164
PSM	YVASYLLAALGGNSSPSAK	718	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4677.2	57.98727	3	1947.945671	1947.934310	R	D	3	22
PSM	NASTFEDVTQVSSAYQK	719	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3719.4	37.02273	3	1953.840971	1953.835718	K	T	320	337
PSM	NASTFEDVTQVSSAYQK	720	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3711.4	36.81307	3	1953.840971	1953.835718	K	T	320	337
PSM	QIESKTAFQEALDAAGDK	721	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3857.3	40.59027	3	2000.914271	2000.909217	K	L	4	22
PSM	KLDPDSIPSPIQVIENDR	722	sp|O94855|SC24D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4169.2	48.52567	3	2115.033371	2115.024916	K	A	258	276
PSM	AAPEASSPPASPLQHLLPGK	723	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4066.4	45.95662	3	2126.988671	2126.980288	K	A	686	706
PSM	LGGSPTSLGTWGSWIGPDHDK	724	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4265.2	50.96605	3	2247.011171	2246.999763	K	F	439	460
PSM	TLEAEFNSPSPPTPEPGEGPR	725	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3744.4	37.67378	3	2288.007971	2287.999823	K	K	525	546
PSM	SPWSNKYDPPLEDGAMPSAR	726	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3780.4	38.57927	3	2296.989971	2296.982399	R	L	73	93
PSM	ADEASELACPTPKEDGLAQQQTQLNLR	727	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3788.4	38.7849	4	3062.411694	3062.401610	K	S	2194	2221
PSM	FVEWLQNAEEESESEGEEN	728	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4301.2	51.71622	3	2333.899571	2333.884913	K	-	401	420
PSM	AIVDALPPPCESACTVPTDVDK	729	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3942.5	42.8025	3	2434.092071	2434.079730	R	W	261	283
PSM	NVMSAFGLTDDQVSGPPSAPAEDR	730	sp|Q92734|TFG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4261.2	50.86562	3	2540.103071	2540.089049	K	S	180	204
PSM	EGPYDVVVLPGGNLGAQNLSESAAVK	731	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4374.2	53.14565	3	2663.300471	2663.284378	K	E	64	90
PSM	QREEYQPATPGLGMFVEVKDPEDK	732	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3974.3	43.61965	4	2842.297694	2842.288477	K	V	72	96
PSM	AFQYVETHGEVCPANWTPDSPTIKPSPAASK	733	sp|P30048|PRDX3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3815.4	39.4898	5	3464.587118	3464.574823	K	E	218	249
PSM	ALTQPSPVSTPSSVQFFLQEDDSADRKAER	734	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4145.2	47.99982	5	3465.568618	3465.549076	R	T	139	169
PSM	ENSSSSSTPLSNGPLNGDVDYFGQQFDQISNR	735	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4672.3	57.89952	4	3540.528894	3539.511431	K	T	322	354
PSM	ADLSLADALTEPSPDIEGEIKR	736	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4703.2	58.312	3	2461.1812	2461.1622	M	D	2	24
PSM	MDSAGQDINLNSPNK	737	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3440.2	29.81707	3	1740.7037	1740.7021	-	G	1	16
PSM	NGSLDSPGKQDTEEDEEEDEKDK	738	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3049.5	19.85037	4	2674.039694	2673.045055	K	G	134	157
PSM	ASGVAVSDGVIK	739	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3611.2	34.23487	2	1143.6119	1143.6130	M	V	2	14
PSM	GGPGSAVSPYPTFNPSSDVAALHK	740	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3914.2	42.0633	4	2436.109694	2435.115856	K	A	30	54
PSM	AAAMDVDTPSGTNSGAGK	741	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3455.6	30.22013	2	1770.7143	1770.7126	M	K	2	20
PSM	SHSPSSPDPDTPSPVGDSR	742	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3093.4	20.90893	3	2080.782971	2080.777625	R	A	616	635
PSM	SSSPAPADIAQTVQEDLR	743	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4335.2	52.41367	3	1964.882171	1963.888816	K	T	230	248
PSM	EFSPFGTITSAK	744	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4286.2	51.38315	2	1443.578047	1443.572430	K	V	313	325
PSM	SPASPRVPPVPDYVAHPER	745	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3579.2	33.40408	4	2150.028894	2150.031004	R	W	143	162
PSM	LTFDSSFSPNTGKK	746	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3560.2	32.90667	3	1607.725871	1607.723254	K	N	97	111
PSM	PYQYPALTPEQKK	747	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3354.2	27.57112	3	1641.7814	1641.7799	M	E	2	15
PSM	SAHVTVSGGTPKGEAVLGTHK	748	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3236.2	24.53662	4	2192.006894	2192.002814	K	L	305	326
PSM	RLSSSSATLLNSPDR	749	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	26.48167	3	1682.796671	1682.798879	K	A	198	213
PSM	SSGPYGGGGQYFAKPR	750	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3373.2	28.06715	3	1707.741971	1707.740636	R	N	337	353
PSM	YIDQEELNK	751	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3153.3	22.39997	2	1150.551447	1150.550619	K	T	198	207
PSM	NRSNTPILVDGKDVMPEVNK	752	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3609.2	34.18332	4	2305.112094	2305.113747	R	V	105	125
PSM	QLSSGVSEIR	753	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3347.2	27.38927	2	1154.534447	1154.533268	R	H	80	90
PSM	NLEQILNGGESPKQK	754	sp|Q13033|STRN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3660.2	35.47623	3	1733.837471	1733.834930	K	G	219	234
PSM	VLLPEYGGTK	755	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3646.2	35.12717	2	1155.560247	1155.557692	K	V	71	81
PSM	KKPGDASSLPDAGLSPGSQVDSK	756	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3349.2	27.44127	4	2320.097294	2320.094786	K	S	1391	1414
PSM	LITPAVVSER	757	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3629.4	34.71288	2	1163.594847	1163.595140	K	L	67	77
PSM	SNVSDAVAQSTR	758	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3097.4	21.0124	2	1233.593047	1233.594943	K	I	232	244
PSM	ETERASPIKMDLAPSK	759	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3367.3	27.91353	3	1851.883271	1851.880166	K	D	353	369
PSM	NKSPAAVTEPETNKFDSTGYDK	760	sp|O75449|KTNA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3303.5	26.25957	4	2478.094494	2478.095180	K	D	168	190
PSM	EAAAQEAGADTPGKGEPPAPKSPPK	761	sp|O95466|FMNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3083.2	20.65773	4	2480.164094	2480.158449	K	A	1010	1035
PSM	EQVANSAFVER	762	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3237.3	24.56568	2	1248.611247	1248.609865	K	V	365	376
PSM	ALINSPEGAVGR	763	sp|O00115|DNS2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3498.2	31.30178	2	1262.601847	1262.602017	R	S	66	78
PSM	CSGPGLSPGMVR	764	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3505.3	31.48763	2	1296.537247	1296.535594	K	A	1453	1465
PSM	TRSWDSSSPVDRPEPEAASPTTR	765	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3295.4	26.04665	4	2608.158894	2608.155489	R	T	352	375
PSM	SAESPTSPVTSETGSTFK	766	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3647.2	35.15173	3	1971.779771	1971.775165	K	K	280	298
PSM	TYGEPESAGPSR	767	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3019.2	19.22558	2	1329.523247	1329.523826	R	A	104	116
PSM	NGNTNSLNLSSPNPMENK	768	sp|Q9UPQ9|TNR6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3584.4	33.54138	3	2009.855771	2009.851385	K	G	375	393
PSM	ADGYEPPVQESV	769	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3594.4	33.80013	2	1369.548447	1369.543893	R	-	253	265
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	770	sp|Q9NTJ3|SMC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3138.6	22.02215	4	2750.202094	2750.193331	R	T	13	39
PSM	ASPGTPLSPGSLR	771	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3633.4	34.81807	2	1398.598647	1398.594562	R	S	33	46
PSM	HTGCCGDNDPIDVCEIGSK	772	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3424.4	29.40638	3	2132.857571	2132.856139	K	V	110	129
PSM	DSVFLSCSEDNR	773	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3442.4	29.87602	2	1427.600247	1427.598708	K	I	180	192
PSM	NAEAVLQSPGLSGK	774	sp|Q13045|FLII_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3470.4	30.59678	2	1449.689047	1449.686475	R	V	849	863
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	775	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=1.1.3374.4	28.0999	4	2914.294894	2914.285140	K	L	281	308
PSM	NIIHGSDSVESAEK	776	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3095.2	20.95382	3	1484.707271	1484.710701	R	E	115	129
PSM	NSGSFPSPSISPR	777	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3622.4	34.5293	2	1491.583447	1491.579641	R	-	1258	1271
PSM	NDSLVTPSPQQAR	778	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3217.6	24.06362	2	1491.673647	1491.671887	R	V	144	157
PSM	KYSPGYNTEVGDK	779	sp|O95299|NDUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3112.4	21.37292	3	1536.650471	1536.649755	R	W	338	351
PSM	VPSPLEGSEGDGDTD	780	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3518.5	31.83388	2	1553.579247	1553.577043	K	-	413	428
PSM	EAAFSPGQQDWSR	781	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3607.5	34.141	2	1557.629647	1557.624937	R	D	1099	1112
PSM	RSPTSSAIPLQSPR	782	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3296.2	26.06603	3	1575.777071	1575.777021	K	N	1244	1258
PSM	NSNSPPSPSSMNQR	783	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3066.3	20.24485	3	1581.624071	1581.624285	R	R	454	468
PSM	TLNAETPKSSPLPAK	784	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3182.4	23.15417	3	1632.814571	1632.812404	R	G	208	223
PSM	ASSPSPLTIGTPESQR	785	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3575.3	33.30245	3	1706.791271	1706.787645	K	K	521	537
PSM	TLNAETPKSSPLPAK	786	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3209.2	23.84773	3	1712.781071	1712.778735	R	G	208	223
PSM	SSTPLPTISSSAENTR	787	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3455.2	30.2068	3	1726.778771	1726.777475	R	Q	158	174
PSM	SAPPTRGPPPSYGGSSR	788	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3042.2	19.67987	3	1749.791471	1749.783563	R	Y	293	310
PSM	FSEGVLQSPSQDQEK	789	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3431.3	29.58572	3	1757.753471	1757.750926	R	L	428	443
PSM	HLGGSGSVVPGSPCLDR	790	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3462.2	30.38765	3	1773.787271	1773.786934	R	H	1303	1320
PSM	HVPDSGATATAYLCGVK	791	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3607.3	34.13433	3	1825.809671	1825.807001	K	G	110	127
PSM	IGRIEDVTPIPSDSTR	792	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3484.2	30.9398	3	1834.883471	1834.882608	K	R	126	142
PSM	DNEESEQPPVPGTPTLR	793	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3547.4	32.5753	3	1944.848771	1944.846617	K	N	634	651
PSM	VKLESPTVSTLTPSSPGK	794	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3616.3	34.3688	3	1986.931571	1986.931606	R	L	290	308
PSM	ATAQDNPKSATEQSGTGIR	795	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3005.5	18.8933	3	2010.903371	2010.900778	K	S	511	530
PSM	SQSLPNSLDYTQTSDPGR	796	sp|Q96TC7|RMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3622.3	34.52597	3	2044.879271	2044.873894	R	H	44	62
PSM	EFHLNESGDPSSKSTEIK	797	sp|Q01105|SET_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3314.2	26.5329	4	2083.912094	2083.909945	K	W	155	173
PSM	SAESPTSPVTSETGSTFKK	798	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3444.3	29.92508	3	2099.875571	2099.870128	K	F	280	299
PSM	DLHQPSLSPASPHSQGFER	799	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3437.2	29.73922	4	2168.966894	2168.964047	K	G	58	77
PSM	DGLNQTTIPVSPPSTTKPSR	800	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3578.4	33.38443	3	2175.060971	2175.057278	K	A	573	593
PSM	RGGSGSHNWGTVKDELTESPK	801	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3330.3	26.95195	4	2321.044494	2321.043754	K	Y	216	237
PSM	SQDATFSPGSEQAEKSPGPIVSR	802	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3416.6	29.20388	3	2454.114371	2454.106414	R	T	329	352
PSM	HGEVCPAGWKPGSDTIKPDVQK	803	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3359.4	27.70807	4	2485.150494	2485.146110	K	S	169	191
PSM	IACRSPQPDPVGTPTIFKPQSK	804	sp|P46013|KI67_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3661.2	35.5023	4	2583.199294	2583.195777	K	R	2219	2241
PSM	EKGPTTGEGALDLSDVHSPPKSPEGK	805	sp|O95684|FR1OP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3373.3	28.07048	4	2712.269694	2712.264371	K	T	139	165
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	806	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3333.3	27.02963	5	2769.240618	2769.239553	K	V	100	125
PSM	SSNLLDLK	807	sp|Q86X55|CARM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3741.2	37.58847	2	968.457447	968.457978	K	N	463	471
PSM	NLLSVAYK	808	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3876.2	41.08237	2	986.480247	986.483799	R	N	44	52
PSM	GLESAFTEK	809	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3751.2	37.84153	2	1060.446847	1060.447807	K	V	1291	1300
PSM	CFSPGVIEVQEVQGK	810	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3931.2	42.50757	3	1755.788171	1755.790288	R	K	256	271
PSM	VLPGVDALSNI	811	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4548.2	56.12173	2	1176.582647	1176.579156	K	-	407	418
PSM	GEWFLLGSPGS	812	sp|Q96T76|MMS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5958.2	69.00383	2	1228.521447	1228.516556	R	-	1020	1031
PSM	ALDDFVLGSAR	813	sp|O60831|PRAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4056.3	45.69221	2	1242.564647	1242.564569	R	L	11	22
PSM	HSGGFLSSPADFSQENK	814	sp|Q7LBC6|KDM3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3689.2	36.231	3	1886.786771	1886.783623	R	A	772	789
PSM	DITEEIMSGAR	815	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3931.3	42.5109	2	1300.538247	1300.537033	K	T	191	202
PSM	NSLESYAFNMK	816	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3752.3	37.86982	2	1302.591247	1302.591438	K	A	540	551
PSM	NDPFTSDPFTK	817	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4020.2	44.7536	2	1347.542247	1347.538413	K	N	684	695
PSM	DALGDSLQVPVSPSSTTSSR	818	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3878.2	41.1343	3	2082.951671	2082.947059	R	C	141	161
PSM	NLSSPFIFHEK	819	sp|P52569|CTR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3835.2	40.00815	3	1397.637371	1397.638068	R	T	644	655
PSM	IMNTFSVVPSPK	820	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3916.3	42.11907	2	1398.662247	1398.661840	R	V	163	175
PSM	ESVPEFPLSPPK	821	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4018.3	44.7076	2	1405.657847	1405.653049	K	K	30	42
PSM	DVEDFLSPLLGK	822	sp|Q13405|RM49_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.5920.2	68.73945	2	1411.668847	1411.663614	K	T	123	135
PSM	IMNTFSVVPSPK	823	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3723.3	37.12365	2	1414.657047	1414.656755	R	V	163	175
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	824	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3928.5	42.43932	4	2835.284494	2835.274618	R	T	350	376
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	825	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3920.3	42.22365	4	2835.284494	2835.274618	R	T	350	376
PSM	IMNTFSVVPSPK	826	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4052.3	45.58713	2	1478.634647	1478.628171	R	V	163	175
PSM	DTTSPMELAALEK	827	sp|Q6VY07|PACS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3950.3	43.00107	2	1484.652647	1484.646978	K	I	427	440
PSM	TQVLSPDSLFTAK	828	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4194.3	49.17078	2	1485.716447	1485.711627	K	F	1717	1730
PSM	QASPNIVIALSGNK	829	sp|P20339|RAB5A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3946.4	42.90113	2	1490.754047	1490.749409	R	A	121	135
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	830	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3800.5	39.10203	4	2989.550494	2989.541321	K	G	202	228
PSM	YISPDQLADLYK	831	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4219.3	49.82123	2	1504.691047	1504.685078	R	S	270	282
PSM	GYISPYFINTSK	832	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4222.5	49.90602	2	1548.636447	1548.630279	R	G	222	234
PSM	DSAGQDINLNSPNK	833	sp|O43399|TPD54_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3756.6	37.98233	2	1551.6605	1551.6561	M	G	2	16
PSM	GSLAEAVGSPPPAATPTPTPPTR	834	sp|Q9Y6I3|EPN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3684.4	36.10873	3	2331.062171	2331.054910	R	K	446	469
PSM	SACGNCYLGDAFR	835	sp|Q6FI81|CPIN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21,3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=1.1.3817.4	39.54257	2	1569.580447	1569.574164	K	C	272	285
PSM	LVGQGASAVLLDLPNSGGEAQAK	836	sp|Q99714|HCD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4348.3	52.69353	3	2354.101571	2354.092023	R	K	30	53
PSM	VTNGAFTGEISPGMIK	837	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3966.2	43.41718	3	1700.787671	1700.784474	K	D	107	123
PSM	SMVSPVPSPTGTISVPNSCPASPR	838	sp|P85037|FOXK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,19-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.4087.2	46.49028	3	2584.125371	2584.110393	R	G	236	260
PSM	VGIDTPDIDIHGPEGK	839	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3690.2	36.2573	3	1741.793171	1741.792396	K	L	4560	4576
PSM	CVWSPLASPSTSILK	840	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4859.2	59.89537	3	1804.793471	1804.787191	R	R	2169	2184
PSM	SWASPVYTEADGTFSR	841	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4038.2	45.21945	3	1852.775171	1852.766910	R	L	342	358
PSM	ASSTSPVEISEWLDQK	842	sp|P13804|ETFA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4287.2	51.39887	3	1855.828571	1855.824091	K	L	188	204
PSM	VSSGYVPPPVATPFSSK	843	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3885.3	41.30895	3	1878.826271	1878.820599	R	S	168	185
PSM	LLSPRPSLLTPTGDPR	844	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3937.2	42.66402	3	1878.902771	1878.900581	R	A	937	953
PSM	PLVLPSPLVTPGSNSQER	845	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4309.2	51.85798	3	2049.960671	2049.953739	R	Y	466	484
PSM	DQPAFTPSGILTPHALGSR	846	sp|Q9H0D6|XRN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4209.4	49.56347	3	2123.953571	2123.944237	R	N	428	447
PSM	DRYMSPMEAQEFGILDK	847	sp|Q16740|CLPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,7-UNIMOD:35	ms_run[1]:scan=1.1.3976.2	43.66622	3	2124.892271	2124.889744	R	V	227	244
PSM	LNSPTDSTPALLSATVTPQK	848	sp|Q9H4X1|RGCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4032.2	45.06418	3	2200.013471	2200.006562	K	A	95	115
PSM	SSVSRVPCNVEGISPELEK	849	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,8-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3731.5	37.33752	3	2245.977071	2245.969131	K	V	290	309
PSM	DLYANTVLSGGTTMYPGIADR	850	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.4152.4	48.1651	3	2310.036971	2310.023930	K	M	292	313
PSM	IADPEHDHTGFLTEYVATR	851	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3762.4	38.1307	3	2330.972171	2330.961009	R	W	190	209
PSM	IADPEHDHTGFLTEYVATR	852	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3795.3	38.96537	3	2330.968871	2330.961009	R	W	190	209
PSM	IADPEHDHTGFLTEYVATR	853	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3774.5	38.43852	2	2330.975447	2330.961009	R	W	190	209
PSM	FVEWLQNAEEESESEGEEN	854	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4366.2	52.97415	3	2333.900471	2333.884913	K	-	401	420
PSM	VPPAPVPCPPPSPGPSAVPSSPK	855	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4,12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3721.5	37.0784	3	2378.088371	2378.078288	K	S	366	389
PSM	LTESPCALVASQYGWSGNMER	856	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.4205.2	49.45189	3	2435.044571	2435.028697	R	I	640	661
PSM	DNLTLWTSDSAGEECDAAEGAEN	857	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4115.4	47.21333	3	2453.991671	2453.976507	R	-	223	246
PSM	SQEGESVTEDISFLESPNPENK	858	sp|Q9UBV2|SE1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4173.2	48.63435	3	2515.077071	2515.063940	K	D	81	103
PSM	DNLTLWTADNAGEEGGEAPQEPQS	859	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4099.5	46.7991	3	2528.109971	2528.093920	R	-	225	249
PSM	DNYVPEVSALDQEIIEVDPDTK	860	sp|P08708|RS17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.5202.2	63.25117	3	2568.173471	2568.152026	R	E	82	104
PSM	FNEEHIPDSPFVVPVASPSGDAR	861	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4153.3	48.19145	3	2626.131071	2626.114215	K	R	2311	2334
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	862	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4009.4	44.50125	3	2881.118471	2881.094982	K	T	701	725
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	863	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,7-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4126.5	47.4998	4	3465.508094	3465.481982	K	A	399	429
PSM	NAVITVPAYFNDSQR	864	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4104.2	46.91948	3	1773.816971	1773.808715	K	Q	188	203
PSM	GFDPTASPFCQ	865	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3934.2	42.58567	2	1305.476047	1305.473705	K	-	1293	1304
PSM	MDEPSPLAQPLELNQHSR	866	sp|Q13085|ACACA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.4094.2	46.65911	3	2182.9812	2182.9712	-	F	1	19
PSM	QFTPCQLLADHANSPNKK	867	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,3-UNIMOD:21,5-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.4059.2	45.76738	3	2210.9322	2210.9212	K	F	743	761
PSM	TKTEQELPRPQSPSDLDSLDGR	868	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3537.3	32.31777	4	2549.175294	2548.180641	K	S	90	112
PSM	DVNSSSPVMLAFK	869	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4078.3	46.25303	2	1473.664247	1473.657483	K	S	28	41
PSM	NGNGGPGPYVGQAGTATLPR	870	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3606.4	34.11155	3	1963.883771	1962.894904	K	N	185	205
PSM	DGLILTSR	871	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	34.05267	2	953.456247	953.458313	K	G	149	157
PSM	SESPKEPEQLRK	872	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2968.2	18.0988	3	1506.703871	1506.707938	K	L	4	16
PSM	CESAFLSK	873	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	26.63743	2	1020.395847	1020.398749	K	R	36	44
PSM	TPEPSSPVKEPPPVLAKPK	874	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3326.3	26.84765	4	2077.087694	2077.086059	K	L	639	658
PSM	SGLTVPTSPK	875	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3325.2	26.81822	2	1065.511647	1065.510742	R	G	87	97
PSM	SCNCLLLK	876	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3547.2	32.56863	2	1086.457047	1086.460304	K	V	336	344
PSM	SCEVPTRLNSASLK	877	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3380.2	28.24998	3	1640.760371	1640.759322	R	Q	97	111
PSM	GHTDTEGRPPSPPPTSTPEK	878	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3011.3	19.02495	4	2246.928094	2246.924624	R	C	353	373
PSM	EKTPSPKEEDEEPESPPEK	879	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2982.3	18.39198	4	2260.967294	2260.962435	K	K	200	219
PSM	VTLTSEEEAR	880	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3108.3	21.27573	2	1133.555447	1133.556432	K	L	306	316
PSM	SVEAAAELSAK	881	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3207.2	23.7959	2	1154.521647	1154.522035	K	D	5	16
PSM	IGKVDCTQHYELCSGNQVR	882	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3286.2	25.80643	4	2343.016494	2343.013716	K	G	242	261
PSM	YLSEVASGDNK	883	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3093.2	20.90227	2	1181.555847	1181.556432	R	Q	130	141
PSM	GCESAVDELK	884	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3320.4	26.69575	2	1186.456447	1186.457721	K	G	441	451
PSM	SGEGEVSGLMR	885	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3495.3	31.22705	2	1200.486847	1200.484604	R	K	473	484
PSM	STGCDFAVSPK	886	sp|P55809|SCOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3298.6	26.13163	2	1247.489247	1247.489355	K	L	501	512
PSM	TSSGDPPSPLVK	887	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3251.3	24.91007	2	1263.577447	1263.574799	K	Q	80	92
PSM	QVVESAYEVIK	888	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3541.3	32.4171	2	1263.670847	1263.671068	K	L	233	244
PSM	ASPEPQRENASPAPGTTAEEAMSR	889	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3290.5	25.921	4	2563.103694	2563.101011	R	G	963	987
PSM	GSSGGSGAKPSDAASEAARPATSTLNR	890	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3118.4	21.52347	4	2582.176094	2582.172202	K	F	1096	1123
PSM	SSPNPFVGSPPK	891	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3431.4	29.58905	2	1292.582047	1292.580219	K	G	393	405
PSM	GILAADESTGSIAK	892	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3406.3	28.93277	2	1331.693847	1331.693260	K	R	29	43
PSM	TFDQLTPEESK	893	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3334.6	27.06565	2	1373.578247	1373.575193	K	E	60	71
PSM	DFTPVCTTELGR	894	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3665.5	35.61682	2	1394.651647	1394.650015	R	A	42	54
PSM	NSGSFPSPSISPR	895	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3539.3	32.36725	2	1411.615647	1411.613310	R	-	1258	1271
PSM	GILAADESTGSIAK	896	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3473.3	30.66938	2	1411.661847	1411.659591	K	R	29	43
PSM	MQAGQISVQSSEPSSPEPGK	897	sp|P37275|ZEB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3367.5	27.9202	3	2122.928171	2122.924215	K	V	632	652
PSM	SSDQPLTVPVSPK	898	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3534.5	32.24977	2	1433.681447	1433.680327	K	F	728	741
PSM	SSDQPLTVPVSPK	899	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3543.6	32.4778	2	1433.681447	1433.680327	K	F	728	741
PSM	GSGSGGSGSDSEPDSPVFEDSK	900	sp|P36956|SRBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3283.4	25.73473	3	2163.816371	2163.811748	R	A	447	469
PSM	EVDEQMLNVQNK	901	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3385.6	28.39417	2	1445.684447	1445.682044	K	N	325	337
PSM	KPTDGASSSNCVTDISHLVR	902	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3628.6	34.69322	3	2223.006971	2222.999112	R	K	698	718
PSM	SSDQPLTVPVSPK	903	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3612.5	34.27083	2	1513.649447	1513.646658	K	F	728	741
PSM	HELQANCYEEVK	904	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3139.3	22.03793	3	1518.675971	1518.677293	K	D	133	145
PSM	NWMVGGEGGAGGRSP	905	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.3354.5	27.58112	2	1526.598647	1526.597342	K	-	79	94
PSM	VAAAAGSGPSPPGSPGHDRER	906	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2972.3	18.19903	4	2051.917294	2051.917431	R	Q	38	59
PSM	PFSAPKPQTSPSPK	907	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3165.2	22.7082	3	1547.739071	1547.738510	K	R	299	313
PSM	VAAETQSPSLFGSTK	908	sp|Q9UKX7|NUP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3538.5	32.34917	2	1601.736247	1601.733819	K	L	215	230
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	909	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,5-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3545.4	32.52317	4	3213.354094	3213.342046	K	F	173	200
PSM	ELQAAGKSPEDLER	910	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3210.2	23.87363	3	1621.733471	1621.734881	K	L	448	462
PSM	GGAAGGALPTSPGPALGAK	911	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3563.5	32.99492	2	1628.796447	1628.792337	R	G	7	26
PSM	STAGDTHLGGEDFDNR	912	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3197.2	23.53643	3	1690.718471	1690.718306	K	M	224	240
PSM	GHASAPYFGKEEPSVAPSSTGK	913	sp|Q8N183|NDUF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3322.3	26.74388	4	2283.023294	2283.020893	K	T	131	153
PSM	NVTELNEPLSNEER	914	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	31.01642	3	1722.749171	1722.746174	K	N	29	43
PSM	QLRFEDVVNQSSPK	915	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3598.2	33.89537	3	1725.812771	1725.808715	K	N	190	204
PSM	TDSVIIADQTPTPTR	916	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3522.3	31.93188	3	1773.761171	1773.758727	R	F	42	57
PSM	SSDEENGPPSSPDLDR	917	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3174.5	22.95115	3	1780.683671	1780.678883	R	I	202	218
PSM	SRLTPVSPESSSTEEK	918	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3128.5	21.78258	3	1892.783471	1892.780585	R	S	266	282
PSM	FQEQECPPSPEPTRK	919	sp|P62070|RRAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3097.5	21.01573	3	1908.811271	1908.807729	K	E	178	193
PSM	FIHQQPQSSSPVYGSSAK	920	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3172.5	22.8995	3	2026.917671	2026.914971	R	T	76	94
PSM	DSGSDEDFLMEDDDDSDYGSSK	921	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3647.3	35.15507	3	2443.869371	2443.860534	K	K	129	151
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	922	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3647.5	35.16173	3	2574.231971	2574.222781	K	K	453	479
PSM	YCRPESQEHPEADPGSAAPYLK	923	sp|P40763|STAT3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3345.3	27.3408	4	2581.099294	2581.094469	K	T	686	708
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	924	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3038.3	19.63697	4	3104.330494	3104.322430	K	S	145	174
PSM	DTTQSKPVSSPFPTKPLEGQAEGDSGECK	925	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=1.1.3480.5	30.84985	4	3156.401694	3156.395856	K	G	306	335
PSM	ALLYLCGGDD	926	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3973.2	43.59138	2	1095.487247	1095.490661	K	-	330	340
PSM	VAASPKSPTAALNESLVECPK	927	sp|Q53EZ4|CEP55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,7-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3824.2	39.71928	4	2328.045294	2328.047382	K	C	422	443
PSM	MYFPDVEFDIKSPK	928	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4231.3	50.11498	3	1794.797471	1794.793976	K	F	5088	5102
PSM	ESHSPFGLDSFNSTAK	929	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3736.3	37.46118	3	1802.756171	1802.751260	K	V	1250	1266
PSM	GPPQSPVFEGVYNNSR	930	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3735.2	37.43185	3	1826.799671	1826.798879	K	M	107	123
PSM	DLFDPIIEDR	931	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4208.3	49.534	2	1231.608647	1231.608468	K	H	87	97
PSM	CESAPGCGVWQRPVIDNPNYK	932	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3739.2	37.53608	4	2526.085294	2526.082130	R	G	360	381
PSM	EGMNIVEAMER	933	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3831.3	39.90631	2	1277.575847	1277.574407	K	F	134	145
PSM	LSGSNPYTTVTPQIINSK	934	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3765.3	38.20478	3	1998.969971	1998.966338	K	W	605	623
PSM	EDFDSLLQSAK	935	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3963.4	43.3444	2	1331.566447	1331.564628	K	K	288	299
PSM	LDIDSPPITAR	936	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3780.3	38.57593	2	1356.573447	1356.572764	R	N	33	44
PSM	ESVPEFPLSPPK	937	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4009.2	44.48792	2	1405.657847	1405.653049	K	K	30	42
PSM	GFPTIYFSPANK	938	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4141.4	47.89567	2	1420.647247	1420.642819	R	K	449	461
PSM	TAHNSEAADLEESFNEHELEPSSPK	939	sp|Q8IWS0-2|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3729.4	37.28173	4	2847.198094	2847.187243	K	S	134	159
PSM	SATLASIDAELQK	940	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3968.2	43.46967	2	1425.677647	1425.675241	K	L	527	540
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	941	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3681.3	36.02794	5	3562.503118	3562.491898	K	V	60	92
PSM	TLTIVDTGIGMTK	942	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4088.3	46.50952	2	1508.666847	1508.659865	R	A	28	41
PSM	TPSSDVLVFDYTK	943	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4127.2	47.5159	2	1550.697847	1550.690557	K	H	144	157
PSM	TPSSDVLVFDYTK	944	sp|Q09028|RBBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4119.2	47.31028	3	1550.693771	1550.690557	K	H	144	157
PSM	GALQNIIPASTGAAK	945	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3922.3	42.2758	2	1570.719247	1570.715740	R	A	201	216
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	946	sp|Q96TA1|NIBA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.4156.3	48.2454	4	3175.566894	3175.546831	R	A	655	686
PSM	TDIQIALPSGCYGR	947	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3951.2	43.0239	3	1629.728471	1629.722209	K	V	156	170
PSM	NGRVEIIANDQGNRITPSYVAFTPEGER	948	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	19-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3899.5	41.6819	4	3262.496094	3262.480937	K	L	47	75
PSM	QSKPVTTPEEIAQVATISANGDK	949	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3721.6	37.08173	3	2463.199871	2463.189415	K	E	158	181
PSM	APNTPDILEIEFKK	950	sp|P00966|ASSY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3997.2	44.18735	3	1693.838171	1693.832805	K	G	216	230
PSM	RASGQAFELILSPR	951	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4149.2	48.07288	3	1703.786171	1703.779738	K	S	14	28
PSM	RPPESPPIVEEWNSR	952	sp|Q9BTL3|RAMAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3675.2	35.86715	3	1871.854271	1871.856728	K	A	32	47
PSM	FDRGYISPYFINTSK	953	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3952.2	43.05008	3	1886.864771	1886.860416	K	G	219	234
PSM	GFSEGLWEIENNPTVK	954	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4209.2	49.5568	3	1898.845271	1898.845160	K	A	81	97
PSM	FDRGYISPYFINTSK	955	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4063.3	45.87537	3	1966.834871	1966.826747	K	G	219	234
PSM	MASPPAPSPAPPAISPIIK	956	sp|Q00587|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4190.2	49.05932	3	2000.953271	2000.944754	R	N	99	118
PSM	GHVFEESQVAGTPMFVVK	957	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3890.2	41.43653	3	2040.942971	2040.938015	R	A	768	786
PSM	TSSLAPVVGTTTTTPSPSAIK	958	sp|Q92733|PRCC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3891.5	41.47301	3	2175.017771	2175.011313	K	A	226	247
PSM	DVSPDLSCADEISECYHK	959	sp|Q96S66|CLCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.3727.5	37.23278	3	2203.850471	2203.843917	K	L	53	71
PSM	SVLCSTPTINIPASPFMQK	960	sp|Q96KB5|TOPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4,8-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4589.2	56.87897	3	2250.000671	2249.986696	K	L	19	38
PSM	QQPPEPEWIGDGESTSPSDK	961	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3716.4	36.94413	3	2262.939971	2262.931803	K	V	7	27
PSM	DYEEVGVDSVEGEGEEEGEEY	962	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3932.4	42.54033	3	2347.905971	2347.897571	K	-	431	452
PSM	DKNTPSPFIETFTEDDEASR	963	sp|P48506|GSH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4094.5	46.66912	3	2378.007671	2377.995132	K	A	210	230
PSM	LQTTDNLLPMSPEEFDEVSR	964	sp|P42224|STAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4498.3	55.3646	3	2400.072671	2400.055624	R	I	717	737
PSM	APTIETVVLYTGETPSEQDQGK	965	sp|Q9BYC8|RM32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4101.3	46.8546	3	2442.132671	2442.120332	K	R	151	173
PSM	NALFPEVFSPTPDENSDQNSR	966	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4387.3	53.46528	3	2443.047371	2443.032914	R	S	567	588
PSM	QSKPVTTPEEIAQVATISANGDK	967	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3820.5	39.62468	3	2463.200171	2463.189415	K	E	158	181
PSM	ERIQQFDDGGSDEEDIWEEK	968	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3846.6	40.3108	3	2504.010071	2504.001674	K	H	607	627
PSM	MESHSEDEDLAGAVGGLGWNSRSPR	969	sp|Q96MH2|HEXI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	39.85052	4	2736.165294	2736.159922	R	T	49	74
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	970	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3927.6	42.4164	3	3014.207171	3014.188484	K	-	661	690
PSM	KPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPR	971	sp|Q9NQC3|RTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4947.3	60.98542	4	3430.649694	3430.618616	R	G	58	92
PSM	CNPGFSSFSEIITTPTETCDDINECATPSK	972	sp|P48960|CD97_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,19-UNIMOD:4,25-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=1.1.4451.2	54.47922	4	3457.429294	3457.403720	R	V	44	74
PSM	ENSSSSSTPLSNGPLNGDVDYFGQQFDQISNR	973	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4759.2	58.91173	4	3539.541694	3539.511431	K	T	322	354
PSM	CIPALDSLTPANEDQK	974	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4875.3	60.08458	2	1833.7972	1833.7852	R	I	447	463
PSM	QAGPASVPLRTEEEFKK	975	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3625.3	34.6045	3	2028.9008	2028.8954	K	F	131	148
PSM	NGSLDSPGKQDTEEDEEEDEK	976	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3074.3	20.44915	3	2430.912071	2429.923149	K	D	134	155
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	977	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3852.5	40.46542	3	2574.994571	2573.998594	R	G	239	267
PSM	QQPPEPEWIGDGESTSPSDK	978	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.4051.5	45.56757	3	2245.9141	2245.9047	K	V	7	27
PSM	DLHQPSLSPASPHSQGFER	979	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3523.2	31.95458	4	2248.932894	2248.930378	K	G	58	77
PSM	PRPDPSPEIEGDLQPATHGSR	980	sp|P51970|NDUA8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3389.3	28.4881	4	2335.062494	2335.059404	R	F	146	167
PSM	CNTPTYCDLGK	981	sp|Q9Y277|VDAC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3529.5	32.12107	2	1449.5317	1449.5300	M	A	2	13
PSM	MQELTLSPGPAK	982	sp|Q93015-2|NAA80_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.4149.4	48.07955	2	1392.6411	1392.6355	-	L	1	13
PSM	DVNSSSPVMLAFK	983	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3836.5	40.04442	2	1489.654447	1489.652398	K	S	28	41
PSM	EAENQGLDISSPGMSGHR	984	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3359.5	27.7114	3	1963.815071	1963.809520	K	Q	191	209
PSM	MNLLPNIESPVTRQEK	985	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.4116.2	47.24617	3	2005.9604	2005.9539	-	M	1	17
PSM	VTNGAFTGEISPGMIK	986	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4146.3	48.0159	3	1781.736371	1780.750805	K	D	107	123
PSM	DKPHVNVGTIGHVDHGK	987	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3123.2	21.6416	4	1808.927694	1808.928179	R	T	54	71
PSM	VLTPTQVK	988	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3282.2	25.70195	2	964.499847	964.499449	K	N	40	48
PSM	DYSSGFGGK	989	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3178.2	23.0444	2	996.357847	996.358992	K	Y	153	162
PSM	ILSPSMASK	990	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3356.3	27.62667	2	1012.466647	1012.466434	R	L	69	78
PSM	DVNAAIATIK	991	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3514.2	31.7192	2	1014.567247	1014.570960	K	T	327	337
PSM	QAGPASVPLRTEEEFKK	992	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3422.2	29.3475	4	2045.922494	2045.922439	K	F	131	148
PSM	MLTFNPNK	993	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3656.2	35.37508	2	1043.449247	1043.451119	R	R	310	318
PSM	NLETPLCK	994	sp|P54819|KAD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3241.2	24.66352	2	1053.455847	1053.456598	K	N	86	94
PSM	TAAYGHFGR	995	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3155.4	22.45533	2	1058.436447	1058.433495	R	D	374	383
PSM	TPSPKEEDEEPESPPEKK	996	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2953.3	17.91348	4	2131.924094	2131.919841	K	T	202	220
PSM	DVVICPDASLEDAKK	997	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3497.2	31.27592	3	1658.818571	1658.818537	R	E	49	64
PSM	GHTDTEGRPPSPPPTSTPEK	998	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2982.2	18.38198	4	2246.928094	2246.924624	R	C	353	373
PSM	TPKTPKGPSSVEDIK	999	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3191.3	23.38392	3	1742.791871	1742.789299	K	A	234	249
PSM	NDSPTQIPVSSDVCR	1000	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3474.2	30.69133	3	1753.737371	1753.734230	R	L	673	688
PSM	GGNFGGRSSGPYGGGGQYFAKPR	1001	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3410.2	29.03375	4	2353.043294	2353.038943	K	N	330	353
PSM	DVQDSLTVSNEAQTAK	1002	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3370.2	27.98867	3	1784.785271	1784.782954	K	E	211	227
PSM	LGAGGGSPEKSPSAQELK	1003	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3155.5	22.45867	3	1791.838871	1791.840409	R	E	13	31
PSM	VLGSEGEEEDEALSPAK	1004	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3404.2	28.87717	3	1838.787671	1838.782285	R	G	63	80
PSM	SASWGSADQLK	1005	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3457.3	30.26128	2	1228.513247	1228.512533	R	E	221	232
PSM	NSVERPAEPVAGAATPSLVEQQK	1006	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3475.3	30.71983	4	2457.197294	2457.190084	R	M	1455	1478
PSM	TSPSSPAPLPHQEATPR	1007	sp|P04920|B3A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3200.3	23.61737	3	1851.854471	1851.851643	R	A	169	186
PSM	GGETPGSEQWK	1008	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3152.5	22.3806	2	1254.492447	1254.491798	K	F	223	234
PSM	NVLGHMQQGGSPTPFDR	1009	sp|P08237|PFKAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3567.3	33.09312	3	1919.850071	1919.834947	K	N	657	674
PSM	FNVWDTAGQEK	1010	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3618.3	34.42102	2	1293.597847	1293.598966	K	F	61	72
PSM	QHEAPSNRPLNELLTPQGPSPR	1011	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3619.5	34.45382	4	2597.184494	2597.178881	R	T	167	189
PSM	DQIVDLTVGNNK	1012	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3594.2	33.79347	2	1314.678847	1314.677945	K	T	213	225
PSM	PAEKPAETPVATSPTATDSTSGDSSR	1013	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3115.3	21.446	4	2639.165294	2639.159965	K	S	148	174
PSM	YSQVLANGLDNK	1014	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3368.5	27.94623	2	1320.666047	1320.667380	K	L	95	107
PSM	NLSPGAVESDVR	1015	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	33.86952	2	1322.588647	1322.586761	K	G	171	183
PSM	INVYYNEATGGK	1016	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3336.4	27.11088	2	1327.641647	1327.640831	R	Y	47	59
PSM	NGLAAELGPASPR	1017	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3534.2	32.23977	2	1331.624047	1331.623480	R	R	91	104
PSM	SMGTGDTPGLEVPSSPLRK	1018	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3651.3	35.2541	3	2007.938171	2007.933658	R	A	381	400
PSM	NGEVVHTPETSV	1019	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3259.4	25.11427	2	1347.573647	1347.570776	K	-	454	466
PSM	ELASPVSPELR	1020	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3629.5	34.71622	2	1356.575847	1356.572764	K	Q	175	186
PSM	ELASPVSPELR	1021	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3637.4	34.91633	2	1356.575847	1356.572764	K	Q	175	186
PSM	DLLVSSGSNNSLPCGSPKK	1022	sp|Q5THK1|PR14L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3509.2	31.58847	3	2038.940771	2038.939472	K	C	1014	1033
PSM	DCDRAIEINPDSAQPYK	1023	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3537.4	32.3211	3	2070.878171	2070.871786	R	W	170	187
PSM	SGSLDSELSVSPK	1024	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3535.3	32.26808	2	1384.611847	1384.612307	K	R	2718	2731
PSM	GVQVETISPGDGR	1025	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3329.4	26.9293	2	1393.6261	1393.6233	M	T	2	15
PSM	LLGGTRTPINDAS	1026	sp|Q8N357|S35F6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3388.5	28.46882	2	1393.661247	1393.660260	R	-	359	372
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	1027	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3478.4	30.79743	4	2838.188894	2838.177635	K	M	23	49
PSM	DSIKLDDDSERK	1028	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3008.2	18.9495	3	1419.678671	1419.684152	K	V	37	49
PSM	ETGKPKGDATVSYEDPPTAK	1029	sp|Q01844|EWS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3082.4	20.63218	3	2169.991571	2169.983110	K	A	405	425
PSM	DGLNQTTIPVSPPSTTKPSR	1030	sp|Q71RC2|LARP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3586.4	33.59282	3	2175.060971	2175.057278	K	A	573	593
PSM	STNEAMEWMNNK	1031	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3561.4	32.93953	2	1453.598647	1453.596599	K	L	737	749
PSM	GGGGNFGPGPGSNFR	1032	sp|P22626|ROA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3443.4	29.90228	2	1456.591847	1456.588492	R	G	214	229
PSM	DVSGPMPDSYSPR	1033	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3445.5	29.95783	2	1486.581447	1486.579961	K	Y	291	304
PSM	EAPAEGEAAEPGSPTAAEGEAASAASSTSSPK	1034	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3518.3	31.82722	4	2994.272094	2994.261530	K	A	106	138
PSM	DLHQPSLSPASPHSQGFER	1035	sp|Q9BZF1|OSBL8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3516.4	31.77827	3	2248.935671	2248.930378	K	G	58	77
PSM	SSSPVQVEEEPVR	1036	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3283.5	25.73807	2	1521.675047	1521.671219	R	L	116	129
PSM	AIEINPDSAQPYK	1037	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3559.3	32.8838	2	1524.688847	1524.686140	R	W	174	187
PSM	GDATVSYEDPPTAK	1038	sp|Q01844|EWS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3216.4	24.03245	2	1529.635447	1529.628685	K	A	411	425
PSM	NIIHGSDSVKSAEK	1039	sp|O60361|NDK8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3013.5	19.07172	3	1563.729971	1563.729402	R	E	100	114
PSM	GDRSPEPGQTWTR	1040	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3142.4	22.1188	3	1565.664371	1565.662385	K	E	90	103
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1041	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3501.4	31.38673	4	3223.243694	3223.230486	K	-	122	148
PSM	HRVIGSGCNLDSAR	1042	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3131.3	21.84983	3	1620.722171	1620.719189	K	F	157	171
PSM	ADLNQGIGEPQSPSR	1043	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3274.6	25.50657	2	1647.728647	1647.725379	R	R	63	78
PSM	ALSRQEMQEVQSSR	1044	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.2928.2	17.62778	3	1743.765071	1743.761113	K	S	187	201
PSM	KVDLTLLSPKSENDK	1045	sp|P27816-4|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	32.13722	3	1765.890671	1765.886297	K	L	262	277
PSM	RVSLEPHQGPGTPESK	1046	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3058.2	20.07053	4	1797.844094	1797.841078	K	K	1989	2005
PSM	IISTTASKTETPIVSK	1047	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3298.5	26.1283	3	1834.872071	1834.873029	K	S	140	156
PSM	RLYPAVDEQETPLPR	1048	sp|Q96S59|RANB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3544.3	32.49367	3	1862.890571	1862.892779	K	S	153	168
PSM	DKGDEEEEGEEKLEEK	1049	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3060.3	20.12502	4	1891.818894	1891.817077	K	Q	536	552
PSM	RADLNQGIGEPQSPSRR	1050	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3098.3	21.035	4	1959.932494	1959.927602	R	V	62	79
PSM	RADLNQGIGEPQSPSRR	1051	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3107.2	21.23688	4	1959.932494	1959.927602	R	V	62	79
PSM	QGAIVAVTGDGVNDSPALKK	1052	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3501.2	31.38007	3	2019.009971	2019.003786	R	A	708	728
PSM	SMGTGDTPGLEVPSSPLRK	1053	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3543.5	32.47447	3	2023.932071	2023.928573	R	A	381	400
PSM	SVSTPSEAGSQDSGDGAVGSR	1054	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3048.6	19.82827	3	2029.827971	2029.822587	K	T	92	113
PSM	AMHQAQTMEGCSSPMVVK	1055	sp|Q92879|CELF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3286.4	25.8131	3	2070.841871	2070.839640	K	F	167	185
PSM	AEPQPLSPASSSYSVSSPR	1056	sp|P18850|ATF6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3591.3	33.72013	3	2105.875271	2105.870797	K	S	88	107
PSM	DQMEGSPNSSESFEHIAR	1057	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3386.3	28.41017	3	2115.828071	2115.820479	R	S	774	792
PSM	DTGKPKGEATVSFDDPPSAK	1058	sp|Q92804|RBP56_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3257.4	25.06317	3	2125.965371	2125.956896	K	A	278	298
PSM	TVEVAEGEAVRTPQSVTAK	1059	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3402.4	28.8314	3	2130.966671	2130.959947	R	Q	132	151
PSM	RGSLSNAGDPEIVKSPSDPK	1060	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3204.3	23.72128	4	2133.009294	2133.010328	R	Q	92	112
PSM	SQGDEAGGHGEDRPEPLSPK	1061	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3045.2	19.75333	3	2141.908871	2141.901506	R	E	361	381
PSM	DCNDTLEEENTNLETPTK	1062	sp|Q9BZE2|PUS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3434.2	29.66087	3	2201.873771	2201.867154	R	R	452	470
PSM	PAETPVATSPTATDSTSGDSSR	1063	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3141.5	22.09583	3	2213.937671	2213.932531	K	S	152	174
PSM	MPPRTPAEASSTGQTGPQSAL	1064	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3498.4	31.30845	3	2242.938971	2242.933080	K	-	238	259
PSM	RGGSGSHNWGTVKDELTESPK	1065	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3322.4	26.74722	4	2321.044494	2321.043754	K	Y	216	237
PSM	RTEGYAAFQEDSSGDEAESPSK	1066	sp|Q15311|RBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3315.6	26.57242	3	2439.973271	2439.970374	K	M	81	103
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	1067	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3621.4	34.50292	4	2807.211294	2807.201193	R	G	70	97
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1068	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3029.3	19.43677	4	3104.330494	3104.322430	K	S	145	174
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1069	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3351.3	27.49643	5	3112.515118	3112.507789	R	S	847	876
PSM	NLLSVAYK	1070	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3868.2	40.87652	2	986.480247	986.483799	R	N	44	52
PSM	SGSPAVLAFAK	1071	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3823.2	39.69308	2	1126.540847	1126.542377	K	E	1725	1736
PSM	VEVTEFEDIKSGYR	1072	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3743.2	37.64088	3	1750.783271	1750.781497	K	I	133	147
PSM	DQIYDIFQK	1073	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3980.2	43.76447	2	1168.574047	1168.576440	K	L	194	203
PSM	NQLTSNPENTVFDAK	1074	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3700.2	36.51933	3	1836.737471	1836.733241	K	R	82	97
PSM	DIDISSPEFK	1075	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3778.2	38.5241	2	1229.522847	1229.521701	K	I	172	182
PSM	MNGVMFPGNSPSYTER	1076	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3817.2	39.5359	3	1865.749571	1865.747771	R	S	150	166
PSM	NTLNGDLASATIPEESR	1077	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3742.3	37.61805	3	1866.839471	1866.836052	K	L	266	283
PSM	QLFHPEQLITGKEDAANNYAR	1078	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3755.2	37.94292	4	2494.172494	2494.164203	R	G	85	106
PSM	CFSPGVIEVQEVQGKK	1079	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3731.2	37.32752	3	1883.887271	1883.885251	R	V	256	272
PSM	MVIQGPSSPQGEAMVTDVLEDQK	1080	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4351.2	52.75857	4	2538.152094	2538.138307	K	E	1107	1130
PSM	DAGTIAGLNVLR	1081	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4149.3	48.07622	2	1278.635047	1278.633317	K	I	160	172
PSM	NLEELNISSAQ	1082	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3880.4	41.18632	2	1296.562047	1296.559877	K	-	120	131
PSM	GRPSSPRTPLYLQPDAYGSLDR	1083	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3842.3	40.19558	4	2605.179294	2605.172733	K	A	116	138
PSM	DATNVGDEGGFAPNILENK	1084	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3942.3	42.79583	3	1959.924971	1959.917400	K	E	203	222
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1085	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3743.4	37.64755	4	2619.220894	2619.213536	R	D	175	200
PSM	ADSGPTQPPLSLSPAPETK	1086	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3685.4	36.13402	3	1971.920171	1971.919054	R	R	2071	2090
PSM	LSELVQAVSDPSSPQYGK	1087	sp|O14773|TPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3790.3	38.83383	3	1983.922571	1983.919054	R	Y	61	79
PSM	VWSPLVTEEGK	1088	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3865.2	40.79782	2	1323.613647	1323.611184	K	R	88	99
PSM	AVVQSPQVTEVL	1089	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4075.3	46.17872	2	1348.666847	1348.663948	K	-	830	842
PSM	GNPTVEVDLFTSK	1090	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3849.2	40.37637	2	1405.710247	1405.708910	R	G	16	29
PSM	WPDPEDLLTPR	1091	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4299.2	51.6551	2	1417.634047	1417.627897	R	W	39	50
PSM	PVQETQAPESPGENSEQALQTLSPR	1092	sp|Q7Z434-4|MAVS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	10-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3753.3	37.89483	4	2852.2382	2852.2262	M	A	2	27
PSM	TVDNFVALATGEK	1093	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3812.2	39.40472	2	1443.667247	1443.664677	K	G	72	85
PSM	SAVPFNQYLPNK	1094	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3933.3	42.56312	2	1456.678047	1456.675182	K	S	262	274
PSM	QASPNIVIALAGNK	1095	sp|P51148|RAB5C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4030.6	45.02559	2	1474.758847	1474.754495	R	A	122	136
PSM	EQFLDGDGWTSR	1096	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3845.4	40.2776	2	1489.590847	1489.587489	K	W	25	37
PSM	KPLPDHVSIVEPKDEILPTTPISEQK	1097	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3792.4	38.88995	4	2989.550494	2989.541321	K	G	202	228
PSM	LTFDTTFSPNTGK	1098	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3861.3	40.6961	2	1507.662647	1507.659591	K	K	108	121
PSM	DEILPTTPISEQK	1099	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3708.5	36.73783	2	1549.731247	1549.727671	K	G	215	228
PSM	TSESTGSLPSPFLR	1100	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3915.3	42.09302	2	1557.712047	1557.707604	K	A	177	191
PSM	DVDASPSPLSVQDLK	1101	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3855.5	40.54428	2	1649.760647	1649.754948	R	G	405	420
PSM	GVLFGVPGAFTPGCSK	1102	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4352.2	52.78819	3	1672.773071	1672.768430	K	T	87	103
PSM	ELPAAEPVLSPLEGTK	1103	sp|Q9BY77|PDIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4037.2	45.1937	3	1729.861871	1729.853934	K	M	266	282
PSM	VTNGAFTGEISPGMIK	1104	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4099.6	46.80243	2	1780.760447	1780.750805	K	D	107	123
PSM	SYELPDGQVITIGNER	1105	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4037.3	45.19703	3	1789.888571	1789.884643	K	F	241	257
PSM	VLLPEYGGTKVVLDDK	1106	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3869.3	40.90633	3	1824.932771	1824.927433	K	D	71	87
PSM	NEIIQSPISQVPSVEK	1107	sp|Q7Z3T8|ZFY16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3846.3	40.3008	3	1846.907771	1846.907761	R	L	934	950
PSM	SYELPDGQVITIGNER	1108	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4253.2	50.65485	3	1869.857471	1869.850974	K	F	241	257
PSM	VSSGYVPPPVATPFSSK	1109	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3893.3	41.51863	3	1878.824171	1878.820599	R	S	168	185
PSM	HGSGPNIILTGDSSPGFSK	1110	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3682.4	36.05747	3	1949.889671	1949.888422	R	E	611	630
PSM	GSMSDGSYSPDYSLAAVDLK	1111	sp|P54750|PDE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4124.3	47.44152	3	2141.900471	2141.886433	K	S	479	499
PSM	EYIPTVFDNYSAQSAVDGR	1112	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4212.4	49.64243	3	2210.962571	2210.952145	K	T	31	50
PSM	GFFICDQPYEPVSPYSCK	1113	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4222.4	49.90268	3	2272.932371	2272.921045	R	E	676	694
PSM	IQQALTSPLPMTPILEGSHR	1114	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4225.5	49.96885	3	2348.112071	2348.100086	R	A	421	441
PSM	LRELDPSLVSANDSPSGMQTR	1115	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3688.6	36.21802	3	2352.086471	2352.078090	K	C	2148	2169
PSM	QLSSTSPLAPYPTSQMVSSDR	1116	sp|Q6UUV7|CRTC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.4031.3	45.04152	3	2411.026871	2411.011724	R	S	408	429
PSM	AAVPSGASTGIYEALELRDNDK	1117	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4245.2	50.45737	4	2436.073294	2436.061117	R	T	33	55
PSM	MVIQGPSSPQGEAMVTDVLEDQK	1118	sp|Q12888|TP53B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4350.3	52.73918	3	2538.157571	2538.138307	K	E	1107	1130
PSM	QSKPVTTPEEIAQVATISANGDK	1119	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3786.6	38.7395	3	2543.167871	2543.155746	K	E	158	181
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	1120	sp|Q9C0E8|LNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3751.6	37.85487	3	2619.227471	2619.213536	R	D	175	200
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1121	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21,22-UNIMOD:35,23-UNIMOD:21	ms_run[1]:scan=1.1.5041.2	61.9203	4	2968.340894	2968.325196	R	S	59	86
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1122	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3994.3	44.11258	5	3385.527618	3385.515651	K	A	399	429
PSM	SAVGFEYQGK	1123	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3379.2	28.22383	2	1164.488447	1164.485256	K	T	135	145
PSM	NPEVGLKPVWYSPK	1124	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3809.2	39.32662	3	1692.829871	1692.827660	K	V	536	550
PSM	SESAPTLHPYSPLSPK	1125	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3687.2	36.17848	3	1869.798971	1869.795113	R	G	100	116
PSM	MDSAGQDINLNSPNK	1126	sp|O43399|TPD54_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3445.2	29.94783	3	1740.7037	1740.7021	-	G	1	16
PSM	AESSESFTMASSPAQR	1127	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,9-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3397.4	28.70025	3	1822.7102	1822.7076	M	R	2	18
PSM	QLSSGVSEIR	1128	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.3765.2	38.20145	2	1137.5045	1137.5062	R	H	80	90
PSM	ATAEVLNIGK	1129	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4054.3	45.63993	2	1136.5467	1136.5473	M	K	2	12
PSM	ASGADSKGDDLSTAILK	1130	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3994.2	44.10925	3	1849.7782	1849.7742	M	Q	2	19
PSM	KYEDICPSTHNMDVPNIK	1131	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,8-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3366.3	27.88737	4	2255.962094	2255.959221	K	R	68	86
PSM	QQDLHLESPQRQPEYSPESPR	1132	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3362.3	27.78293	4	2600.169294	2600.165660	R	C	95	116
PSM	AAEEAFVNDIDESSPGTEWER	1133	sp|P09496-2|CLCA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4066.2	45.94995	4	2430.996094	2430.985295	R	V	163	184
PSM	MEPSSLELPADTVQR	1134	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.4244.2	50.43148	3	1793.7989	1793.7902	-	I	1	16
PSM	SHPSPQAKPSNPSNPR	1135	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.2900.2	17.35157	3	1821.8158	1821.8154	M	V	2	18
PSM	MNLLPNIESPVTRQEK	1136	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4507.3	55.5411	3	1989.9689	1989.9590	-	M	1	17
PSM	LLLDPSSPPTK	1137	sp|Q6IAA8|LTOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3695.3	36.39188	2	1246.621647	1246.621021	K	A	21	32
PSM	NLNNSNLFSPVNR	1138	sp|P52948|NUP98_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3933.4	42.56645	2	1568.703847	1567.714421	K	D	604	617
PSM	RELHGQNPVVTPCNK	1139	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3013.3	19.06505	4	1827.844894	1827.845118	K	Q	147	162
PSM	VLTPTQVK	1140	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3274.2	25.49323	2	964.499847	964.499449	K	N	40	48
PSM	DWDDDQND	1141	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3118.2	21.5168	2	1021.325647	1021.326098	K	-	541	549
PSM	SALFSESQK	1142	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3294.2	26.01425	2	1075.459247	1075.458706	K	A	566	575
PSM	HVEEFSPR	1143	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3089.4	20.80557	2	1079.443247	1079.443725	K	A	408	416
PSM	TLSDYNIQK	1144	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3224.2	24.22507	2	1080.546447	1080.545139	R	E	55	64
PSM	GGAAGGALPTSPGPALGAK	1145	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3564.3	33.0145	3	1628.794271	1628.792337	R	G	7	26
PSM	EGMTAFVEK	1146	sp|P30084|ECHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3626.2	34.62755	2	1090.438847	1090.440614	K	R	274	283
PSM	VLGTSPEAIDSAENR	1147	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3512.2	31.6671	3	1637.727971	1637.729796	R	F	1034	1049
PSM	DFTVSAMHGDMDQK	1148	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3620.2	34.47	3	1660.624871	1660.626259	R	E	296	310
PSM	VDALLSAQPK	1149	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3422.3	29.35083	2	1120.551447	1120.552941	K	G	950	960
PSM	TTEEQVQASTPCPR	1150	sp|Q14137|BOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3011.2	19.01495	3	1682.695871	1682.697116	K	T	97	111
PSM	IDEMPEAAVKSTANK	1151	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3225.4	24.25732	3	1682.761871	1682.758653	R	Y	30	45
PSM	ENVNATENCISAVGK	1152	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	27.28598	3	1684.713971	1684.712766	K	I	964	979
PSM	GHTDTEGRPPSPPPTSTPEK	1153	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3002.3	18.8113	4	2246.928094	2246.924624	R	C	353	373
PSM	DCGSVDGVIK	1154	sp|P61916|NPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3307.4	26.36068	2	1128.447447	1128.452241	K	E	26	36
PSM	NLQTVNVDEN	1155	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3280.3	25.65298	2	1144.535047	1144.536031	K	-	116	126
PSM	GTGLLSSDYR	1156	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3537.2	32.31443	2	1147.490047	1147.491069	K	I	402	412
PSM	QLSSGVSEIR	1157	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3371.3	28.01818	2	1154.533247	1154.533268	R	H	80	90
PSM	HAQDSDPRSPTLGIARTPMK	1158	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3306.2	26.32792	4	2337.030894	2337.033797	K	T	60	80
PSM	LQKLESPVAH	1159	sp|Q86TM6|SYVN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3127.4	21.75043	2	1200.590247	1200.590389	R	-	608	618
PSM	DITSDTSGDFR	1160	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3327.4	26.87708	2	1212.526647	1212.525861	K	N	167	178
PSM	NQDNLQGWNK	1161	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3210.5	23.88363	2	1215.564647	1215.563249	R	T	97	107
PSM	AGSSTPGDAPPAVAEVQGR	1162	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3411.2	29.05982	3	1845.828971	1845.825822	R	S	2885	2904
PSM	DRVTDALNATR	1163	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3328.3	26.89983	2	1230.631847	1230.631663	K	A	419	430
PSM	DNSTMGYMMAK	1164	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3452.2	30.13032	2	1247.499447	1247.498465	R	K	486	497
PSM	GSGPLSPSIQSR	1165	sp|P10586|PTPRF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3353.2	27.54488	2	1264.581047	1264.581281	K	T	995	1007
PSM	GSSGENNNPGSPTVSNFR	1166	sp|Q99576-3|T22D3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3276.2	25.54532	3	1899.778871	1899.774849	R	Q	32	50
PSM	SMGLPTSDEQK	1167	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3302.3	26.22645	2	1271.509047	1271.510484	K	K	298	309
PSM	LAEQAERYDDMASAMK	1168	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3510.2	31.61463	3	1907.781071	1907.779465	R	A	13	29
PSM	ELASPVSPELR	1169	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3541.4	32.42043	2	1276.607447	1276.606433	K	Q	175	186
PSM	VGNESPVQELK	1170	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3269.4	25.37037	2	1278.588047	1278.585698	K	Q	46	57
PSM	HTIIPAKSPEK	1171	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3025.2	19.32887	3	1299.654971	1299.658803	R	C	1908	1919
PSM	DKDAYSSFGSR	1172	sp|O00571|DDX3X_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3200.4	23.6207	2	1311.521647	1311.513261	K	S	65	76
PSM	TREAQQALGSAAADATEAK	1173	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3371.4	28.02152	3	1967.897171	1967.894964	K	N	1405	1424
PSM	FSTLTDDPSPR	1174	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3346.5	27.37333	2	1314.549447	1314.549312	R	L	1011	1022
PSM	NLSPGAVESDVR	1175	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3581.4	33.46315	2	1322.5940470956602	1322.58676022602	K	G	171	183
PSM	NLSPGAVESDVR	1176	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3589.3	33.6677	2	1322.588647	1322.586761	K	G	171	183
PSM	TAHNSEADLEESFNEHELEPSSPK	1177	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3646.3	35.1305	4	2776.1572	2776.1496	K	S	134	158
PSM	GGNFGGRSSGPYGGGGQYFAK	1178	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3481.6	30.8779	3	2099.886371	2099.885068	K	P	278	299
PSM	INVYYNEATGGK	1179	sp|P68371|TBB4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3368.6	27.94957	2	1407.616247	1407.607162	R	Y	47	59
PSM	GILAADESTGSIAK	1180	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3499.5	31.33792	2	1411.658847	1411.659591	K	R	29	43
PSM	DTPTSAGPNSFNK	1181	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3167.4	22.76672	2	1414.577847	1414.576590	R	G	138	151
PSM	EGLELPEDEEEK	1182	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3471.2	30.61527	2	1415.633847	1415.630385	K	K	412	424
PSM	KLDVEEPDSANSSFYSTR	1183	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3565.4	33.0441	3	2123.918171	2123.904860	K	S	1822	1840
PSM	EMPQDLRSPARTPPSEEDSAEAER	1184	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3200.5	23.62403	4	2873.166494	2873.157614	K	L	70	94
PSM	ISVREPMQTGIK	1185	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	27.75348	3	1437.702671	1437.705102	R	A	183	195
PSM	AMSTTSISSPQPGK	1186	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3145.3	22.19297	2	1470.642647	1470.642561	R	L	267	281
PSM	GTDTQTPAVLSPSK	1187	sp|P46087|NOP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	25.63358	2	1480.683847	1480.681055	K	T	722	736
PSM	PCSEETPAISPSK	1188	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3123.6	21.65493	2	1481.6141	1481.6104	M	R	2	15
PSM	IIYGGSVTGATCK	1189	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3411.5	29.06982	2	1485.600847	1485.597599	R	E	244	257
PSM	SSDQPLTVPVSPK	1190	sp|Q9ULW0|TPX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3620.5	34.48	2	1513.649447	1513.646658	K	F	728	741
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1191	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3519.5	31.86005	4	3162.512494	3162.502310	K	E	179	210
PSM	ACKVDSPTVTTTLK	1192	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3238.3	24.59137	3	1599.757571	1599.757925	K	N	455	469
PSM	KSEAPAEVTHFSPK	1193	sp|Q6PID6|TTC33_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3191.2	23.38058	3	1606.739171	1606.739239	K	S	186	200
PSM	RITSPLMEPSSIEK	1194	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3580.2	33.43037	3	1666.798571	1666.800124	K	I	53	67
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1195	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3569.5	33.15253	3	2559.251771	2559.241253	K	S	97	122
PSM	DYTGCSTSESLSPVK	1196	sp|O95297|MPZL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3371.2	28.01485	3	1709.689871	1709.685548	R	Q	199	214
PSM	DYTGCSTSESLSPVK	1197	sp|O95297|MPZL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3371.6	28.02818	2	1709.691647	1709.685548	R	Q	199	214
PSM	NLDIERPTYTNLNR	1198	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3508.2	31.56238	3	1717.874171	1717.874747	R	L	216	230
PSM	GQAAVQQLQAEGLSPR	1199	sp|P16152|CBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3560.6	32.92	2	1731.835847	1731.830513	R	F	43	59
PSM	IDEMPEAAVKSTANK	1200	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3277.4	25.57808	3	1762.726571	1762.724984	R	Y	30	45
PSM	DVQDSLTVSNEAQTAK	1201	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3378.4	28.2042	3	1784.785271	1784.782954	K	E	211	227
PSM	HYGGLTGLNKAETAAK	1202	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	27.67877	3	1789.778771	1789.780132	R	H	91	107
PSM	HAQDSDPRSPTLGIAR	1203	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3203.2	23.69197	4	1799.834494	1799.831576	K	T	60	76
PSM	DKPHVNVGTIGHVDHGK	1204	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3114.3	21.42165	4	1808.927694	1808.928179	R	T	54	71
PSM	NTCPGDRSAITPGGLR	1205	sp|P34897|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3313.4	26.51377	3	1830.750071	1830.748514	K	L	410	426
PSM	LSLEGDHSTPPSAYGSVK	1206	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3490.3	31.09673	3	1923.865571	1923.861539	K	A	11	29
PSM	EGNTTEDDFPSSPGNGNK	1207	sp|Q15007|FL2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3185.6	23.2378	3	1944.741071	1944.737460	R	S	295	313
PSM	GSLSNAGDPEIVKSPSDPK	1208	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3306.5	26.33792	3	1976.910671	1976.909217	R	Q	93	112
PSM	AYEDGCKTVDLKPDWGK	1209	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3504.2	31.45813	4	2060.892494	2060.891459	K	G	57	74
PSM	SAESPTSPVTSETGSTFKK	1210	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3469.5	30.57517	3	2099.875571	2099.870128	K	F	280	299
PSM	NQSPVDQGATGASQGLLDRK	1211	sp|P18827|SDC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3395.5	28.65152	3	2120.992271	2120.985176	R	E	231	251
PSM	GGSGSHNWGTVKDELTESPK	1212	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3402.2	28.82473	4	2164.946494	2164.942643	R	Y	217	237
PSM	NSLDASRPAGLSPTLTPGER	1213	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3623.4	34.55567	3	2197.983071	2197.976994	K	Q	138	158
PSM	NTNDANSCQIIIPQNQVNR	1214	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3480.4	30.84652	3	2198.047571	2198.049828	K	K	310	329
PSM	KLEKEEEEGISQESSEEEQ	1215	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3086.6	20.73487	3	2235.989771	2235.986661	K	-	89	108
PSM	RLQEDPNYSPQRFPNAQR	1216	sp|P46379|BAG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3300.3	26.17393	4	2295.053294	2295.054593	K	A	1109	1127
PSM	DTCYSPKPSVYLSTPSSASK	1217	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3661.4	35.50897	3	2333.957771	2333.952813	K	A	538	558
PSM	FNSESESGSEASSPDYFGPPAK	1218	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3623.6	34.56233	3	2368.945571	2368.937282	R	N	96	118
PSM	AAAAAAAAAPAAAATAPTTAATTAATAAQ	1219	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3647.4	35.1584	3	2447.179571	2447.169348	K	-	108	137
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1220	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3457.5	30.26795	4	3093.286494	3093.277137	R	-	738	768
PSM	DLTDYLMK	1221	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4013.2	44.58678	2	997.479247	997.479034	R	I	186	194
PSM	NTPASASLEGLAQTAGR	1222	sp|Q96Q45|TM237_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3894.2	41.5413	3	1722.793871	1722.793793	K	R	43	60
PSM	DGEEAGAYDGPRTADGIVSHLK	1223	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3682.3	36.05413	4	2337.029694	2337.027435	R	K	108	130
PSM	SADTLWDIQK	1224	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3696.2	36.41473	2	1175.583047	1175.582253	K	D	320	330
PSM	GTPLISPLIK	1225	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4237.2	50.27112	2	1197.583847	1197.581144	R	W	826	836
PSM	VEVTEFEDIK	1226	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3676.4	35.90007	2	1207.595447	1207.597235	K	S	133	143
PSM	FQPQSPDFLDITNPK	1227	sp|Q92890|UFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4208.2	49.53067	3	1825.829471	1825.828782	K	A	125	140
PSM	GPPQSPVFEGVYNNSR	1228	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3718.2	36.98987	3	1826.797271	1826.798879	K	M	107	123
PSM	QVPDSAATATAYLCGVK	1229	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3907.2	41.87978	3	1830.824171	1830.822317	R	A	107	124
PSM	ADLINNLGTIAK	1230	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3827.3	39.8012	2	1241.696847	1241.697952	K	F	96	108
PSM	DMASPNWSILPEEER	1231	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.4136.4	47.75872	3	1868.769071	1868.765196	R	N	327	342
PSM	YLGSPITTVPK	1232	sp|P30307|MPIP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3690.3	36.26063	2	1254.627847	1254.626106	K	L	165	176
PSM	DSPSVWAAVPGK	1233	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3822.5	39.67693	2	1292.582447	1292.580219	K	T	27	39
PSM	NELESYAYSLK	1234	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3718.4	36.99653	2	1315.629447	1315.629597	R	N	563	574
PSM	SGFGEISSPVIR	1235	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3832.4	39.93604	2	1327.618647	1327.617332	R	E	4	16
PSM	KAEAAASALADADADLEER	1236	sp|O43633|CHM2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3796.2	38.98825	3	1995.884771	1995.878645	K	L	197	216
PSM	ADIDVSGPKVDIDTPDIDIHGPEGK	1237	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3911.2	41.9878	4	2682.248894	2682.242573	K	L	4087	4112
PSM	EFSPFGSITSAK	1238	sp|Q13310|PABP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4046.2	45.42683	2	1349.593647	1349.590449	K	V	313	325
PSM	EFSPFGTITSAK	1239	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4107.3	47.00117	2	1363.609447	1363.606099	K	V	313	325
PSM	SESVEGFLSPSR	1240	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3769.2	38.30587	2	1373.591247	1373.586426	R	C	1311	1323
PSM	SIPLECPLSSPK	1241	sp|Q92667|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3750.4	37.82338	2	1406.654847	1406.651669	K	G	142	154
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1242	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,16-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3866.2	40.82415	4	2833.364494	2833.352672	K	S	362	389
PSM	GSGGLFSPSTAHVPDGALGQR	1243	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4002.3	44.32157	3	2169.935171	2169.924564	R	D	1023	1044
PSM	LTFDSSFSPNTGK	1244	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3767.4	38.26035	2	1479.632447	1479.628291	K	K	97	110
PSM	MAESPCSPSGQQPPSPPSPDELPANVK	1245	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3849.3	40.3797	4	2963.229694	2963.211957	K	Q	1292	1319
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1246	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:21	ms_run[1]:scan=1.1.5070.2	62.12283	4	2968.340894	2968.325196	R	S	59	86
PSM	TLNDELEIIEGMK	1247	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4310.4	51.8941	2	1503.755047	1503.749061	K	F	206	219
PSM	TLTIVDTGIGMTK	1248	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4144.3	47.96712	2	1508.665047	1508.659865	R	A	28	41
PSM	VLDNYLTSPLPEEVDETSAEDEGVSQR	1249	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4213.3	49.67503	4	3071.363694	3071.349617	K	K	139	166
PSM	IADPEHDHTGFLTEYVATR	1250	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3754.5	37.9269	3	2330.972171	2330.961009	R	W	190	209
PSM	EGSVLDILKSPGFASPK	1251	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4311.2	51.92038	3	1823.913071	1823.907032	K	I	605	622
PSM	NPDDITQEEYGEFYK	1252	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3750.3	37.82005	3	1846.794371	1846.789740	R	S	292	307
PSM	WLDDLLASPPPSGGGAR	1253	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4693.3	58.18982	3	1867.796171	1867.790696	R	R	684	701
PSM	SATSSSPGSPLHSLETSL	1254	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4620.2	57.28195	3	1916.787071	1916.780585	K	-	1203	1221
PSM	DLKPSNLLLNTTCDLK	1255	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3997.3	44.19068	3	1923.942071	1923.937681	R	I	149	165
PSM	DSGPLPTPPGVSLLGEPPK	1256	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4541.2	56.00277	3	1936.961771	1936.954711	K	D	482	501
PSM	SGAMSPMSWNSDASTSEAS	1257	sp|Q13158|FADD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3969.4	43.50713	2	1981.717647	1981.707088	R	-	190	209
PSM	MASPPAPSPAPPAISPIIK	1258	sp|Q00587|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4182.2	48.85277	3	2000.953271	2000.944754	R	N	99	118
PSM	EFFPIADGDQQSPIEIK	1259	sp|Q8N1Q1|CAH13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4351.3	52.76523	3	2012.925971	2012.913240	K	T	19	36
PSM	AAPEASSPPASPLQHLLPGK	1260	sp|Q96TA1|NIBA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3898.2	41.64572	4	2047.011694	2047.013957	K	A	686	706
PSM	CSPTVAFVEFPSSPQLK	1261	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,4-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4566.3	56.55068	3	2052.879371	2052.866898	R	N	669	686
PSM	TIGGGDDSFNTFFSETGAGK	1262	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=1.1.4220.3	49.84705	3	2086.862471	2086.852096	K	H	41	61
PSM	EAPETDTSPSLWDVEFAK	1263	sp|Q92665|RT31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4310.3	51.88743	3	2100.903971	2100.892898	K	Q	267	285
PSM	SAGVQCFGPTAEAAQLESSK	1264	sp|P22102|PUR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3858.2	40.61337	3	2116.919771	2116.913651	R	R	88	108
PSM	SIQTPQSHGTLTAELWDNK	1265	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3831.5	39.91298	3	2205.016871	2205.010328	K	V	1977	1996
PSM	ESMCSTPAFPVSPETPYVK	1266	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,5-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4132.2	47.64688	3	2285.915171	2285.902691	K	T	839	858
PSM	EASRPPEEPSAPSPTLPAQFK	1267	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3681.5	36.0346	3	2315.087771	2315.083493	R	Q	351	372
PSM	AAVPSGASTGIYEALELRDNDK	1268	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4065.2	45.92385	4	2356.097694	2356.094786	R	T	33	55
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1269	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4,12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3761.3	38.10185	4	2378.079694	2378.078288	K	S	366	389
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1270	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4082.4	46.35683	3	2408.002871	2407.988786	R	-	223	246
PSM	RGFFICDQPYEPVSPYSCK	1271	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,14-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3984.3	43.8651	3	2429.032871	2429.022156	R	E	675	694
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1272	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4058.2	45.74118	4	2515.089294	2515.082187	K	A	30	54
PSM	RVATPVDWKDGDSVMVLPTIPEEEAK	1273	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4134.2	47.6996	4	2961.436894	2961.419491	K	K	174	200
PSM	LDSPPPSPITEASEAAEAAEAGNLAVSSR	1274	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.5176.2	63.0217	3	2996.332271	2996.305323	R	E	492	521
PSM	GVVDSEDLPLNISR	1275	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4068.4	46.00832	2	1592.749047	1592.744718	R	E	387	401
PSM	VLLPEYGGTK	1276	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3629.3	34.70955	2	1155.560247	1155.557692	K	V	71	81
PSM	GGNFGGRSSGPYGGGGQYFAK	1277	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3489.4	31.07412	3	2099.886371	2099.885068	K	P	278	299
PSM	NPEVGLKPVWYSPK	1278	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3801.2	39.11763	3	1692.829871	1692.827660	K	V	536	550
PSM	SGTSEFLNK	1279	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3303.4	26.25623	2	1061.440247	1061.443056	K	M	169	178
PSM	ESVPEFPLSPPK	1280	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4043.2	45.34867	2	1405.657847	1405.653049	K	K	30	42
PSM	AESSESFTMASSPAQRR	1281	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3484.3	30.94313	3	1962.8185	1962.8137	M	R	2	19
PSM	CSGPGLSPGMVR	1282	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3864.2	40.77147	2	1279.5192	1279.5082	K	A	1453	1465
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1283	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4257.4	50.77153	3	2829.2172	2829.1962	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	1284	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4265.3	50.97272	3	2829.2172	2829.1962	-	Y	1	25
PSM	QVPDSAATATAYLCGVK	1285	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4303.2	51.75747	3	1813.8052	1813.7952	R	A	107	124
PSM	LAIQGPEDSPSR	1286	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3314.5	26.5429	2	1348.601447	1348.602411	R	Q	230	242
PSM	QREEYQPATPGLGMFVEVKDPEDK	1287	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3988.2	43.95973	4	2841.2672	2841.2562	K	V	72	96
PSM	MNPVYSPGSSGVPYANAK	1288	sp|A1KXE4|F168B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3819.4	39.59488	3	1975.8431	1975.8382	-	G	1	19
PSM	NVSSFPDDATSPLQENR	1289	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3665.4	35.61348	3	1956.828971	1955.826216	R	N	52	69
PSM	CESAFLSK	1290	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.4136.2	47.75205	2	1003.3711	1003.3717	K	R	36	44
PSM	CESAFLSK	1291	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.4144.2	47.96045	2	1003.3711	1003.3717	K	R	36	44
PSM	NILLTNEQLESARK	1292	sp|Q9H9B4|SFXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3550.3	32.6505	3	1707.856271	1707.855665	R	I	36	50
PSM	NQTAEKEEFEHQQK	1293	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2872.2	17.02002	4	1744.800894	1744.801642	K	E	584	598
PSM	LVPVLSAK	1294	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3591.2	33.7168	2	905.497647	905.498721	K	A	270	278
PSM	TIAPALVSK	1295	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3414.2	29.13828	2	978.515247	978.515099	K	K	72	81
PSM	DGYNYTLSK	1296	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3275.3	25.52272	2	1059.485247	1059.487290	K	T	28	37
PSM	SGLTVPTSPK	1297	sp|Q53EL6|PDCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	26.61135	2	1065.511647	1065.510742	R	G	87	97
PSM	LTFDSSFSPNTGKK	1298	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3552.2	32.69921	3	1607.725871	1607.723254	K	N	97	111
PSM	GGEIQPVSVK	1299	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3257.2	25.0565	2	1092.521047	1092.521641	K	V	57	67
PSM	LVLVGDGGTGK	1300	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3439.2	29.79117	2	1094.535247	1094.537291	K	T	13	24
PSM	YNLKSPAVK	1301	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3151.2	22.34468	2	1098.546047	1098.547462	R	R	5	14
PSM	LGIHEDSTNR	1302	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2980.2	18.34205	3	1140.550571	1140.552350	K	R	439	449
PSM	SASVAPFTCK	1303	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3326.5	26.85432	2	1146.475847	1146.478062	K	T	1057	1067
PSM	SASVAPFTCK	1304	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3388.2	28.45882	2	1146.483047	1146.478062	K	T	1057	1067
PSM	QLSSGVSEIR	1305	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3355.3	27.6006	2	1154.534447	1154.533268	R	H	80	90
PSM	GASLKSPLPSQ	1306	sp|Q86TS9|RM52_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3329.3	26.92597	2	1163.558647	1163.558755	K	-	113	124
PSM	LLSESAQPLK	1307	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3430.3	29.55955	2	1164.577047	1164.579156	K	K	224	234
PSM	DNLTSATLPR	1308	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3541.2	32.41376	2	1166.532047	1166.533268	K	N	302	312
PSM	TISPMVMDAK	1309	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3566.2	33.06355	2	1171.502847	1171.501834	K	A	793	803
PSM	LALGDDSPALK	1310	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	33.19468	2	1178.558847	1178.558421	R	E	87	98
PSM	TDSVIIADQTPTPTR	1311	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3546.2	32.5425	3	1773.761171	1773.758727	R	F	42	57
PSM	ATEPPSPDAGELSLASR	1312	sp|Q8IYB8|SUV3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3630.2	34.73265	3	1776.798071	1776.793125	K	L	720	737
PSM	EAAENSLVAYK	1313	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3290.3	25.91433	2	1193.592047	1193.592818	K	A	143	154
PSM	KKPRPPPALGPEETSASAGLPK	1314	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	17.0	15-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3370.3	27.992	4	2387.1704941913204	2387.1651280448195	K	K	14	36
PSM	DLLTPCYSR	1315	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3660.3	35.47957	2	1203.500047	1203.499526	K	Q	304	313
PSM	RWDQTADQTPGATPK	1316	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3134.6	21.91798	3	1830.742571	1830.733910	R	K	199	214
PSM	QNTLVNNVSSPLPGEGK	1317	sp|Q15771|RAB30_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	33.32862	3	1832.869871	1832.866958	R	S	176	193
PSM	SASVAPFTCK	1318	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3446.4	29.98062	2	1226.445847	1226.444393	K	T	1057	1067
PSM	RDYDDMSPR	1319	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3029.2	19.42677	2	1233.447647	1233.448553	R	R	278	287
PSM	EITALAPSTMK	1320	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3603.2	34.02635	2	1240.576847	1240.577441	K	I	318	329
PSM	SLGSAGPSGTLPR	1321	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3409.4	29.01457	2	1278.598047	1278.596931	R	S	332	345
PSM	DITSDTSGDFR	1322	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	30.33563	2	1292.492447	1292.492192	K	N	167	178
PSM	ASPGTPLSPGSLR	1323	sp|Q96BD0|SO4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3566.3	33.06688	2	1318.630647	1318.628231	R	S	33	46
PSM	EITALAPSTMK	1324	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3645.2	35.10268	2	1320.543647	1320.543772	K	I	318	329
PSM	KQSKPVTTPEEIAQVATISANGDK	1325	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3630.3	34.73598	4	2671.260894	2671.250709	K	E	157	181
PSM	TPSPKEEDEEPESPPEK	1326	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3027.2	19.37815	3	2003.826671	2003.824878	K	K	202	219
PSM	LDQPVSAPPSPR	1327	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3245.2	24.76142	2	1342.629647	1342.628231	K	D	235	247
PSM	DGFPSGTPALNAK	1328	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3548.2	32.59485	2	1353.596647	1353.596597	K	G	148	161
PSM	LSSWDQAETPGHTPSLR	1329	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3605.4	34.08541	3	2040.839471	2040.834352	K	W	215	232
PSM	LQAPDSATLLEK	1330	sp|Q9BUL5|PHF23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3635.4	34.86765	2	1364.659847	1364.658863	R	M	119	131
PSM	ESDFSDTLSPSK	1331	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3385.5	28.39083	2	1391.552447	1391.549372	K	E	444	456
PSM	EGLELPEDEEEK	1332	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3479.4	30.82197	2	1415.633847	1415.630385	K	K	412	424
PSM	SAGLEQPTDPVAR	1333	sp|O75410|TACC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3356.5	27.63333	2	1419.639247	1419.639524	K	D	361	374
PSM	ESYDAPPTPSGAR	1334	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	22.32248	2	1426.582847	1426.576590	R	L	109	122
PSM	EMPQDLRSPARTPPSEEDSAEAER	1335	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3344.5	27.32177	4	2857.170094	2857.162699	K	L	70	94
PSM	DNPGVVTCLDEAR	1336	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3517.4	31.80438	2	1444.662447	1444.661643	K	H	227	240
PSM	EALSPCPSTVSTK	1337	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3216.3	24.02912	2	1455.636247	1455.631662	R	S	670	683
PSM	HEILDADGICSPGEKVENK	1338	sp|Q9NW08|RPC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3444.4	29.92842	3	2189.972171	2189.966415	R	Q	806	825
PSM	SCTPSPDQISHR	1339	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3054.3	19.9717	3	1463.586671	1463.586443	R	A	271	283
PSM	EFGSLPTTPSEQR	1340	sp|O15400|STX7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3536.5	32.29967	2	1527.665247	1527.660654	K	Q	72	85
PSM	NHCGIASAASYPTV	1341	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3619.6	34.45715	2	1526.626247	1526.622494	R	-	320	334
PSM	ELSDQATASPIVAR	1342	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3378.6	28.21087	2	1536.722447	1536.718503	K	T	88	102
PSM	LAVDEEENADNNTK	1343	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3055.4	20.00065	3	1560.692171	1560.690360	K	A	40	54
PSM	TEAQDLCRASPEPPGPESSSR	1344	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3228.4	24.33512	3	2349.995771	2349.989669	R	W	663	684
PSM	DLEEDHACIPIKK	1345	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3275.2	25.51938	3	1566.771371	1566.771193	K	S	560	573
PSM	APVPGTPDSLSSGSSR	1346	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3292.6	25.97633	2	1593.705247	1593.703581	K	D	322	338
PSM	PYQYPALTPEQKK	1347	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3346.3	27.36667	3	1641.7814	1641.7799	M	E	2	15
PSM	NIIHGSDSVKSAEK	1348	sp|O60361|NDK8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3056.6	20.03295	3	1643.695571	1643.695733	R	E	100	114
PSM	WLKSPTTPIDPEK	1349	sp|Q08AD1|CAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3631.2	34.75877	3	1670.739371	1670.735807	K	Q	859	872
PSM	IISTTASKTETPIVSK	1350	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	23.85107	3	1754.907071	1754.906698	K	S	140	156
PSM	LREVVETPLLHPER	1351	sp|P35998|PRS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3522.2	31.92855	3	1766.907371	1766.908035	K	F	187	201
PSM	RLQSIGTENTEENRR	1352	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2991.3	18.57978	3	1801.903571	1801.903087	K	F	43	58
PSM	QLLKSPELPSPQAEK	1353	sp|Q9H078|CLPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3636.3	34.88892	3	1823.851271	1823.847148	K	R	659	674
PSM	QNQTTAISTPASSEISK	1354	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3263.3	25.21233	3	1841.845871	1841.840803	K	A	1753	1770
PSM	TPEPSSPVKEPPPVLAK	1355	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3402.3	28.82807	3	1851.940271	1851.938332	K	P	639	656
PSM	MLDAEDIVNTARPDEK	1356	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3605.3	34.08208	3	1895.835971	1895.833609	K	A	240	256
PSM	LPQSSSSESSPPSPQPTK	1357	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3047.3	19.7961	3	1919.858471	1919.851368	K	V	412	430
PSM	TVIDYNGERTLDGFKK	1358	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3510.3	31.61797	3	1934.912471	1934.913909	R	F	453	469
PSM	KPVTVSPTTPTSPTEGEAS	1359	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3267.3	25.3149	3	1964.902871	1964.897984	R	-	505	524
PSM	SSGSPYGGGYGSGGGSGGYGSR	1360	sp|P51991|ROA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3180.3	23.09955	3	1989.756071	1989.749028	R	R	355	377
PSM	GNSRPGTPSAEGGSTSSTLR	1361	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3017.2	19.16223	3	1997.883071	1997.880377	R	A	383	403
PSM	DSGLESPAAAEAPLRGQYK	1362	sp|Q8NBR6|MINY2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3610.2	34.20895	3	2038.940771	2038.936101	K	V	89	108
PSM	NQGGYGGSSSSSSYGSGRRF	1363	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3181.6	23.1352	3	2076.833471	2076.828675	R	-	353	373
PSM	DSESSNDDTSFPSTPEGIK	1364	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3563.3	32.98825	3	2091.819071	2091.815770	K	D	437	456
PSM	TVEVAEGEAVRTPQSVTAK	1365	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3410.5	29.04375	3	2130.966671	2130.959947	R	Q	132	151
PSM	MPPRTPAEASSTGQTGPQSAL	1366	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3490.4	31.10007	3	2242.938971	2242.933080	K	-	238	259
PSM	NNEESPTATVAEQGEDITSKK	1367	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3434.4	29.66753	3	2327.022071	2327.016595	K	D	9	30
PSM	VKSATLSSTESTASEMQEEMK	1368	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3622.5	34.53263	3	2353.016171	2353.006624	K	G	638	659
PSM	IVRGDQPAASGDSDDDEPPPLPR	1369	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3405.4	28.90995	3	2483.106671	2483.096577	K	L	45	68
PSM	GHHLPSENLGKEPLDPDPSHSPSDK	1370	sp|Q8NFQ8|TOIP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3324.3	26.79543	5	2769.240618	2769.239553	K	V	100	125
PSM	GGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSR	1371	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	29-UNIMOD:21	ms_run[1]:scan=1.1.3627.5	34.66368	4	2953.108094	2953.096136	R	G	233	266
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1372	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3343.4	27.29265	5	3112.515118	3112.507789	R	S	847	876
PSM	EGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGK	1373	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=1.1.3295.6	26.05332	4	3492.339694	3492.326786	K	A	111	145
PSM	AVDSLVPIGR	1374	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	40.50795	2	1105.553047	1105.553276	K	G	195	205
PSM	DRSSPPPGYIPDELHQVAR	1375	sp|Q9Y2U5|M3K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3676.2	35.8934	4	2213.031694	2213.026647	R	N	161	180
PSM	GTPLISPLIK	1376	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4098.2	46.76313	2	1117.616047	1117.614813	R	W	826	836
PSM	IADPEHDHTGFLTEYVATR	1377	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3797.2	39.01439	4	2330.966494	2330.961009	R	W	190	209
PSM	ESAFEFLSSA	1378	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4827.2	59.52755	2	1166.457447	1166.453287	K	-	325	335
PSM	EAALPPVSPLK	1379	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3688.3	36.20802	2	1200.613447	1200.615542	R	A	1224	1235
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1380	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4067.2	45.97605	4	2407.994894	2407.988786	R	-	223	246
PSM	LLSPRPSLLTPTGDPR	1381	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3929.2	42.45535	3	1878.902771	1878.900581	R	A	937	953
PSM	DLKPSNLLLNTTCDLK	1382	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3941.2	42.767	3	1923.941771	1923.937681	R	I	149	165
PSM	DITEEIMSGAR	1383	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3923.2	42.29867	2	1300.538247	1300.537033	K	T	191	202
PSM	ALVEFESNPEETREPGSPPSVQR	1384	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3679.3	35.9754	4	2634.200094	2634.196291	R	A	31	54
PSM	KKIEEAMDGSETPQLFTVLPEK	1385	sp|Q13435|SF3B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3993.3	44.08732	4	2649.213694	2649.205004	K	R	769	791
PSM	EGLELLKTAIGK	1386	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3852.3	40.45875	2	1350.718847	1350.715984	K	A	222	234
PSM	TYITDPVSAPCAPPLQPK	1387	sp|Q93052|LPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3925.3	42.35435	3	2033.958071	2033.953331	K	G	354	372
PSM	EFSPFGTITSAK	1388	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4030.5	45.02225	2	1363.607447	1363.606099	K	V	313	325
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	1389	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3806.2	39.24778	4	2756.210494	2756.199676	K	E	296	321
PSM	GGLNTPLHESDFSGVTPQR	1390	sp|Q99459|CDC5L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3673.4	35.82167	3	2090.947271	2090.942249	K	Q	381	400
PSM	AEREKTPSAETPSEPVDWTFAQR	1391	sp|O60333|KIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	39.0664	4	2791.195694	2791.189171	R	E	642	665
PSM	ELEEIVQPIISK	1392	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3938.2	42.69013	2	1396.785247	1396.781347	K	L	622	634
PSM	LGGSAVISLEGKPL	1393	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4125.2	47.46388	2	1419.744847	1419.737448	K	-	153	167
PSM	GFPTIYFSPANK	1394	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4150.4	48.10578	2	1420.647247	1420.642819	R	K	449	461
PSM	TLTIVDTGIGMTK	1395	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3885.6	41.31895	2	1428.695447	1428.693534	R	A	28	41
PSM	DQLIYNLLKEEQTPQNK	1396	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4178.5	48.7539	3	2153.048171	2153.040566	K	I	6	23
PSM	LFMAQALQEYNN	1397	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4131.5	47.63073	2	1440.674847	1440.670751	K	-	341	353
PSM	EFSPFGTITSAK	1398	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4264.2	50.94358	2	1443.578047	1443.572430	K	V	313	325
PSM	SFGTRPLSSGFSPEEAQQQDEEFEK	1399	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3846.4	40.30413	4	2909.252894	2909.239278	R	K	976	1001
PSM	ASGQAFELILSPR	1400	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4188.3	49.01063	2	1467.718447	1467.712296	R	S	15	28
PSM	CDENILWLDYK	1401	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4121.3	47.36457	2	1467.676447	1467.670417	K	N	152	163
PSM	DFTPVCTTELGR	1402	sp|P30041|PRDX6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3768.5	38.28977	2	1474.620647	1474.616346	R	A	42	54
PSM	NLEQILNGGESPK	1403	sp|Q13033|STRN3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3916.5	42.12573	2	1477.684247	1477.681389	K	Q	219	232
PSM	MAESPCSPSGQQPPSPPSPDELPANVK	1404	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,9-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3841.3	40.16905	4	2963.229694	2963.211957	K	Q	1292	1319
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1405	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3912.3	42.01422	4	2972.338094	2972.324602	K	Q	178	204
PSM	GFSVVADTPELQR	1406	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3751.5	37.85153	2	1497.686047	1497.686475	K	I	97	110
PSM	TTPSVVAFTADGER	1407	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3745.3	37.69655	2	1529.679447	1529.676304	R	L	86	100
PSM	GASSPLITVFTDDK	1408	sp|Q15155|NOMO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4206.2	49.4814	2	1529.706247	1529.701456	K	G	822	836
PSM	GNPTVEVDLFTSK	1409	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4144.4	47.97378	2	1565.649847	1565.641572	R	G	16	29
PSM	APNTPDILEIEFK	1410	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4343.4	52.61878	2	1565.746647	1565.737842	K	K	216	229
PSM	QQEPVTSTSLVFGK	1411	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3799.6	39.07973	2	1599.754447	1599.754554	K	K	1107	1121
PSM	CEFQDAYVLLSEK	1412	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4100.4	46.82852	2	1600.751247	1600.744310	K	K	237	250
PSM	KQSLGELIGTLNAAK	1413	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4054.2	45.6366	3	1621.844471	1621.844038	R	V	56	71
PSM	IFVGGLSPDTPEEK	1414	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3949.3	42.97508	2	1647.689247	1647.683437	K	I	184	198
PSM	FSPVTPKFTPVASK	1415	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3759.2	38.04688	3	1664.763071	1664.761628	K	F	266	280
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1416	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3814.5	39.46707	3	2574.011771	2573.998594	R	G	239	267
PSM	VTNGAFTGEISPGMIK	1417	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3751.3	37.84487	3	1716.780971	1716.779389	K	D	107	123
PSM	GADFLVTEVENGGSLGSK	1418	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4056.2	45.68888	3	1778.868071	1778.868659	K	K	189	207
PSM	DCEECIQLEPTFIK	1419	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.4052.2	45.5838	3	1780.801571	1780.801173	K	G	416	430
PSM	NSVTPDMMEEMYKK	1420	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3688.2	36.20469	3	1781.711471	1781.707546	K	A	229	243
PSM	TITLEVEPSDTIENVK	1421	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3851.3	40.43253	3	1786.920971	1786.920025	K	A	12	28
PSM	TWTTPEVTSPPPSPR	1422	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3714.2	36.88522	3	1811.756771	1811.753248	R	T	125	140
PSM	EALAEAALESPRPALVR	1423	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3776.2	38.47623	3	1871.953271	1871.950628	R	S	271	288
PSM	VSSGYVPPPVATPFSSK	1424	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3903.2	41.77592	3	1878.824171	1878.820599	R	S	168	185
PSM	KYEQGFITDPVVLSPK	1425	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	42.03713	3	1899.944471	1899.938332	K	D	109	125
PSM	ALYDNVAESPDELSFR	1426	sp|P56945|BCAR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4079.2	46.27495	3	1904.823371	1904.819339	K	K	10	26
PSM	SATSSSPGSPLHSLETSL	1427	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4306.2	51.81685	3	1916.789771	1916.780585	K	-	1203	1221
PSM	LDGLVETPTGYIESLPR	1428	sp|P55209|NP1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4563.2	56.49763	3	1938.945071	1938.933975	R	V	56	73
PSM	AFLASPEYVNLPINGNGKQ	1429	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4283.2	51.3166	3	2111.020571	2111.008872	K	-	192	211
PSM	DNLTLWTSDQQDEEAGEGN	1430	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4035.3	45.1453	3	2120.883371	2120.877051	R	-	228	247
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	1431	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3673.5	35.825	4	2853.400494	2853.390968	K	K	62	95
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	1432	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.4102.2	46.87068	4	3013.356094	3013.339266	K	V	8	36
PSM	SGEEDFESLASQFSDCSSAK	1433	sp|Q13526|PIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.4274.2	51.16908	3	2259.865571	2259.851504	K	A	98	118
PSM	DSALQDTDDSDDDPVLIPGAR	1434	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4053.2	45.61038	3	2293.969571	2293.958746	R	Y	648	669
PSM	QVEEQSAAANEEVLFPFCR	1435	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.4397.3	53.67693	3	2303.006171	2302.992964	K	E	218	237
PSM	DAEKTPAVSISCLELSNNLEK	1436	sp|Q9Y6M5|ZNT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.4052.4	45.59047	3	2397.121871	2397.113473	K	K	458	479
PSM	DFSPGLFEDPSVAFATPDPKK	1437	sp|Q7Z5J4|RAI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4728.3	58.59115	3	2424.047171	2424.032777	K	T	681	702
PSM	DYEIESQNPLASPTNTLLGSAK	1438	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4536.2	55.93375	3	2507.107571	2507.086998	K	E	618	640
PSM	GISCMNTTLSESPFKCDPDAAR	1439	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4,12-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3778.5	38.5341	3	2536.052771	2536.043362	K	A	239	261
PSM	FNEEHIPDSPFVVPVASPSGDAR	1440	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4162.5	48.3882	3	2626.131071	2626.114215	K	R	2311	2334
PSM	SQLPTLEQDGGTQNPVSSPGMSQELR	1441	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3920.6	42.23365	3	2835.292571	2835.274618	R	T	350	376
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	1442	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3901.6	41.73718	4	3393.361294	3393.345713	K	F	86	114
PSM	QSKPVTTPEEIAQVATISANGDK	1443	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,18-UNIMOD:21	ms_run[1]:scan=1.1.3947.5	42.93028	3	2446.1752	2446.1622	K	E	158	181
PSM	VAPEEHPVLLTEAPLNPK	1444	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3821.4	39.64758	3	2033.0275	2033.0229	R	A	96	114
PSM	SSPNPFVGSPPK	1445	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3521.5	31.91232	2	1293.577447	1292.580219	K	G	393	405
PSM	ESVPEFPLSPPK	1446	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4000.4	44.27258	2	1406.656047	1405.653049	K	K	30	42
PSM	AAQGEPQVQFK	1447	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3486.2	30.9909	2	1243.6131	1243.6192	M	L	2	13
PSM	QQEPVTSTSLVFGK	1448	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=1.1.4161.3	48.36525	2	1582.7327	1582.7275	K	K	1107	1121
PSM	EGFSIPVSADGFK	1449	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4438.2	54.29293	2	1512.600847	1512.593894	K	F	1887	1900
PSM	QPPPLAPQSPQGGVMGGSNSNQQQQMR	1450	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3554.5	32.761	4	2898.296494	2898.290225	K	L	281	308
PSM	QSPASPPPLGGGAPVR	1451	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.3724.4	37.15285	2	1549.7307	1549.7285	R	T	1444	1460
PSM	DNLTLWTSDQQDDDGGEGNN	1452	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4057.3	45.71833	3	2192.881271	2192.873028	R	-	228	248
PSM	QEEEAAQQGPVVVSPASDYK	1453	sp|O75391|SPAG7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=1.1.3722.3	37.09785	3	2193.9505	2193.9462	R	D	145	165
PSM	MTEWETAAPAVAETPDIK	1454	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4552.2	56.21338	3	2080.9182	2080.9062	-	L	1	19
PSM	MEPSSLELPADTVQR	1455	sp|Q16719|KYNU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.4372.2	53.10258	3	1793.7989	1793.7902	-	I	1	16
PSM	NGNGGPGPYVGQAGTATLPR	1456	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3700.3	36.52267	3	1963.884371	1962.894904	K	N	185	205
PSM	DTSSITSCGDGNVVKQEQLSPK	1457	sp|Q9Y6Q9|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3414.4	29.14495	4	2429.087294	2429.078150	K	K	709	731
PSM	SGPDVETPSAIQICR	1458	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3912.2	42.01088	3	1750.7618	1750.7592	M	I	2	17
PSM	DGLNDDDFEPYLSPQAR	1459	sp|Q9Y5A9|YTHD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4141.3	47.889	3	2030.836871	2030.825881	K	P	27	44
PSM	SASDLSEDLFK	1460	sp|Q92541|RTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4000.3	44.26925	2	1290.544447	1290.538079	K	V	650	661
PSM	RLSSSSATLLNSPDRAR	1461	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3294.5	26.02425	3	1989.904571	1989.903435	K	R	198	215
PSM	KAEAGAGSATEFQFR	1462	sp|Q9NQ39|RS10L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3438.2	29.76515	3	1649.729771	1648.724651	K	G	150	165
PSM	FVLSSGK	1463	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	26.2231	2	816.376647	816.378271	K	F	49	56
PSM	FYEAFSK	1464	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3362.2	27.7796	2	890.414247	890.417420	K	N	429	436
PSM	LELCDERVSSR	1465	sp|P07919|QCR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3281.2	25.67582	3	1442.623271	1442.622494	R	S	50	61
PSM	LGAPALTSR	1466	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3307.3	26.35735	2	964.471647	964.474297	R	Q	426	435
PSM	MLQAISPK	1467	sp|P49585|PCY1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	26.92263	2	966.460247	966.460955	R	Q	310	318
PSM	FANLTPSR	1468	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3324.2	26.7921	2	984.441647	984.442997	K	T	2050	2058
PSM	AMAPTSPQI	1469	sp|Q9BYD2|RM09_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3556.2	32.80238	2	994.417247	994.419484	K	-	259	268
PSM	SCNCLLLK	1470	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3350.2	27.4672	2	1006.491847	1006.493973	K	V	336	344
PSM	TPESSHEGLITDPHSPSR	1471	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3154.3	22.42592	4	2025.880494	2025.879314	R	F	719	737
PSM	GVISTPVIR	1472	sp|Q9NZB2|F120A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3578.2	33.37777	2	1020.535047	1020.536897	R	T	987	996
PSM	TVSPALISR	1473	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3395.2	28.64152	2	1022.513447	1022.516162	K	F	374	383
PSM	VLLPEYGGTK	1474	sp|P61604|CH10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3485.2	30.96533	2	1075.590647	1075.591361	K	V	71	81
PSM	DYDDMSPR	1475	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3123.4	21.64827	2	1077.348047	1077.347441	R	R	279	287
PSM	EVVKPVPITSPAVSK	1476	sp|Q96HC4|PDLI5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3426.2	29.45177	3	1629.876671	1629.874276	K	V	102	117
PSM	GVVFDVTSGK	1477	sp|Q9UMX5|NENF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3613.2	34.28679	2	1087.495447	1087.495092	K	E	70	80
PSM	DYDDMSPR	1478	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.2809.2	16.56188	2	1093.341847	1093.342356	R	R	279	287
PSM	VSGAGFSPSSK	1479	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3106.2	21.21482	2	1102.471847	1102.469606	R	M	1132	1143
PSM	VSMPDVELNLKSPK	1480	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3519.2	31.85005	3	1651.787471	1651.789226	K	V	3415	3429
PSM	HFKDEDEDEDVASPDGLGR	1481	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3295.3	26.04332	4	2209.886094	2209.880102	K	L	537	556
PSM	MSGFIYQGK	1482	sp|Q15052|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3601.2	33.97395	2	1109.463847	1109.461683	R	I	487	496
PSM	SADTLWGIQK	1483	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3618.2	34.41768	2	1117.575847	1117.576774	K	E	319	329
PSM	DLEGSDIDTR	1484	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3165.4	22.71487	2	1119.507447	1119.504397	R	R	373	383
PSM	GVEPSPSPIKPGDIK	1485	sp|Q92890|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3503.2	31.4321	3	1679.760971	1679.757271	K	R	241	256
PSM	YNLQEVVKSPKDPSQLNSK	1486	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3512.3	31.67043	4	2253.101694	2253.104229	K	Q	262	281
PSM	ILKSPEIQR	1487	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3138.2	22.00882	3	1162.611071	1162.611125	R	A	292	301
PSM	LALGDDSPALK	1488	sp|P17174|AATC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3563.2	32.98492	2	1178.558847	1178.558421	R	E	87	98
PSM	LPDLSPVENK	1489	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3612.3	34.26417	2	1190.556047	1190.558421	K	E	2101	2111
PSM	IDIIPNPQER	1490	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3609.3	34.18665	2	1193.640647	1193.640437	K	T	73	83
PSM	DPNSPLYSVK	1491	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3427.2	29.47792	2	1198.527847	1198.527120	R	S	82	92
PSM	VQEAESPVFK	1492	sp|Q08357|S20A2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3298.4	26.12497	2	1212.542847	1212.542771	K	E	263	273
PSM	NKSAFPFSDK	1493	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3395.4	28.64818	2	1219.529447	1219.527455	K	L	191	201
PSM	NLQTVNVDEN	1494	sp|P62899|RL31_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3358.4	27.6821	2	1224.503447	1224.502362	K	-	116	126
PSM	VIGSGCNLDSAR	1495	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3146.4	22.22287	2	1247.593047	1247.592835	R	F	158	170
PSM	TSSGDPPSPLVK	1496	sp|Q99618|CDCA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3241.3	24.66685	2	1263.576247	1263.574799	K	Q	80	92
PSM	LMIEMDGTENK	1497	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3505.2	31.4843	2	1279.580047	1279.578824	K	S	93	104
PSM	EVNVSPCPTQPCQLSK	1498	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3388.3	28.46215	3	1922.829071	1922.826750	K	G	36	52
PSM	FAAATGATPIAGR	1499	sp|P08865|RSSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	27.37	2	1282.605247	1282.607102	K	F	90	103
PSM	NLQYYDISAK	1500	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3599.5	33.93152	2	1293.566447	1293.564234	K	S	143	153
PSM	KQSKPVTTPEEIAQVATISANGDK	1501	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3592.3	33.74602	4	2591.294894	2591.284378	K	E	157	181
PSM	GTEAGQVGEPGIPTGEAGPSCSSASDK	1502	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=1.1.3467.4	30.52245	4	2625.097294	2625.090171	R	L	221	248
PSM	SLVESVSSSPNK	1503	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3226.4	24.28293	2	1312.592047	1312.591177	R	E	309	321
PSM	EITALAPSTMK	1504	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3654.2	35.32558	2	1320.543647	1320.543772	K	I	318	329
PSM	DKATQTPSCWAEEGAEK	1505	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3312.3	26.485	3	1986.801971	1986.803038	K	R	199	216
PSM	NSNPALNDNLEK	1506	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3169.6	22.8252	2	1327.637647	1327.636808	K	G	120	132
PSM	DVDDGSGSPHSPHQLSSK	1507	sp|Q9H4A3|WNK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.2969.3	18.11758	3	2008.760171	2008.756496	R	S	2022	2040
PSM	EITALAPSTMK	1508	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,9-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3406.4	28.9361	2	1336.541647	1336.538687	K	I	318	329
PSM	NNASTDYDLSDK	1509	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3119.4	21.54807	2	1341.570447	1341.568454	K	S	301	313
PSM	LDQPVSAPPSPR	1510	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3236.5	24.54662	2	1342.629647	1342.628231	K	D	235	247
PSM	LAIQGPEDSPSR	1511	sp|Q15773|MLF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3322.6	26.75388	2	1348.601447	1348.602411	R	Q	230	242
PSM	ELASPVSPELR	1512	sp|Q5T4S7|UBR4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3631.4	34.76543	2	1356.575847	1356.572764	K	Q	175	186
PSM	SSTPLHSPSPIR	1513	sp|O95817|BAG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3196.5	23.52058	2	1357.640647	1357.639131	R	V	283	295
PSM	TFDQLTPDESK	1514	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3323.4	26.77303	2	1359.562047	1359.559543	K	E	71	82
PSM	HSPNLSFEPNFCQDNPRSPTSSK	1515	sp|Q86TC9|MYPN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3607.4	34.13766	4	2725.168494	2725.159194	K	E	107	130
PSM	YQLDPTASISAK	1516	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	34.00027	2	1372.629847	1372.627563	K	V	236	248
PSM	SSDASTAQPPESQPLPASQTPASNQPK	1517	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3279.4	25.63025	4	2800.260894	2800.255263	K	R	97	124
PSM	ETSAATLSPGASSR	1518	sp|Q9Y6I9|TX264_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3065.2	20.21277	2	1413.610447	1413.613704	R	G	237	251
PSM	NSVTPLASPEPTK	1519	sp|Q16875|F263_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3310.4	26.43792	2	1419.663247	1419.664677	R	K	460	473
PSM	NSEPAGLETPEAK	1520	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3160.6	22.59193	2	1421.609647	1421.607556	R	V	890	903
PSM	RRSPSPYYSR	1521	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2947.2	17.8018	3	1427.576471	1427.574830	R	Y	258	268
PSM	AIADTGANVVVTGGK	1522	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3341.5	27.24397	2	1451.709447	1451.702125	K	V	282	297
PSM	GASQAGMTGYGMPR	1523	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3433.4	29.64143	2	1462.577047	1462.573436	R	Q	183	197
PSM	TDGEPGPQGWSPR	1524	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3402.5	28.83473	2	1462.599047	1462.587823	K	E	75	88
PSM	ETPAATEAPSSTPK	1525	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2977.2	18.26775	2	1465.633447	1465.633770	K	A	185	199
PSM	NSGSFPSPSISPR	1526	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3614.4	34.3197	2	1491.583447	1491.579641	R	-	1258	1271
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	1527	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3605.5	34.08875	4	3054.260094	3054.246274	K	N	1928	1956
PSM	LDPFADGGKTPDPK	1528	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3414.3	29.14162	3	1536.690371	1536.686140	R	M	133	147
PSM	YLLGDAPVSPSSQK	1529	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3640.3	34.98865	2	1540.723047	1540.717440	K	L	195	209
PSM	YRDVAECGPQQELDLNSPR	1530	sp|Q9BTE3|MCMBP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3559.4	32.88713	3	2326.012271	2326.004926	K	N	102	121
PSM	ESQRSGNVAELALK	1531	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3415.2	29.16435	3	1580.756471	1580.755951	K	A	658	672
PSM	APVPGTPDSLSSGSSR	1532	sp|Q9UJZ1|STML2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3284.5	25.76415	2	1593.705247	1593.703581	K	D	322	338
PSM	DGSLASNPYSGDLTK	1533	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3584.5	33.54472	2	1603.683247	1603.676698	R	F	850	865
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	1534	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3549.6	32.63432	3	2494.095071	2494.089063	R	L	815	839
PSM	LEAIEDDSVKETDSSSASAATPSK	1535	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3282.6	25.71528	3	2517.105671	2517.100719	K	K	215	239
PSM	TDSVIIADQTPTPTR	1536	sp|P17544|ATF7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3492.2	31.1455	3	1693.790471	1693.792396	R	F	42	57
PSM	VIGSGCNLDSARFR	1537	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3558.2	32.85452	3	1710.698471	1710.695022	R	Y	158	172
PSM	EADGSETPEPFAAEAK	1538	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3440.6	29.8304	2	1727.698447	1727.692742	R	F	234	250
PSM	FCSNSGRLSGPAELR	1539	sp|Q96PC5|MIA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3493.2	31.17157	3	1809.728171	1809.727050	R	S	1235	1250
PSM	GQEEISGALPVASPASSR	1540	sp|Q9UBK8|MTRR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3608.3	34.16062	3	1834.848371	1834.846223	R	T	159	177
PSM	QLVRGEPNVSYICSR	1541	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3482.2	30.88937	3	1856.861771	1856.860433	K	Y	269	284
PSM	ESSETPDQFMTADETR	1542	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3601.4	33.98062	3	1922.728571	1922.724118	K	N	716	732
PSM	NASTFEDVTQVSSAYQK	1543	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3653.2	35.30073	3	1953.832271	1953.835718	K	T	320	337
PSM	AAPRPAPVAQPPAAAPPSAVGSSAAAPR	1544	sp|Q9Y6H1|CHCH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3469.4	30.57183	4	2692.295294	2692.288766	R	Q	24	52
PSM	GPPASSPAPAPKFSPVTPK	1545	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3631.5	34.76877	3	2071.888571	2071.882228	R	F	254	273
PSM	NPQSILKPHSPTYNDEGL	1546	sp|Q9NVA1|UQCC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3603.5	34.03635	3	2088.954671	2088.951751	K	-	282	300
PSM	NTNAGAPPGTAYQSPLPLSR	1547	sp|Q02218|ODO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3653.3	35.30407	3	2090.976671	2090.978634	R	G	82	102
PSM	ELSVQDQPSLSPTSLQNSSSHTTTAK	1548	sp|O95628|CNOT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3621.5	34.50625	4	2822.298094	2822.297128	K	G	422	448
PSM	SQGDEAGGHGEDRPEPLSPK	1549	sp|Q9NZT2|OGFR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3053.4	19.94938	4	2141.908494	2141.901506	R	E	361	381
PSM	DTCYSPKPSVYLSTPSSASK	1550	sp|Q9Y5K6|CD2AP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3652.5	35.2857	3	2333.957771	2333.952813	K	A	538	558
PSM	SISSPSVSSETMDKPVDLSTRK	1551	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3332.3	27.00377	4	2446.132494	2446.129851	K	E	2802	2824
PSM	DAAASASTPAQAPTSDSPVAEDASR	1552	sp|P55789|ALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3291.6	25.95043	3	2452.044671	2452.039122	R	R	43	68
PSM	KVDEGAGDSAAVASGGAQTLALAGSPAPSGHPK	1553	sp|Q9NZT2|OGFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3504.5	31.46813	4	3053.453694	3053.445523	R	A	460	493
PSM	DLASPLIGRS	1554	sp|O95067|CCNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3814.2	39.45707	2	1107.530647	1107.532540	K	-	389	399
PSM	DVPPLSETEATPVPIK	1555	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3854.3	40.51128	3	1771.868471	1771.864499	K	D	575	591
PSM	ELIFQETAR	1556	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3709.2	36.75398	2	1185.542647	1185.543105	K	F	362	371
PSM	MYFPDVEFDIKSPK	1557	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4235.2	50.21597	3	1794.797471	1794.793976	K	F	5088	5102
PSM	SMSAPVIFDR	1558	sp|O60749|SNX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3905.2	41.82777	2	1201.520447	1201.520261	K	S	117	127
PSM	EAALPPVSPLK	1559	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3704.2	36.62373	2	1200.613447	1200.615542	R	A	1224	1235
PSM	TWTTPEVTSPPPSPR	1560	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3722.2	37.09452	3	1811.756771	1811.753248	R	T	125	140
PSM	FIVSPVPESR	1561	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3719.3	37.0194	2	1209.579047	1209.579490	R	L	1258	1268
PSM	EVSSLEGSPPPCLGQEEAVCTK	1562	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.3716.2	36.93747	4	2453.053294	2453.049158	K	I	1388	1410
PSM	GPLQSVQVFGR	1563	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3895.2	41.56735	2	1266.610447	1266.612187	K	K	5	16
PSM	VMTIPYQPMPASSPVICAGGQDR	1564	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4120.3	47.33905	4	2554.152894	2554.141953	R	C	178	201
PSM	VKADRDESSPYAAMLAAQDVAQR	1565	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3741.4	37.59513	4	2571.189694	2571.178867	K	C	62	85
PSM	GYFEYIEENK	1566	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3745.2	37.69322	2	1290.575447	1290.576833	R	Y	256	266
PSM	KQEGTPEGLYL	1567	sp|P62191|PRS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3727.3	37.22612	2	1313.592047	1313.590449	K	-	430	441
PSM	TVSLPLSSPNIK	1568	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3831.4	39.90965	2	1334.684447	1334.684684	K	L	1663	1675
PSM	NDPFTSDPFTK	1569	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4028.2	44.96035	2	1347.542247	1347.538413	K	N	684	695
PSM	SFSTALYGESDL	1570	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4470.3	54.85318	2	1368.559047	1368.548644	K	-	900	912
PSM	ILATPPQEDAPSVDIANIR	1571	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4097.2	46.73718	3	2099.038571	2099.030001	K	M	284	303
PSM	DMTSEQLDDILK	1572	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4061.3	45.82313	2	1406.665047	1406.659911	K	Y	672	684
PSM	GFPTIYFSPANK	1573	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4133.3	47.67653	2	1420.647247	1420.642819	R	K	449	461
PSM	AFLAELEQNSPK	1574	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3865.4	40.80448	2	1425.658247	1425.654112	K	I	4512	4524
PSM	SSTVGLVTLNDMK	1575	sp|Q14320|FA50A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3967.3	43.44705	2	1443.667647	1443.668047	K	A	62	75
PSM	ESDQTLAALLSPK	1576	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4192.2	49.1116	2	1451.693247	1451.690891	K	E	1687	1700
PSM	CLELFSELAEDK	1577	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4208.4	49.53733	2	1452.683247	1452.680647	K	E	412	424
PSM	EAEALLQSMGLTPESPIVPPPMSPSSK	1578	sp|Q13409-2|DC1I2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:35,15-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.4395.2	53.62515	4	2968.340494	2968.325196	R	S	59	86
PSM	TTPSVVAFTADGER	1579	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3754.4	37.92356	2	1529.679447	1529.676304	R	L	86	100
PSM	ILTFDQLALDSPK	1580	sp|Q07020|RL18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4333.2	52.35168	2	1539.769647	1539.758577	K	G	120	133
PSM	MLAESDESGDEESVSQTDKTELQNTLR	1581	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3731.6	37.34085	4	3091.330894	3091.317665	K	T	186	213
PSM	VSMPDVELNLKSPK	1582	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3835.3	40.01148	3	1635.794471	1635.794311	K	V	3415	3429
PSM	WADPQISESNFSPK	1583	sp|Q9BW91|NUDT9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3801.5	39.12763	2	1684.719047	1684.713418	R	F	110	124
PSM	NGYELSPTAAANFTR	1584	sp|P49721|PSB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3872.6	40.99477	2	1690.742247	1690.735216	R	R	71	86
PSM	ENSSSSSTPLSNGPLNGDVDYFGQQFDQISNR	1585	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4781.2	59.11115	4	3539.541694	3539.511431	K	T	322	354
PSM	ISLPGQMAGTPITPLK	1586	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4222.2	49.89602	3	1782.845171	1782.839226	K	D	213	229
PSM	GPPQSPVFEGVYNNSR	1587	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	36.78033	3	1826.797271	1826.798879	K	M	107	123
PSM	DMASPNWSILPEEER	1588	sp|Q15814|TBCC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4317.3	52.03027	3	1852.779671	1852.770281	R	N	327	342
PSM	CPSLDNLAVPESPGVGGGK	1589	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3835.5	40.01815	3	1932.869471	1932.865244	R	A	2249	2268
PSM	ALSSGGSITSPPLSPALPK	1590	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4075.2	46.17538	3	1938.916271	1938.910477	R	Y	17	36
PSM	YADLTEDQLPSCESLK	1591	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3811.2	39.37882	3	1947.823571	1947.817291	R	D	142	158
PSM	SFEAPATINSASLHPEK	1592	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3683.3	36.0799	3	1957.824371	1957.822390	K	E	219	236
PSM	LDNVPHTPSSYIETLPK	1593	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3889.3	41.41355	3	1989.948371	1989.944874	R	A	45	62
PSM	DNLTLWTSDQQDEEAGEGN	1594	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4027.3	44.93755	3	2120.883371	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	1595	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3999.4	44.24628	3	2192.883671	2192.873028	R	-	228	248
PSM	TQDPAKAPNTPDILEIEFK	1596	sp|P00966|ASSY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4093.2	46.63623	3	2206.067771	2206.055881	K	K	210	229
PSM	DLGLSESGEDVNAAILDESGKK	1597	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3904.3	41.80507	3	2246.094371	2246.091401	K	F	464	486
PSM	IADPEHDHTGFLTEYVATR	1598	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3891.3	41.46635	4	2250.996094	2250.994678	R	W	190	209
PSM	QHPQPYIFPDSPGGTSYER	1599	sp|Q9Y6M9|NDUB9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3703.5	36.6076	3	2254.976171	2254.968463	R	Y	75	94
PSM	DLLLTSSYLSDSGSTGEHTK	1600	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4148.2	48.05913	3	2269.952471	2269.939271	K	S	397	417
PSM	AAVPSGASTGIYEALELRDNDK	1601	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3902.3	41.75327	3	2276.136671	2276.128455	R	T	33	55
PSM	YGPGEPSPVSETVVTPEAAPEK	1602	sp|P32004|L1CAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3686.4	36.15937	3	2320.059071	2320.051190	K	N	695	717
PSM	TLEAEFNSPSPPTPEPGEGPR	1603	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3783.5	38.65759	3	2367.975671	2367.966154	K	K	525	546
PSM	AIVDALPPPCESACTVPTDVDK	1604	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3958.3	43.21023	3	2434.092071	2434.079730	R	W	261	283
PSM	HSVTAATPPPSPTSGESGDLLSNLLQSPSSAK	1605	sp|Q96QU8|XPO6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4498.4	55.37127	4	3292.518894	3292.490164	K	L	198	230
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	1606	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3686.5	36.1627	4	3562.513294	3562.491898	K	V	60	92
PSM	EQVANSAFVER	1607	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	26.41245	2	1328.575247	1328.576196	K	V	365	376
PSM	CIPALDSLTPANEDQK	1608	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.4822.2	59.45715	3	1833.7910	1833.7851	R	I	447	463
PSM	VAPEEHPVLLTEAPLNPK	1609	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3813.4	39.43748	3	2033.028071	2033.023459	R	A	96	114
PSM	GRPSSPRTPLYLQPDAYGSLDR	1610	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3848.4	40.35668	4	2605.179294	2605.172733	K	A	116	138
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	1611	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3186.5	23.2634	4	3566.449294	3565.448950	K	D	124	155
PSM	NGSLDSPGKQDTEEDEEEDEK	1612	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3065.4	20.2261	3	2430.912971	2429.923149	K	D	134	155
PSM	ESVPEFPLSPPK	1613	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4033.4	45.09677	2	1405.657847	1405.653049	K	K	30	42
PSM	QLSSGVSEIR	1614	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3834.2	39.98178	2	1137.5035	1137.5062	R	H	80	90
PSM	MTEWETAAPAVAETPDIK	1615	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.4150.3	48.10245	3	2096.9107	2096.9008	-	L	1	19
PSM	ADDLDFETGDAGASATFPMQCSALRK	1616	sp|P63241|IF5A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,8-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.4379.5	53.27645	3	2895.2302	2895.2092	M	N	2	28
PSM	TDGFAEAIHSPQVAGVPR	1617	sp|P12270|TPR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3718.3	36.9932	3	1930.896671	1930.893842	R	F	2146	2164
PSM	SGPDVETPSAIQICR	1618	sp|O00154-2|BACH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,7-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3920.2	42.22032	3	1750.7618	1750.7592	M	I	2	17
PSM	SETAPAAPAAPAPAEKTPVKK	1619	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=1.1.3190.6	23.36782	3	2153.0812	2153.0764	M	K	2	23
PSM	GGLGAPPLQSAR	1620	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3416.4	29.19722	2	1202.580447	1202.580887	R	S	88	100
PSM	NDSVIVADQTPTPTR	1621	sp|P15336|ATF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3379.3	28.22717	3	1772.752871	1772.738326	R	F	60	75
PSM	SPSGPVKSPPLSPVGTTPVK	1622	sp|Q9BVC5|ASHWN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3547.5	32.57863	3	2091.006671	2091.005440	K	L	182	202
PSM	EKQTEATNAIAEMKYPK	1623	sp|Q8NHM5|KDM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3025.3	19.33887	4	2046.937294	2046.933324	K	V	209	226
PSM	AQQNNVEHKVETFSGVYK	1624	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3431.6	29.59572	3	2236.960571	2236.955530	K	K	161	179
PSM	VAPDEHPILLTEAPLNPK	1625	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3821.4	39.64758	3	2033.028071	2033.023459	R	I	97	115
PSM	DISLSDYK	1626	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3456.2	30.23232	2	939.454247	939.454927	K	G	28	36
PSM	SAITPGGLR	1627	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	26.5071	2	950.457647	950.458647	R	L	417	426
PSM	FSVSPVVR	1628	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3617.2	34.39153	2	969.463647	969.468483	K	V	499	507
PSM	DRVHHEPQLSDK	1629	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.2864.2	16.95335	3	1459.716071	1459.716790	K	V	26	38
PSM	PCSEETPAISPSK	1630	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3137.2	21.98293	3	1481.6119	1481.6104	M	R	2	15
PSM	QFSQYIK	1631	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3667.2	35.65847	2	992.436047	992.436849	K	N	222	229
PSM	LVLVGDGGTGK	1632	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3331.2	26.97447	2	1014.568647	1014.570960	K	T	13	24
PSM	SGKPAELLK	1633	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3155.3	22.452	2	1021.519647	1021.520913	R	M	595	604
PSM	NWACFTGK	1634	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3570.2	33.16863	2	1062.400047	1062.399418	R	K	133	141
PSM	DGGAWGTEQR	1635	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3080.2	20.56753	2	1075.466247	1075.468286	K	E	65	75
PSM	AVILGPPGSGK	1636	sp|P27144|KAD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3442.2	29.86935	2	1074.546447	1074.547462	R	G	8	19
PSM	DLVAQAPLKPKTPR	1637	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3334.3	27.05565	3	1612.870871	1612.870193	K	G	523	537
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	1638	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	23-UNIMOD:21	ms_run[1]:scan=1.1.3398.3	28.72325	6	3290.608341	3290.597273	K	E	178	210
PSM	ITIADCGQLE	1639	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3626.3	34.63088	2	1118.526847	1118.527775	K	-	156	166
PSM	LESPTVSTLTPSSPGK	1640	sp|Q96C36|P5CR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3575.2	33.29912	3	1679.802071	1679.801898	K	L	292	308
PSM	AGDLLEDSPK	1641	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3311.2	26.45648	2	1123.480047	1123.479836	R	R	158	168
PSM	TVGHSVVSPQDTVQR	1642	sp|Q92871|PMM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3187.5	23.28638	3	1688.785871	1688.788314	R	C	235	250
PSM	LKGEATVSFDDPPSAK	1643	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3390.4	28.51748	3	1740.800171	1740.797147	K	A	333	349
PSM	SIYYITGESK	1644	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3423.2	29.37355	2	1159.575647	1159.576105	K	E	258	268
PSM	TPESSHEGLITDPHSPSRFR	1645	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3285.2	25.78032	4	2329.050894	2329.048839	R	V	719	739
PSM	LSSPVPAVCR	1646	sp|O75792|RNH2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3272.3	25.44477	2	1164.535047	1164.536246	R	K	16	26
PSM	DNLTSATLPR	1647	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3549.2	32.62098	2	1166.532047	1166.533268	K	N	302	312
PSM	IDIIPNPQER	1648	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3601.3	33.97728	2	1193.640647	1193.640437	K	T	73	83
PSM	ITLDNAYMEK	1649	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3499.2	31.32792	2	1196.574247	1196.574725	K	C	142	152
PSM	SNSPLPVPPSK	1650	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3292.2	25.963	2	1201.573247	1201.574405	R	A	301	312
PSM	NFEDVAFDEK	1651	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3620.3	34.47333	2	1212.527647	1212.529883	K	K	376	386
PSM	NLQYYDISAK	1652	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3485.3	30.96867	2	1213.597847	1213.597903	K	S	143	153
PSM	RLEEPEEPKVLTPEEQLADK	1653	sp|O75822|EIF3J_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3573.2	33.24698	4	2429.177294	2429.172702	K	L	98	118
PSM	GKYSDDTPLPTPSYK	1654	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3368.2	27.93623	3	1827.741071	1827.736929	R	Y	259	274
PSM	EITALAPSTMK	1655	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3522.4	31.93522	2	1240.577447	1240.577441	K	I	318	329
PSM	VLQSPATTVVR	1656	sp|Q8TCS8|PNPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3342.4	27.2668	2	1249.642447	1249.643153	K	T	751	762
PSM	ELEKPIQSKPQSPVIQAAAVSPK	1657	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3451.2	30.10433	4	2524.334894	2524.330206	R	F	207	230
PSM	AGGPATPLSPTR	1658	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3156.5	22.48462	2	1283.532247	1283.531234	R	L	29	41
PSM	TANVPQTVPMR	1659	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3363.4	27.81228	2	1292.593047	1292.594823	K	L	77	88
PSM	QSSLAEPVSPSK	1660	sp|O43572|AKA10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3163.3	22.65953	2	1308.597447	1308.596263	K	K	179	191
PSM	KPVTVSPTTPTSPTEGEAS	1661	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3259.2	25.1076	3	1964.902871	1964.897984	R	-	505	524
PSM	VNTPTTTVYR	1662	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3208.5	23.8318	2	1310.534047	1310.530900	K	C	244	254
PSM	TLNMTTSPEEK	1663	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3202.4	23.67255	2	1329.553847	1329.552349	K	R	326	337
PSM	SERPPTILMTEEPSSPK	1664	sp|Q5VZK9|CARL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=1.1.3428.2	29.504	3	1993.909871	1993.906775	K	G	1080	1097
PSM	YALYDATYETK	1665	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3507.3	31.53977	2	1336.618647	1336.618698	R	E	82	93
PSM	LDQPVSAPPSPR	1666	sp|Q16204|CCDC6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3228.3	24.33178	2	1342.630647	1342.628231	K	D	235	247
PSM	NGEVVHTPETSV	1667	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3250.4	24.889	2	1347.573647	1347.570776	K	-	454	466
PSM	GGSGSHNWGTVKDELTESPKYIQK	1668	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3522.5	31.93855	4	2697.251694	2697.243576	R	Q	217	241
PSM	NLYPSSSPYTR	1669	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3437.5	29.74922	2	1363.582647	1363.580947	K	N	275	286
PSM	DSTAPQRVPVASPSAHNISSSGGAPDR	1670	sp|Q7KZI7-2|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3280.4	25.65632	4	2740.2702	2740.2562	K	T	471	498
PSM	MDSTANEVEAVK	1671	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3194.3	23.46205	2	1372.558647	1372.558163	K	V	425	437
PSM	IVSAQSLAEDDVE	1672	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3669.3	35.71387	2	1374.654247	1374.651455	R	-	133	146
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	1673	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3392.3	28.5666	4	2758.220094	2758.211304	K	M	23	49
PSM	ISVYYNEATGGK	1674	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3382.5	28.31228	2	1380.602247	1380.596263	R	Y	47	59
PSM	TAAALAPASLTSAR	1675	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3548.4	32.60152	2	1379.681247	1379.680995	R	M	2357	2371
PSM	HGESAWNLENR	1676	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3362.4	27.78627	2	1391.563047	1391.561943	R	F	11	22
PSM	RSASPDDDLGSSNWEAADLGNEERK	1677	sp|O00193|SMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3601.6	33.98728	4	2798.191294	2798.178075	K	Q	14	39
PSM	AHSPMIAVGSDDSSPNAMAK	1678	sp|Q96EE3|SEH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3497.4	31.28258	3	2144.844071	2144.830923	R	V	177	197
PSM	VQISPDSGGLPER	1679	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3448.6	30.03948	2	1433.657647	1433.655175	K	S	178	191
PSM	HGFREGTTPKPK	1680	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2778.2	16.33593	3	1433.679371	1433.681664	R	R	76	88
PSM	ALDVSASDDEIAR	1681	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3505.4	31.49097	2	1440.623447	1440.613369	K	L	181	194
PSM	ALDVSASDDEIAR	1682	sp|P13798|ACPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3507.4	31.5431	2	1440.623447	1440.613369	K	L	181	194
PSM	SSGPYGGGGQYFAK	1683	sp|Q32P51|RA1L2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3456.5	30.24232	2	1454.589447	1454.586761	R	P	285	299
PSM	EAQERLTGDAFR	1684	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3281.3	25.67915	3	1471.647071	1471.645672	K	K	153	165
PSM	SKPIPIMPASPQK	1685	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3440.5	29.82707	2	1472.748647	1472.746238	K	G	607	620
PSM	MPPRTPAEASSTGQTGPQSAL	1686	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3514.4	31.72587	3	2242.938971	2242.933080	K	-	238	259
PSM	EGHLSPDIVAEQK	1687	sp|P15559|NQO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3362.5	27.7896	2	1501.684447	1501.681389	K	K	78	91
PSM	NWMVGGEGGAGGRSP	1688	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3573.3	33.25032	2	1510.605647	1510.602427	K	-	79	94
PSM	NWMVGGEGGAGGRSP	1689	sp|Q6UW78|UQCC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3565.5	33.04743	2	1510.605647	1510.602427	K	-	79	94
PSM	NHCGIASAASYPTV	1690	sp|P07711|CATL1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3627.6	34.66702	2	1526.626247	1526.622494	R	-	320	334
PSM	SLPTTVPESPNYR	1691	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3510.5	31.62463	2	1539.698247	1539.697039	R	N	766	779
PSM	SVTEQGAELSNEER	1692	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3140.2	22.06033	3	1547.707271	1547.706344	K	N	28	42
PSM	NDAPTPGTSTTPGLR	1693	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3227.5	24.31245	2	1563.696047	1563.693017	R	S	324	339
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	1694	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3509.5	31.59847	4	3223.243694	3223.230486	K	-	122	148
PSM	TAADVVSPGANSVDSR	1695	sp|Q01804|OTUD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3230.5	24.39053	2	1624.713047	1624.709395	K	V	1000	1016
PSM	PAEKPAETPVATSPTATDSTSGDSSR	1696	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3077.2	20.49623	5	2719.136118	2719.126296	K	S	148	174
PSM	ESEPESPMDVDNSK	1697	sp|Q86W56|PARG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3164.6	22.69557	2	1642.610847	1642.606963	K	N	297	311
PSM	ESVPEFPLSPPKKK	1698	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3553.2	32.7251	3	1661.841671	1661.842975	K	D	30	44
PSM	DSSQSPSQVDQFCK	1699	sp|Q13637|RAB32_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3324.6	26.80543	2	1691.653247	1691.649832	K	E	150	164
PSM	NNESQWKDSPLATR	1700	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3277.3	25.57475	3	1724.757071	1724.751929	K	H	795	809
PSM	VVSISSEHLEPITPTK	1701	sp|O00267|SPT5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3599.3	33.92485	3	1815.902171	1815.901947	K	N	1022	1038
PSM	RELHGQNPVVTPCNK	1702	sp|Q16630|CPSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3012.3	19.04997	3	1827.844871	1827.845118	K	Q	147	162
PSM	DETVSDCSPHIANIGR	1703	sp|P47756|CAPZB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3455.4	30.21347	3	1849.774271	1849.766593	K	L	200	216
PSM	SGRSPTGNTPPVIDSVSEK	1704	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3367.4	27.91687	3	2006.931671	2006.931015	R	A	2671	2690
PSM	SAESPTSPVTSETGSTFKK	1705	sp|Q02952|AKA12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3295.5	26.04998	3	2019.904271	2019.903797	K	F	280	299
PSM	AIGSASEGAQSSLQEVYHK	1706	sp|P28066|PSA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3569.4	33.1492	3	2040.918671	2040.915365	R	S	169	188
PSM	GPPASSPAPAPKFSPVTPK	1707	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3644.2	35.07838	3	2071.888571	2071.882228	R	F	254	273
PSM	YPLFEGQETGKKETIEE	1708	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3624.4	34.58165	3	2076.933671	2076.929284	R	-	723	740
PSM	AKPSPAPPSTTTAPDASGPQK	1709	sp|P40855|PEX19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3064.4	20.19368	3	2084.981471	2084.977965	K	R	32	53
PSM	DSESSNDDTSFPSTPEGIK	1710	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3555.4	32.78337	3	2091.819071	2091.815770	K	D	437	456
PSM	NVASGGGGVGDGVQEPTTGNWR	1711	sp|O00429|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3524.3	31.9841	3	2193.945371	2193.944040	K	G	569	591
PSM	HFKDEDEDEDVASPDGLGR	1712	sp|O95365|ZBT7A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3292.5	25.973	3	2209.887671	2209.880102	K	L	537	556
PSM	MPPRTPAEASSTGQTGPQSAL	1713	sp|Q9Y676|RT18B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3506.3	31.51377	3	2242.938971	2242.933080	K	-	238	259
PSM	DTYSDRSGSSSPDSEITELK	1714	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3529.6	32.1244	3	2252.938571	2252.932197	R	F	565	585
PSM	QQTQQVQSPVDSATMSPVER	1715	sp|Q9UJF2|NGAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3500.4	31.3607	3	2295.025571	2295.020241	R	T	939	959
PSM	KKPRPPPALGPEETSASAGLPK	1716	sp|Q01105|SET_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3302.6	26.23645	3	2307.2019706434903	2307.1987970448195	K	K	14	36
PSM	IVRGDQPAASGDSDDDEPPPLPR	1717	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3413.6	29.12538	3	2483.106671	2483.096577	K	L	45	68
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	1718	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	20-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3183.5	23.18323	4	2858.114894	2858.104652	K	M	639	664
PSM	APTTVEDRVGDSTPVSEKPVSAAVDANASESP	1719	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3586.6	33.59948	4	3262.497294	3262.487842	K	-	421	453
PSM	DTPGHGSGWAETPRTDRGGDSIGETPTPGASK	1720	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.3353.4	27.55155	5	3353.408618	3353.398723	R	R	302	334
PSM	IGPLGLSPK	1721	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3737.2	37.48397	2	960.501847	960.504534	K	K	32	41
PSM	WLCPLSGK	1722	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3750.2	37.81672	2	1039.455247	1039.456204	K	K	713	721
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1723	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3855.2	40.53428	5	2833.353618	2833.352672	K	S	362	389
PSM	GTLSGWILSK	1724	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4238.2	50.29395	2	1140.559847	1140.558027	R	A	78	88
PSM	GRTVIIEQSWGSPK	1725	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3686.2	36.1527	3	1716.753071	1716.763753	K	V	59	73
PSM	GGPGSAVSPYPTFNPSSDVAALHK	1726	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4066.3	45.95329	4	2515.0888	2515.0817	K	A	30	54
PSM	DLRSPLIATPTFVADK	1727	sp|P49116|NR2C2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4157.4	48.2718	3	1902.895271	1902.889348	K	D	216	232
PSM	NLEELNISSAQ	1728	sp|Q9Y2R5|RT17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3872.5	40.99143	2	1296.562047	1296.559877	K	-	120	131
PSM	GRPSSPRTPLYLQPDAYGSLDR	1729	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3850.2	40.40278	4	2605.179294	2605.172733	K	A	116	138
PSM	TQTPPVSPAPQPTEERLPSSPVYEDAASFK	1730	sp|Q14247|SRC8_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3995.4	44.14183	5	3385.527618	3385.515651	K	A	399	429
PSM	TVQGPPTSDDIFEREYK	1731	sp|P04181|OAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3702.4	36.57823	3	2060.914571	2060.909217	K	Y	33	50
PSM	SIPLECPLSSPK	1732	sp|Q92667|AKAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3742.4	37.62138	2	1406.654847	1406.651669	K	G	142	154
PSM	TVIIEQSWGSPK	1733	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3756.3	37.97233	2	1423.676447	1423.674847	R	V	61	73
PSM	QREEYQPATPGLGMFVEVKDPEDK	1734	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=1.1.3806.3	39.25112	4	2858.295694	2858.283392	K	V	72	96
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1735	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4017.3	44.68322	4	2881.112094	2881.094982	K	T	701	725
PSM	YESQEPLAGQESPLPLATR	1736	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3856.3	40.56382	3	2165.010371	2165.004180	R	E	590	609
PSM	AELSYRGPVSGTEPEPVYSMEAADYR	1737	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3968.3	43.473	4	2953.302894	2953.284120	K	E	429	455
PSM	IMNTFSVVPSPK	1738	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4068.2	46.00165	2	1478.634647	1478.628171	R	V	163	175
PSM	DGDSYRSPWSNKYDPPLEDGAMPSAR	1739	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3853.5	40.49166	4	2990.265294	2990.254217	R	L	67	93
PSM	LGGSAVISLEGKPL	1740	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4334.2	52.37433	3	1499.705171	1499.703779	K	-	153	167
PSM	HSDLFSSSSPWDK	1741	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3700.6	36.53267	2	1571.639247	1571.629354	K	G	779	792
PSM	GALQNIIPASTGAAK	1742	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3912.5	42.02088	2	1570.719247	1570.715740	R	A	201	216
PSM	GALQNIIPASTGAAK	1743	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3905.4	41.83443	2	1570.719247	1570.715740	R	A	201	216
PSM	ISMQDVDLSLGSPK	1744	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3709.5	36.76398	2	1584.717447	1584.710641	K	L	500	514
PSM	DWALSSAAAVMEER	1745	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4343.2	52.60545	3	1614.675971	1614.674924	K	K	547	561
PSM	IFVGGLSPDTPEEK	1746	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3958.4	43.21357	2	1647.689247	1647.683437	K	I	184	198
PSM	DGDFENPVPYTGAVK	1747	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3788.2	38.77823	3	1687.714271	1687.713083	R	V	123	138
PSM	QSVDGKAPLATGEDDDDEVPDLVENFDEASK	1748	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4288.4	51.43447	4	3384.467294	3384.440617	K	N	172	203
PSM	GDVVNQDDLYQALASGK	1749	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.4005.2	44.39175	3	1871.839271	1871.830239	R	I	246	263
PSM	DLDLLASVPSPSSSGSRK	1750	sp|Q8WU79|SMAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3954.3	43.10565	3	1894.906871	1894.903738	K	V	210	228
PSM	EGSVLDILKSPGFASPK	1751	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4500.2	55.42311	3	1903.883771	1903.873363	K	I	605	622
PSM	KISLPGQMAGTPITPLK	1752	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3965.2	43.39091	3	1910.928071	1910.934189	K	D	212	229
PSM	EVDGLLTSEPMGSPVSSK	1753	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3898.3	41.64905	3	1911.855971	1911.853676	K	T	582	600
PSM	IETVNESWNALATPSDK	1754	sp|P21399|ACOC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3883.3	41.25768	3	1953.880871	1953.872103	K	L	616	633
PSM	DSSTSPGDYVLSVSENSR	1755	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3967.2	43.44372	3	1978.819271	1978.815711	R	V	39	57
PSM	EPGGRSPAFVQLAPLSSK	1756	sp|P51610|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3932.2	42.53367	3	1999.921871	1999.916959	R	V	1200	1218
PSM	SSSPAPADIAQTVQEDLR	1757	sp|Q13283|G3BP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4001.2	44.29188	3	2043.870371	2043.855147	K	T	230	248
PSM	VLDSGAPIKIPVGPETLGR	1758	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.4289.2	51.447	3	2078.029871	2078.021425	K	I	125	144
PSM	TVDSQGPTPVCTPTFLER	1759	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3908.4	41.91273	3	2083.931771	2083.928573	K	R	227	245
PSM	SATLSSTESTASEMQEEMK	1760	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3779.3	38.55158	3	2125.849571	2125.843247	K	G	640	659
PSM	DCCVEPGTELSPTLPHQL	1761	sp|Q14012|KCC1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4,3-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.4104.4	46.92615	3	2131.906871	2131.895558	R	-	353	371
PSM	NDSPTQIPVSSDVCRLTPA	1762	sp|Q8TC07|TBC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3800.3	39.09537	3	2135.956871	2135.955850	R	-	673	692
PSM	TEFSPAAFEQEQLGSPQVR	1763	sp|Q92585|MAML1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.4092.5	46.61675	3	2199.995171	2199.983779	K	A	300	319
PSM	DLGTQNHTSELILSSPPGQK	1764	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3691.6	36.29713	3	2201.044571	2201.036543	K	V	385	405
PSM	SIDSNSEIVSFGSPCSINSR	1765	sp|P42702|LIFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3938.4	42.6968	3	2234.959271	2234.951493	R	Q	1047	1067
PSM	QPLEQNQTISPLSTYEESK	1766	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3824.5	39.72928	3	2271.041171	2271.030789	K	V	403	422
PSM	NVVVVDGVRTPFLLSGTSYK	1767	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4299.3	51.6651	3	2310.119471	2310.106217	R	D	53	73
PSM	IADPEHDHTGFLTEYVATR	1768	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3735.4	37.43852	3	2330.968571	2330.961009	R	W	190	209
PSM	ADLLLSTQPGREEGSPLELER	1769	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3963.5	43.34773	3	2389.164971	2389.152635	K	L	593	614
PSM	NALFPEVFSPTPDENSDQNSR	1770	sp|Q8IVT2|MISP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4397.4	53.68027	3	2443.047371	2443.032914	R	S	567	588
PSM	DYEIESQNPLASPTNTLLGSAK	1771	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4549.2	56.13845	3	2507.1072	2507.0862	K	E	618	640
PSM	KAPLNIPGTPVLEDFPQNDDEK	1772	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4120.5	47.34572	3	2516.199971	2516.183601	R	E	41	63
PSM	TMIISPERLDPFADGGKTPDPK	1773	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4310.2	51.88077	4	2544.148494	2544.137259	R	M	125	147
PSM	ETYTDDLPPPPVPPPAIKSPTAQSK	1774	sp|Q9Y6N7|ROBO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3892.2	41.48917	4	2725.330494	2725.325180	R	T	1474	1499
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	1775	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4018.6	44.7176	3	2881.118471	2881.094982	K	T	701	725
PSM	VTNGAFTGEISPGMIK	1776	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4039.3	45.2485	2	1701.777247	1700.784474	K	D	107	123
PSM	IFRDGEEAGAYDGPRTADGIVSHLK	1777	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3682.5	36.0608	4	2753.282094	2753.281024	K	K	105	130
PSM	QAGPASVPLRTEEEFK	1778	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3616.2	34.36547	3	1917.828371	1917.827476	K	K	131	147
PSM	YPIEHGIITNWDDMEK	1779	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3832.3	39.9327	3	1959.907871	1959.903664	K	I	71	87
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1780	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3085.5	20.70577	4	3025.352094	3024.356099	K	S	145	174
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	1781	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4188.4	49.01397	4	3523.482494	3522.472617	K	F	604	634
PSM	AEPQPPSGGLTDEAALSCCSDADPSTK	1782	sp|Q04760|LGUL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,7-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.3951.5	43.0339	3	2882.1802	2882.1622	M	D	2	29
PSM	QFSQYIK	1783	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4399.2	53.73845	2	975.4093	975.4098	K	N	222	229
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	1784	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3511.3	31.64433	4	2660.150894	2660.147901	R	-	621	645
PSM	MVPSSPAVEK	1785	sp|P41440|S19A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=1.1.3567.2	33.08978	2	1165.5093	1165.5085	-	Q	1	11
PSM	AENVVEPGPPSAK	1786	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3502.4	31.4126	2	1415.6338	1415.6329	M	R	2	15
PSM	QAGGFLGPPPPSGK	1787	sp|Q9UM00|TMCO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=1.1.3918.2	42.16777	2	1371.6249	1371.6219	K	F	224	238
PSM	ATSEEDVSIKSPICEK	1788	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3306.4	26.33458	3	1871.821271	1871.822376	K	Q	1606	1622
PSM	LISPYK	1789	sp|O14929|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3288.2	25.85877	2	799.384447	799.388108	R	K	359	365
PSM	LILDSAR	1790	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3398.2	28.71992	2	866.425047	866.426284	K	A	544	551
PSM	GLTSVINQK	1791	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3295.2	26.03998	2	958.543447	958.544745	R	L	300	309
PSM	SGPKPFSAPKPQTSPSPK	1792	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3148.2	22.26792	4	1916.940494	1916.939729	R	R	295	313
PSM	DVNVNFEK	1793	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3303.2	26.24957	2	963.464247	963.466161	K	S	26	34
PSM	FANLTPSR	1794	sp|O15027|SC16A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3316.2	26.58492	2	984.441647	984.442997	K	T	2050	2058
PSM	DFSPEALK	1795	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3576.2	33.32528	2	985.413047	985.415779	K	K	181	189
PSM	VPLSAYER	1796	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3446.2	29.97395	2	1013.457247	1013.458313	R	V	2385	2393
PSM	DGLTDVYNK	1797	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3320.2	26.68908	2	1023.486647	1023.487290	K	I	182	191
PSM	GLAGPPASPGK	1798	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3084.2	20.6732	2	1030.481047	1030.484862	K	A	538	549
PSM	GLTSVINQK	1799	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3612.2	34.26083	2	1038.508447	1038.511076	R	L	300	309
PSM	DATLTALDR	1800	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3564.2	33.01117	2	1054.471447	1054.469606	K	G	391	400
PSM	MLTFNPNK	1801	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3399.2	28.74598	2	1059.446447	1059.446034	R	R	310	318
PSM	GHTDTEGRPPSPPPTSTPEK	1802	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3022.2	19.25287	4	2166.959294	2166.958293	R	C	353	373
PSM	GFVEIQTPK	1803	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3577.3	33.35482	2	1097.514047	1097.515827	K	I	214	223
PSM	TAGNSEFLGK	1804	sp|P78344|IF4G2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3288.3	25.8621	2	1102.469447	1102.469606	K	T	32	42
PSM	ASTLQLGSPR	1805	sp|Q7L8L6|FAKD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3310.2	26.43125	2	1108.525447	1108.527789	K	A	88	98
PSM	DNVVCLSPK	1806	sp|Q96D46|NMD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3391.3	28.54043	2	1110.478247	1110.478062	K	L	252	261
PSM	SPGAPGPLTLK	1807	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3556.4	32.80905	2	1116.557647	1116.558027	R	E	344	355
PSM	GVEPSPSPIKPGDIK	1808	sp|Q92890|UFD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	31.22372	3	1679.760971	1679.757271	K	R	241	256
PSM	NPNTSEPQHLLVMK	1809	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3561.3	32.9362	3	1686.778571	1686.780058	K	G	495	509
PSM	GHLSRPEAQSLSPYTTSANR	1810	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3298.3	26.12163	4	2251.040094	2251.038274	R	A	424	444
PSM	SETSWESPK	1811	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3147.4	22.24865	2	1129.434847	1129.432886	K	Q	562	571
PSM	IAVAAQNCYK	1812	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3116.4	21.47407	2	1136.567047	1136.564829	K	V	97	107
PSM	TLNAETPKSSPLPAK	1813	sp|Q7L2J0|MEPCE_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3201.2	23.64332	3	1712.781071	1712.778735	R	G	208	223
PSM	LAIQGPEDSPSRQSR	1814	sp|Q15773|MLF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3205.2	23.74397	3	1719.795071	1719.794128	R	R	230	245
PSM	RQAQQERDELADEIANSSGK	1815	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3284.3	25.75748	4	2324.038094	2324.039397	K	G	1697	1717
PSM	TLTPDQWAR	1816	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	33.74268	2	1166.512047	1166.512139	K	E	74	83
PSM	TEAQDLCRASPEPPGPESSSR	1817	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3223.2	24.19982	4	2349.998094	2349.989669	R	W	663	684
PSM	ADTSQEICSPRLPISASHSSK	1818	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3444.2	29.92175	4	2350.067694	2350.062440	K	T	1020	1041
PSM	RLSTHSPFR	1819	sp|P11171|41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3064.2	20.18702	3	1179.551471	1179.555007	K	T	707	716
PSM	WNSVSPASAGK	1820	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3185.5	23.23447	2	1182.506847	1182.507054	K	R	304	315
PSM	LLEELEEGQK	1821	sp|Q13404|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3488.2	31.0418	2	1186.610647	1186.608134	R	G	17	27
PSM	EHYPVSSPSSPSPPAQPGGVSR	1822	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3357.3	27.65275	4	2378.998494	2378.993372	K	N	2036	2058
PSM	SNSPLPVPPSK	1823	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3282.3	25.70528	2	1201.573247	1201.574405	R	A	301	312
PSM	IPGSPPESMGR	1824	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3275.5	25.52938	2	1206.516247	1206.510425	K	G	58	69
PSM	ELAEDDSILK	1825	sp|P56385|ATP5I_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3564.4	33.01783	2	1211.532847	1211.532265	R	-	60	70
PSM	AIPGDQHPESPVHTEPMGIQGR	1826	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3376.4	28.15202	4	2432.101694	2432.094409	R	G	784	806
PSM	NTCPGDRSAITPGGLR	1827	sp|P34897|GLYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3321.3	26.71802	3	1830.750071	1830.748514	K	L	410	426
PSM	EAPEGWQTPK	1828	sp|Q9NWT8|AKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3266.3	25.28897	2	1221.507847	1221.506719	K	I	184	194
PSM	TLTPISAAYAR	1829	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3665.3	35.61015	2	1242.600647	1242.600954	K	A	295	306
PSM	SFLSEPSSPGR	1830	sp|Q69YN4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3472.3	30.6439	2	1242.526047	1242.528183	R	T	1572	1583
PSM	SSSPTQYGLTK	1831	sp|Q9NYL2|M3K20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3208.4	23.82847	2	1247.547047	1247.543499	R	N	635	646
PSM	ALVSGKPAESSAVAATEK	1832	sp|O95182|NDUA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3376.5	28.15535	3	1874.849471	1874.842791	K	K	75	93
PSM	WNSVSPASAGK	1833	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3244.2	24.73707	2	1262.473047	1262.473385	K	R	304	315
PSM	ALGSAQYEDPR	1834	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3223.4	24.20648	2	1285.538247	1285.533997	K	N	1694	1705
PSM	EGNTTEDDFPSSPGNGNK	1835	sp|Q15007|FL2D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3193.6	23.44592	3	1944.741071	1944.737460	R	S	295	313
PSM	GCLLYGPPGTGK	1836	sp|P62333|PRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3568.5	33.12643	2	1298.575447	1298.573025	K	T	169	181
PSM	ARPESERERDGEQSPNVSLMQR	1837	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3174.6	22.95448	4	2650.1972941913205	2650.1918908244097	R	M	323	345
PSM	VKLESPTVSTLTPSSPGK	1838	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3574.4	33.2798	3	1986.927671	1986.931606	R	L	290	308
PSM	EQVANSAFVER	1839	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3317.4	26.61802	2	1328.575247	1328.576196	K	V	365	376
PSM	ASPLTHSPPDEL	1840	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	32.81238	2	1342.579247	1342.580613	K	-	267	279
PSM	RRSPSPYYSR	1841	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2938.2	17.72767	3	1347.601871	1347.608499	R	Y	258	268
PSM	DGFPSGTPALNAK	1842	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3540.2	32.38877	2	1353.596647	1353.596597	K	G	148	161
PSM	DGFPSGTPALNAK	1843	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3532.3	32.19228	2	1353.596647	1353.596597	K	G	148	161
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1844	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3548.3	32.59818	4	2717.314094	2717.307830	R	R	31	56
PSM	RSRLTPVSPESSSTEEK	1845	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3086.4	20.7282	3	2048.885171	2048.881696	K	S	265	282
PSM	ELISNSSDALDK	1846	sp|Q14568|HS902_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3520.4	31.88305	2	1370.604047	1370.596657	R	I	47	59
PSM	TNLSGRQSPSFK	1847	sp|Q6IN85|P4R3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3098.2	21.03167	3	1400.644571	1400.644944	K	L	734	746
PSM	NVGFESDTGGAFK	1848	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3593.4	33.7748	2	1407.579847	1407.570776	R	G	47	60
PSM	NKQDDDLNCEPLSPHNITPEPVSK	1849	sp|Q6VMQ6|MCAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3545.2	32.5165	4	2826.260494	2826.253154	K	L	101	125
PSM	TADSVSPLEPPTK	1850	sp|Q9UMZ2|SYNRG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3386.4	28.4135	2	1420.6444470956603	1420.64869177624	K	D	575	588
PSM	TVEVAEGEAVRTPQSVTAK	1851	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3394.4	28.62215	3	2130.966671	2130.959947	R	Q	132	151
PSM	TPQAPASANLVGPRSAHATAPVNIAGSR	1852	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3598.4	33.90203	4	2870.376494	2870.358971	R	T	2329	2357
PSM	KETPPPLVPPAAR	1853	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3416.2	29.19055	3	1451.752271	1451.753766	R	E	3	16
PSM	AQAAAPASVPAQAPK	1854	sp|P47914|RL29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3162.5	22.64035	2	1456.708647	1456.707544	K	R	135	150
PSM	STGGAPTFNVTVTK	1855	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3634.4	34.84278	2	1458.678047	1458.675576	K	T	92	106
PSM	APLKPYPVSPSDK	1856	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3279.2	25.62358	3	1477.722671	1477.721798	K	V	1039	1052
PSM	QISSSSTGCLSSPNATVQSPK	1857	sp|Q9Y6Y0|NS1BP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3326.6	26.85765	3	2214.986471	2214.982793	K	H	266	287
PSM	TTPSYVAFTDTER	1858	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3566.4	33.07022	2	1486.695847	1486.693989	R	L	37	50
PSM	VCVPSSASALGTASK	1859	sp|P22681|CBL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3447.6	30.01332	2	1513.686247	1513.684760	R	A	507	522
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	1860	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3572.6	33.2343	4	3044.160094	3044.151982	K	L	595	622
PSM	DELTESPKYIQK	1861	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	25.83265	3	1529.701871	1529.701456	K	Q	229	241
PSM	MLAESDESGDEESVSQTDKTELQNTLR	1862	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3648.4	35.1831	4	3107.318094	3107.312580	K	T	186	213
PSM	VPSPLEGSEGDGDTD	1863	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3502.5	31.41593	2	1553.579247	1553.577043	K	-	413	428
PSM	FLMECRNSPVTK	1864	sp|Q13541|4EBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,5-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3142.5	22.12213	3	1576.681271	1576.677901	K	T	58	70
PSM	AGEPNSPDAEEANSPDVTAGCDPAGVHPPR	1865	sp|Q08J23|NSUN2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,14-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.3514.5	31.7292	4	3173.254494	3173.243468	R	-	738	768
PSM	AGMTSSPDATTGQTFG	1866	sp|Q9UQR1|ZN148_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3553.6	32.73843	2	1607.620247	1607.617468	R	-	779	795
PSM	DLVAQAPLKPKTPR	1867	sp|O94776|MTA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3342.2	27.26013	3	1612.870871	1612.870193	K	G	523	537
PSM	VLGTSPEAIDSAENR	1868	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3513.6	31.70633	2	1637.730247	1637.729796	R	F	1034	1049
PSM	ELTSTCSPIISKPK	1869	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3308.2	26.38	3	1639.787171	1639.789226	K	P	774	788
PSM	IIAEGANGPTTPEADK	1870	sp|P00367|DHE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3171.2	22.86353	3	1662.750071	1662.750197	K	I	400	416
PSM	DVYLSPRDDGYSTK	1871	sp|P38159|RBMX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3390.3	28.51415	3	1694.718071	1694.718897	R	D	204	218
PSM	RIITYNEAMDSPDQ	1872	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3520.6	31.88972	2	1731.725047	1731.717517	K	-	682	696
PSM	MDATANDVPSPYEVR	1873	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3457.6	30.27128	2	1759.717047	1759.712432	K	G	434	449
PSM	EGTCQRGDQCCYSHSPPTPR	1874	sp|Q9NXH9|TRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,10-UNIMOD:4,11-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.2990.2	18.54153	4	2471.945694	2471.940628	K	V	611	631
PSM	IRYESLTDPSKLDSGK	1875	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3488.3	31.04513	3	1967.866571	1967.864255	K	E	54	70
PSM	GSLSNAGDPEIVKSPSDPK	1876	sp|O43847|NRDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3314.4	26.53957	3	1976.910671	1976.909217	R	Q	93	112
PSM	GPPASSPAPAPKFSPVTPK	1877	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3549.4	32.62765	3	1991.916671	1991.915897	R	F	254	273
PSM	SGPKPFSAPKPQTSPSPK	1878	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3190.2	23.35448	4	1996.904894	1996.906060	R	R	295	313
PSM	SLDSDESEDEEDDYQQK	1879	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3154.5	22.43258	3	2110.740971	2110.737580	K	R	57	74
PSM	QNEPFVATQSSACVDGPANH	1880	sp|O00180|KCNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3445.4	29.9545	3	2127.932171	2127.927981	K	-	317	337
PSM	CGNTIPDDDNQVVSLSPGSR	1881	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3661.3	35.50563	3	2209.934471	2209.931092	R	Y	643	663
PSM	AQTPPGPSLSGSKSPCPQEK	1882	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3199.3	23.59152	4	2211.930494	2211.927266	K	S	1001	1021
PSM	AQTPPGPSLSGSKSPCPQEK	1883	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,14-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3202.6	23.67922	3	2211.931871	2211.927266	K	S	1001	1021
PSM	TVGTPIASVPGSTNTGTVPGSEK	1884	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3582.6	33.49597	3	2236.067171	2236.062423	R	D	270	293
PSM	TEAQDLCRASPEPPGPESSSR	1885	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3220.3	24.12802	3	2349.995771	2349.989669	R	W	663	684
PSM	QIDSSPVGGETDETTVSQNYR	1886	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3438.5	29.77515	3	2361.997871	2361.996194	K	G	565	586
PSM	EVEDKESEGEEEDEDEDLSK	1887	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3098.6	21.045	3	2418.903071	2418.895931	K	Y	147	167
PSM	SQPEPSPVLSQLSQR	1888	sp|Q5T6F2|UBAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3708.2	36.72783	3	1731.817271	1731.819280	K	Q	427	442
PSM	STFVLDEFK	1889	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4141.2	47.88233	2	1164.512647	1164.510408	K	R	286	295
PSM	STFVLDEFK	1890	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4150.2	48.09912	2	1164.512647	1164.510408	K	R	286	295
PSM	AAALAAAVAQDPAASGAPSS	1891	sp|Q8TAE8|G45IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3736.2	37.45785	3	1775.811971	1775.809109	R	-	203	223
PSM	GTPLISPLIK	1892	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.4244.3	50.43482	2	1197.583847	1197.581144	R	W	826	836
PSM	GQEDSLASAVDAATEQK	1893	sp|Q8WUD4|CCD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3906.3	41.8571	3	1798.763771	1798.762219	K	T	145	162
PSM	EAALPPVSPLK	1894	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3712.2	36.83285	2	1200.613447	1200.615542	R	A	1224	1235
PSM	DGFVTVDELK	1895	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3921.2	42.24643	2	1201.527847	1201.526786	K	D	85	95
PSM	ADSEPESPLNASYVYK	1896	sp|Q5T1V6|DDX59_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3674.3	35.8444	3	1848.779471	1848.781891	K	E	154	170
PSM	LDIDSPPITAR	1897	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3725.3	37.17522	2	1276.607847	1276.606433	R	N	33	44
PSM	ALSSGGSITSPPLSPALPK	1898	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4084.2	46.40387	3	1938.916271	1938.910477	R	Y	17	36
PSM	NPLPPILGSPTK	1899	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3928.3	42.43265	2	1312.681247	1312.679204	R	A	615	627
PSM	DFAPLTPNIVR	1900	sp|Q08AM6|VAC14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4079.3	46.27828	2	1321.649447	1321.643153	K	A	6	17
PSM	GDNITLLQSVSN	1901	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4030.4	45.01892	2	1339.608047	1339.602076	K	-	81	93
PSM	QASPLISPLLNDQACPR	1902	sp|Q9Y4F1|FARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.4209.3	49.56013	3	2038.898471	2038.894844	K	T	508	525
PSM	FLQCAEQVQPPRSPATVEAQPLPAS	1903	sp|Q9BSY4|CHCH5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3885.5	41.31562	4	2800.333294	2800.325532	R	-	86	111
PSM	EQFLDGDGWTSR	1904	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3741.5	37.59846	2	1409.626847	1409.621158	K	W	25	37
PSM	DLLLTSSYLSDSGSTGEHTK	1905	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3838.4	40.09338	3	2110.013771	2110.006609	K	S	397	417
PSM	IMNTFSVVPSPK	1906	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3731.4	37.33418	2	1414.657047	1414.656755	R	V	163	175
PSM	IMNTFSVVPSPK	1907	sp|Q13509|TBB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3715.3	36.91468	2	1414.657047	1414.656755	R	V	163	175
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	1908	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:4,16-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.3850.4	40.40945	4	2833.359694	2833.352672	K	S	362	389
PSM	SPAFVQLAPLSSK	1909	sp|P51610|HCFC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3996.2	44.16128	2	1423.713647	1423.711233	R	V	1205	1218
PSM	AALEALGSCLNNK	1910	sp|P34897|GLYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3727.4	37.22945	2	1439.648847	1439.647981	R	Y	83	96
PSM	TDSVIIADQTPTPTRFLK	1911	sp|P17544|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.4117.2	47.25877	3	2162.015771	2162.006168	R	N	42	60
PSM	ATLPSPDKLPGFK	1912	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3828.2	39.82423	2	1449.730047	1449.726883	K	M	831	844
PSM	VEIIANDQGNRITPSYVAFTPEGER	1913	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21,20-UNIMOD:21	ms_run[1]:scan=1.1.4076.3	46.20337	4	2935.334094	2935.315434	R	L	50	75
PSM	DVNSSSPVMLAFK	1914	sp|Q99598|TSNAX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4069.2	46.02723	2	1473.664247	1473.657483	K	S	28	41
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	1915	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3920.4	42.22698	4	2972.336094	2972.324602	K	Q	178	204
PSM	DTYSDRSGSSSPDSEITELKFPSINHD	1916	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4077.3	46.2281	4	3063.317694	3063.298250	R	-	565	592
PSM	DTPENNPDTPFDFTPENYK	1917	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4085.4	46.43245	3	2319.933971	2319.920904	R	R	43	62
PSM	IFVGGLSPDTPEEK	1918	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3761.4	38.10518	2	1567.721847	1567.717106	K	I	184	198
PSM	ISMQDVDLSLGSPK	1919	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=1.1.3701.5	36.55538	2	1584.717447	1584.710641	K	L	500	514
PSM	QEEEQDLDGEKGPSSEGPEEEDGEGFSFK	1920	sp|P84157|MXRA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3715.4	36.91802	4	3264.291694	3264.277968	R	Y	114	143
PSM	NTSLPPLWSPEAER	1921	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4090.2	46.5545	3	1675.760171	1675.760702	K	S	201	215
PSM	VTNGAFTGEISPGMIK	1922	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3971.4	43.54897	2	1700.791447	1700.784474	K	D	107	123
PSM	ADAASSLTVDVTPPTAK	1923	sp|Q9H8Y8|GORS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3711.2	36.8064	3	1722.813071	1722.807712	K	A	404	421
PSM	DNLTLWTADNAGEEGGEAPQEPQS	1924	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4320.3	52.11765	3	2608.078871	2608.060251	R	-	225	249
PSM	GSTPYGGVKLEDLIVK	1925	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4099.2	46.7891	3	1754.889071	1754.885569	R	D	166	182
PSM	ISLPGQMAGTPITPLK	1926	sp|Q9H8Y8|GORS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:35,10-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4024.2	44.85593	3	1798.839071	1798.834141	K	D	213	229
PSM	TWTTPEVTSPPPSPR	1927	sp|Q7Z6M1|RABEK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3706.2	36.67585	3	1811.756771	1811.753248	R	T	125	140
PSM	QGSYSPALPLQPLGGHK	1928	sp|Q6ZRI6|CO039_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3833.2	39.95565	3	1828.887371	1828.887300	K	G	295	312
PSM	DLYLIPLSAQDPVPSK	1929	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4503.2	55.49092	3	1834.920971	1834.911783	K	L	1158	1174
PSM	SATSSSPGSPLHSLETSL	1930	sp|P20020|AT2B1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4639.2	57.48803	3	1916.787071	1916.780585	K	-	1203	1221
PSM	YFEADPPGQVAASPDPTT	1931	sp|O43598|DNPH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3760.2	38.07272	3	1941.822071	1941.803355	R	-	157	175
PSM	QFVPIKVEQIEAGTPGR	1932	sp|Q16881|TRXR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3833.3	39.95898	3	1947.990071	1947.981929	R	L	400	417
PSM	DGLLSPGAWNGEPSGEGSR	1933	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4178.2	48.7439	3	1964.833271	1964.826550	K	S	504	523
PSM	QQGFNYCTSAISSPLTK	1934	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3816.2	39.50967	3	1980.866471	1980.865244	K	S	1671	1688
PSM	SSDITSDLGNVLTSTPNAK	1935	sp|Q5T8D3-2|ACBD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.4033.3	45.09343	3	1998.916571	1998.914696	R	T	123	142
PSM	TIGGGDDSFNTFFSETGAGK	1936	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4124.2	47.43818	3	2006.893271	2006.885765	K	H	41	61
PSM	QLLTLSSELSQARDENK	1937	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3987.2	43.93513	3	2010.970271	2010.962315	R	R	530	547
PSM	MASPPAPSPAPPAISPIIK	1938	sp|Q00587|BORG5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,8-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4096.3	46.72467	3	2016.948371	2016.939669	R	N	99	118
PSM	PVTTPEEIAQVATISANGDK	1939	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3952.4	43.05675	3	2120.012171	2120.003846	K	E	161	181
PSM	LYGPSSVSFADDFVRSSK	1940	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4169.3	48.529	3	2120.892971	2120.885719	R	Q	134	152
PSM	ATESGAQSAPLPMEGVDISPK	1941	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3930.3	42.48468	3	2163.982271	2163.975917	K	Q	8	29
PSM	GSGGLFSPSTAHVPDGALGQR	1942	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4012.2	44.5595	3	2169.935171	2169.924564	R	D	1023	1044
PSM	TDKSSASAPDVDDPEAFPALA	1943	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4117.3	47.2621	3	2182.941371	2182.930741	R	-	388	409
PSM	DNLTLWTSDMQGDGEEQNK	1944	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3747.5	37.75323	3	2195.934671	2195.927707	R	E	226	245
PSM	EIFDSRGNPTVEVDLFTSK	1945	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4491.2	55.17728	3	2313.013571	2312.996726	R	G	10	29
PSM	VAASPKSPTAALNESLVECPK	1946	sp|Q53EZ4|CEP55_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21,9-UNIMOD:21,19-UNIMOD:4	ms_run[1]:scan=1.1.3818.3	39.56538	3	2328.059171	2328.047382	K	C	422	443
PSM	ETAVPGPLGIEDISPNLSPDDK	1947	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=1.1.4371.3	53.07993	3	2343.102371	2343.088304	R	S	1413	1435
PSM	DYEEVGVDSVEGEGEEEGEEY	1948	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3924.4	42.33168	3	2347.905971	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	1949	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4032.5	45.07418	3	2349.957671	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1950	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4065.4	45.93052	3	2408.002871	2407.988786	R	-	223	246
PSM	DSGSDEDFLMEDDDDSDYGSSK	1951	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3817.5	39.5459	3	2427.877571	2427.865619	K	K	129	151
PSM	ASYHFSPEELDENTSPLLGDAR	1952	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4232.2	50.13757	3	2607.073871	2607.056760	K	F	262	284
PSM	SGVDQMDLFGDMSTPPDLNSPTESK	1953	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=1.1.4235.5	50.2293	3	2763.150971	2763.129259	K	D	208	233
PSM	TCNSPQNSTDSVSDIVPDSPFPGALGSDTR	1954	sp|Q14694|UBP10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,19-UNIMOD:21	ms_run[1]:scan=1.1.4191.5	49.09521	4	3200.381694	3200.360533	R	T	208	238
PSM	SSPNPFVGSPPK	1955	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3618.5	34.42768	2	1373.550847	1372.546550	K	G	393	405
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	1956	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3170.6	22.85108	5	3566.446618	3565.448950	K	D	124	155
PSM	ESVPEFPLSPPK	1957	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3992.2	44.05885	2	1406.655047	1405.653049	K	K	30	42
PSM	ASGVAVSDGVIK	1958	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3960.4	43.26572	2	1303.5499	1303.5457	M	V	2	14
PSM	KYEQGFITDPVVLSPK	1959	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3929.3	42.45868	3	1899.944471	1899.938332	K	D	109	125
PSM	ATESGAQSAPLPMEGVDISPKQDEGVLK	1960	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=1.1.3746.3	37.72227	4	2949.382894	2949.367850	K	V	8	36
PSM	EAALPPVSPLK	1961	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3696.4	36.4214	2	1200.613447	1200.615542	R	A	1224	1235
PSM	ATNFLAHEK	1962	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3676.3	35.89673	2	1151.4995	1151.5007	M	I	2	11
PSM	TEWETAAPAVAETPDIK	1963	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=1.1.4193.2	49.1377	3	1949.8720	1949.8654	M	L	2	19
PSM	GVLLFGPPGTGK	1964	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4103.2	46.8934	2	1221.617447	1221.615876	K	T	211	223
PSM	SAAPSTLDSSSTAPAQLGK	1965	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3427.3	29.48125	3	1867.8577	1867.8559	R	K	209	228
PSM	SDEFSLADALPEHSPAK	1966	sp|Q8NDC0|MISSL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,14-UNIMOD:21	ms_run[1]:scan=1.1.4204.2	49.42563	3	1934.8358	1934.8294	M	T	2	19
PSM	AASEAAVVSSPSLK	1967	sp|Q8WWH5|TRUB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.3674.4	35.84773	2	1437.6755	1437.6747	M	T	2	16
PSM	SDKDDIETPLLTEAAPILEDGNCEPAK	1968	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,8-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.4623.2	57.33967	3	3062.3922	3062.3672	M	N	2	29
PSM	MFPAAPSPRTPGTGSR	1969	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3954.2	43.10232	3	1830.7588	1830.7520	-	R	1	17
PSM	SCINLPTVLPGSPSK	1970	sp|P04183|KITH_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4469.2	54.81777	2	1690.8092	1690.7992	M	T	2	17
PSM	DLGLPTEAYISVEEVHDDGTPTSK	1971	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	20-UNIMOD:21	ms_run[1]:scan=1.1.4251.2	50.60489	4	2652.196894	2652.184389	K	T	130	154
PSM	ASGVQVADEVCR	1972	sp|P60981|DEST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3685.5	36.13735	2	1411.5874	1411.5798	M	I	2	14
PSM	MLSPQR	1973	sp|Q6DD88|ATLA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	28.95562	2	852.3536	852.3560	-	V	1	7
PSM	AAYPDLENPPLLVTPSQQAK	1974	sp|P54136|SYRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4143.2	47.93778	3	2231.095571	2231.087516	K	F	90	110
PSM	AENVVEPGPPSAK	1975	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.3494.4	31.20438	2	1415.6338	1415.6329	M	R	2	15
PSM	KFCIQQVGDMTNRK	1976	sp|P18433|PTPRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:4,10-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	18.48	3	1819.799771	1819.811041	R	P	382	396
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	1977	sp|O60784|TOM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3752.4	37.87315	4	2654.200094	2654.189112	K	K	453	479
PSM	PNMVTAGHACTKKYTPEQVAMATVTALHR	1978	sp|P05062|ALDOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:4,11-UNIMOD:21,15-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.4468.2	54.80238	4	3425.488094	3422.477722	K	T	231	260
PSM	YNQLLR	1979	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3189.2	23.32837	2	805.442647	805.444637	K	I	407	413
PSM	VIPELNGK	1980	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3273.2	25.46733	2	868.499847	868.501818	K	L	220	228
PSM	QLIVGVNK	1981	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3280.2	25.64965	2	869.534247	869.533452	K	M	147	155
PSM	IIALDGDTK	1982	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3304.2	26.27578	2	944.519247	944.517862	R	N	335	344
PSM	FQEQECPPSPEPTRK	1983	sp|P62070|RRAS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	21.08305	4	1908.812094	1908.807729	K	E	178	193
PSM	DLSIRSVR	1984	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3298.2	26.1183	2	1024.505247	1024.506660	K	L	64	72
PSM	AKPAMPQDSVPSPR	1985	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3198.2	23.5623	3	1559.715071	1559.716729	K	S	470	484
PSM	IESPKLER	1986	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3082.2	20.61885	3	1050.512771	1050.511076	K	T	807	815
PSM	NSNSPPSPSSMNQR	1987	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3056.5	20.02962	3	1581.624071	1581.624285	R	R	454	468
PSM	SAFSGGYYR	1988	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3366.2	27.88403	2	1086.418847	1086.417176	K	G	43	52
PSM	TTIFSPEGR	1989	sp|P25789|PSA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3572.2	33.22097	2	1086.475647	1086.474691	R	L	9	18
PSM	AVNSATGVPTV	1990	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3607.2	34.131	2	1094.498047	1094.500906	K	-	626	637
PSM	DVNAAIATIK	1991	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3449.2	30.05215	2	1094.534847	1094.537291	K	T	327	337
PSM	LVEPGSPAEK	1992	sp|O14745|NHRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3058.3	20.07387	2	1105.506247	1105.505657	R	A	41	51
PSM	TPKTPKGPSSVEDIK	1993	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3119.2	21.5414	3	1662.825671	1662.822968	K	A	234	249
PSM	LLASADDFGK	1994	sp|O95834|EMAL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3619.2	34.44382	2	1115.489247	1115.490007	K	V	587	597
PSM	IVAPISDSPKPPPQR	1995	sp|O95336|6PGL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3328.2	26.8965	3	1680.861071	1680.860022	K	V	171	186
PSM	GTYVPSSPTR	1996	sp|Q9Y4P8|WIPI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3121.3	21.59443	2	1143.497647	1143.496155	K	L	407	417
PSM	LITPAVVSER	1997	sp|P62851|RS25_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3621.2	34.49625	2	1163.594847	1163.595140	K	L	67	77
PSM	TISPMVMDAK	1998	sp|P18206|VINC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3558.3	32.85785	2	1171.502847	1171.501834	K	A	793	803
PSM	GGSGSGPTIEEVD	1999	sp|P0DMV8|HS71A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3319.2	26.66358	2	1203.526047	1203.525526	K	-	629	642
PSM	ENMEAISPLK	2000	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3539.2	32.36392	2	1210.531047	1210.530491	R	N	80	90
PSM	EAPEGWQTPK	2001	sp|Q9NWT8|AKIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3274.3	25.49657	2	1221.507847	1221.506719	K	I	184	194
PSM	GPTTGEGALDLSDVHSPPKSPEGK	2002	sp|O95684|FR1OP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3447.4	30.00665	4	2455.128094	2455.126815	K	T	141	165
PSM	EAESSPFVER	2003	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3215.2	24.00125	2	1229.497447	1229.496549	K	L	548	558
PSM	EQGQAPITPQQGQALAK	2004	sp|P84095|RHOG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3327.5	26.88042	3	1843.885271	1843.882943	K	Q	131	148
PSM	VAEDEAEAAAAAK	2005	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3064.3	20.19035	2	1244.587247	1244.588461	K	F	148	161
PSM	DAPWTASSSEK	2006	sp|Q00341|VIGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3319.4	26.67025	2	1257.491647	1257.491463	R	A	1230	1241
PSM	VLLSDSNLHDA	2007	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3659.2	35.45007	2	1262.556647	1262.554398	K	-	302	313
PSM	HSQPSPEPHSPTEPPAWGSSIVK	2008	sp|Q5VZ89|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3516.2	31.7716	4	2531.146894	2531.148219	K	V	964	987
PSM	QSQQPMKPISPVKDPVSPASQK	2009	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.3408.3	28.98515	4	2536.188094	2536.179793	R	M	1085	1107
PSM	ELISNASDALDK	2010	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3457.4	30.26462	2	1274.637447	1274.635411	R	I	103	115
PSM	YVECSALTQK	2011	sp|P60953|CDC42_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3276.3	25.54865	2	1277.537847	1277.536305	K	G	154	164
PSM	TTLPQDCSNPAPLSSPLNGVHDR	2012	sp|P16278|BGAL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3649.3	35.20452	4	2555.155694	2555.147567	R	A	420	443
PSM	LKDDEVAQLKK	2013	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3055.2	19.99398	3	1285.724171	1285.724166	K	S	309	320
PSM	TQMAEVLPSPR	2014	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3571.3	33.19802	2	1307.603847	1307.594489	K	G	1205	1216
PSM	APASVLPAATPR	2015	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3469.3	30.5685	2	1309.585447	1309.583269	R	Q	45	57
PSM	VKLESPTVSTLTPSSPGK	2016	sp|Q96C36|P5CR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3608.5	34.16728	3	1986.931571	1986.931606	R	L	290	308
PSM	AGDNIPEEQPVASTPTTVSDGENKK	2017	sp|Q9Y320|TMX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3308.5	26.39	4	2663.200094	2663.196351	K	D	270	295
PSM	TPKGPSSVEDIK	2018	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3152.6	22.38393	2	1336.628847	1336.627563	K	A	237	249
PSM	NGNTNSLNLSSPNPMENK	2019	sp|Q9UPQ9|TNR6B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3593.2	33.76814	3	2009.855771	2009.851385	K	G	375	393
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2020	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3580.4	33.43703	4	2717.314494	2717.307830	R	R	31	56
PSM	GEPNVSYICSR	2021	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3364.4	27.83865	2	1360.550847	1360.548267	R	Y	273	284
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	2022	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.3540.3	32.3921	4	2717.314094	2717.307830	R	R	31	56
PSM	NLYPSSSPYTR	2023	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3445.3	29.95117	2	1363.582647	1363.580947	K	N	275	286
PSM	EIDCLSPEAQK	2024	sp|Q32MZ4|LRRF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3265.4	25.26643	2	1368.567047	1368.563248	R	L	11	22
PSM	ESDFSDTLSPSK	2025	sp|Q14BN4|SLMAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3377.2	28.17143	2	1391.552447	1391.549372	K	E	444	456
PSM	SSPASSQEGSPSGDQQFSPK	2026	sp|Q6ZW49|PAXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3140.4	22.067	3	2086.854071	2086.848073	K	S	218	238
PSM	IIYGGSVTGATCK	2027	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3357.5	27.65942	2	1405.631647	1405.631268	R	E	244	257
PSM	TQYNQVPSEDFERTPQSPTLPPAK	2028	sp|P78310|CXAR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3659.3	35.4534	4	2809.301694	2809.296005	K	V	316	340
PSM	GILAADESTGSIAK	2029	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3472.5	30.65057	2	1411.661847	1411.659591	K	R	29	43
PSM	TKTPGPGAQSALR	2030	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3081.3	20.59667	3	1442.631971	1442.632011	R	A	105	118
PSM	CVSPIPVSPTSR	2031	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3451.3	30.10767	2	1458.601247	1458.597934	R	I	811	823
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	2032	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3452.5	30.14032	3	2268.869771	2268.864409	R	S	326	351
PSM	SGSSSPDSEITELK	2033	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3503.4	31.43877	2	1515.636447	1515.634164	R	F	571	585
PSM	IYQEEEMPESGAGSEFNRK	2034	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3429.6	29.54343	3	2279.947871	2279.940594	K	L	56	75
PSM	EFHLNESGDPSSK	2035	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3274.5	25.50323	2	1525.611847	1525.608618	K	S	165	178
PSM	FQRPGDPQSAQDK	2036	sp|Q15637|SF01_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3016.2	19.15047	2	1552.668847	1552.667136	K	A	294	307
PSM	DGTAPPPQSPGSPGTGQDEEWSDEESPRK	2037	sp|Q9UKS6|PACN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3339.5	27.19225	4	3117.291694	3117.283662	R	A	333	362
PSM	NIIHGSDSVESAEK	2038	sp|P15531|NDKA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3152.3	22.37393	3	1564.679471	1564.677032	R	E	115	129
PSM	YEQGTGCWQGPNR	2039	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3228.5	24.33845	2	1631.622447	1631.618806	K	S	465	478
PSM	SAPASPTHPGLMSPR	2040	sp|P85037|FOXK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	27.64942	3	1664.676971	1664.678309	R	S	416	431
PSM	RVTNDISPESSPGVGR	2041	sp|Q15154|PCM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3164.5	22.69223	3	1749.808571	1749.804692	K	R	59	75
PSM	HAEPLTDTGSETPTAR	2042	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3087.2	20.74725	3	1761.761471	1761.757074	K	R	51	67
PSM	GNCVSLLSPSPEGDPR	2043	sp|P17813|EGLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3668.2	35.68435	3	1763.756471	1763.754965	K	F	514	530
PSM	VQHASPAGTYAHTVNR	2044	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3057.2	20.04502	4	1787.811294	1787.810446	R	N	173	189
PSM	DQELSPREPVLPPQK	2045	sp|O95139|NDUB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3483.2	30.91445	3	1811.881571	1811.881880	K	M	25	40
PSM	KPVTVSPTTPTSPTEGEAS	2046	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3294.6	26.02758	3	2044.865171	2044.864315	R	-	505	524
PSM	KPVTVSPTTPTSPTEGEAS	2047	sp|Q9Y6G9|DC1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3286.3	25.80977	3	2044.865171	2044.864315	R	-	505	524
PSM	QAGPASVPLRTEEEFKK	2048	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3422.5	29.3575	3	2045.926871	2045.922439	K	F	131	148
PSM	KDNEESEQPPVPGTPTLR	2049	sp|O15439|MRP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3372.3	28.0444	3	2072.943371	2072.941580	K	N	633	651
PSM	NSLDASRPAGLSPTLTPGER	2050	sp|Q14135|VGLL4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3597.3	33.87285	3	2118.012371	2118.010663	K	Q	138	158
PSM	EYIPGQPPLSQSSDSSPTR	2051	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3614.3	34.31637	3	2124.945371	2124.936495	K	N	871	890
PSM	IADPEHDHTGFLTEYVATR	2052	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3664.4	35.58712	3	2251.002371	2250.994678	R	W	190	209
PSM	EEDCHSPTSKPPKPDQPLK	2053	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.2999.2	18.74783	4	2269.010494	2269.008614	K	V	454	473
PSM	SWDSSSPVDRPEPEAASPTTR	2054	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3394.5	28.62548	3	2351.013371	2351.006699	R	T	354	375
PSM	SPEKLPQSSSSESSPPSPQPTK	2055	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3087.5	20.76058	3	2361.082271	2361.073716	K	V	408	430
PSM	RSEACPCQPDSGSPLPAEEEK	2056	sp|Q14160|SCRIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,7-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.3176.6	23.00623	3	2422.983971	2422.977056	R	R	492	513
PSM	AIPGDQHPESPVHTEPMGIQGR	2057	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3384.4	28.36137	4	2432.101694	2432.094409	R	G	784	806
PSM	CQENGQELSPIALEPGPEPHR	2058	sp|O94966-2|UBP19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3669.6	35.72387	3	2437.080371	2437.073339	R	A	202	223
PSM	LDNTPASPPRSPAEPNDIPIAK	2059	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3650.3	35.2293	3	2459.123471	2459.113487	K	G	2311	2333
PSM	STAQQELDGKPASPTPVIVASHTANK	2060	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3404.4	28.88383	4	2726.335694	2726.327640	R	E	847	873
PSM	NQIHVKSPPREGSQGELTPANSQSR	2061	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3143.6	22.15125	4	2876.306494	2876.296765	R	M	462	487
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	2062	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2995.4	18.67965	4	3178.172894	3178.161241	R	K	494	522
PSM	NVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADK	2063	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	28-UNIMOD:21	ms_run[1]:scan=1.1.3595.3	33.82208	5	4716.124118	4716.094806	K	A	530	573
PSM	DFLLTAR	2064	sp|P63173|RL38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3891.2	41.46302	2	914.423247	914.426284	K	R	10	17
PSM	DQLIYNLLK	2065	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4181.2	48.82347	2	1118.633847	1118.633560	K	E	6	15
PSM	DRLGSPLAVDEALRR	2066	sp|Q7RTP6|MICA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3695.2	36.38855	3	1746.876971	1746.877798	K	S	1306	1321
PSM	LVLDSVKLEA	2067	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4029.2	44.98623	2	1165.600247	1165.599557	R	-	99	109
PSM	VSPLNLSSVTP	2068	sp|Q9UJX2|CDC23_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4121.2	47.36123	2	1192.572847	1192.574071	R	-	587	598
PSM	DDTDDEIAKYDGKWEVEEMK	2069	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3831.2	39.90298	4	2415.044494	2415.042402	K	E	91	111
PSM	TLLLSSDDEF	2070	sp|Q9Y519|T184B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4693.2	58.17982	2	1218.511047	1218.505716	K	-	398	408
PSM	GVLLFGPPGTGK	2071	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4111.2	47.102	2	1221.617447	1221.615876	K	T	211	223
PSM	TVFSPTLPAAR	2072	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3830.4	39.88348	2	1238.605647	1238.606039	K	S	375	386
PSM	GLLLYGPPGTGK	2073	sp|Q8IYT4|KATL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3867.2	40.85045	2	1251.628447	1251.626441	K	T	289	301
PSM	IMGTSPLQIDR	2074	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3776.3	38.47957	2	1309.609647	1309.610139	K	A	1075	1086
PSM	TLTPISAAYAR	2075	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3738.3	37.51333	2	1322.567647	1322.567285	K	A	295	306
PSM	DMGAQYAAASPAWAAAQQR	2076	sp|Q8NFD5|ARI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3786.3	38.7295	3	2042.870171	2042.866975	K	S	478	497
PSM	NNIPYFETSAK	2077	sp|P51149|RAB7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3734.3	37.4089	2	1362.588447	1362.585698	K	E	147	158
PSM	LLLSSETPIEGK	2078	sp|Q9HDC9|APMAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3694.2	36.3623	2	1365.681447	1365.679264	K	N	184	196
PSM	ICSIYTQSGENSLVQEGSEASPIGK	2079	sp|Q9Y4W2|LAS1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3838.3	40.09005	4	2733.223694	2733.220457	R	S	503	528
PSM	DLPTIPGVTSPSSDEPPMEASQSHLR	2080	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4129.2	47.56818	4	2827.286094	2827.273555	R	N	74	100
PSM	ALAGCDFLTISPK	2081	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.4123.3	47.41563	2	1471.689647	1471.678218	K	L	246	259
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	2082	sp|Q6P2E9|EDC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3752.5	37.87648	4	2961.191694	2961.178529	R	V	870	899
PSM	GNPTVEVDLFTSK	2083	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3992.3	44.06218	2	1485.681847	1485.675241	R	G	16	29
PSM	YQIDPDACFSAK	2084	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3696.5	36.42473	2	1493.593247	1493.589797	K	V	225	237
PSM	TGTAEMSSILEER	2085	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3836.6	40.04775	2	1502.634447	1502.632390	K	I	46	59
PSM	SCEGQNPELLPKTPISPLK	2086	sp|Q9NQW6|ANLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,13-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3887.3	41.36123	3	2267.038571	2267.031003	K	T	308	327
PSM	TSESTGSLPSPFLR	2087	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3907.4	41.88645	2	1557.712047	1557.707604	K	A	177	191
PSM	TLEAEFNSPSPPTPEPGEGPR	2088	sp|A0MZ66|SHOT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.3791.4	38.86368	3	2367.975671	2367.966154	K	K	525	546
PSM	ATTPASTANSDVATIPTDTPLKEENEGFVK	2089	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3938.5	42.70013	4	3263.473694	3263.452382	K	V	274	304
PSM	IFVGGLSPDTPEEK	2090	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3941.4	42.77367	2	1647.689247	1647.683437	K	I	184	198
PSM	IFVGGLSPDTPEEK	2091	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3933.5	42.56978	2	1647.689247	1647.683437	K	I	184	198
PSM	GQLTNIVSPTAATTPR	2092	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3713.2	36.85882	3	1785.804671	1785.806346	K	I	993	1009
PSM	DDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN	2093	sp|Q9BVG9|PTSS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	34-UNIMOD:21	ms_run[1]:scan=1.1.4499.2	55.39725	4	3607.589294	3607.558775	K	-	452	488
PSM	NLGTIAKSGTSEFLNK	2094	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3953.3	43.07952	3	1838.831171	1838.821662	K	M	162	178
PSM	DATLTALDRGQQQVFK	2095	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3862.2	40.71898	3	1869.902171	1869.898593	K	G	391	407
PSM	NLPPEEQMISALPDIK	2096	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4315.2	51.98835	3	1873.898771	1873.889668	K	V	410	426
PSM	SEPSLEPESFRSPTFGK	2097	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3736.4	37.46452	3	1973.878271	1973.877189	R	S	398	415
PSM	EGYNNPPISGENLIGLSR	2098	sp|Q9Y5Q8|TF3C5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4081.2	46.32495	3	2008.935671	2008.925536	R	A	192	210
PSM	LDNVPHTPSSYIETLPK	2099	sp|Q99733|NP1L4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.4100.3	46.82185	3	2069.919671	2069.911205	R	A	45	62
PSM	ILATPPQEDAPSVDIANIR	2100	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4046.3	45.4335	3	2099.033771	2099.030001	K	M	284	303
PSM	DLGTQNHTSELILSSPPGQK	2101	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3699.3	36.49653	3	2201.044571	2201.036543	K	V	385	405
PSM	ESMCSTPAFPVSPETPYVK	2102	sp|Q68CZ2|TENS3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21,4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.4124.4	47.44485	3	2285.915171	2285.902691	K	T	839	858
PSM	SGSSSPDSEITELKFPSINHD	2103	sp|P17812|PYRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4097.3	46.74385	3	2326.015271	2326.000217	R	-	571	592
PSM	GVVPLAGTNGETTTQGLDGLSER	2104	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3985.3	43.8895	3	2351.109671	2351.100600	K	C	112	135
PSM	AAVPSGASTGIYEALELRDNDK	2105	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4101.2	46.8446	3	2356.110671	2356.094786	R	T	33	55
PSM	GVVPLAGTNGETTTQGLDGLSER	2106	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.4226.3	49.99492	3	2431.087271	2431.066931	K	C	112	135
PSM	AIVDALPPPCESACTVPTDVDK	2107	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3950.5	43.00773	3	2434.092071	2434.079730	R	W	261	283
PSM	AAVPSGASTGIYEALELRDNDK	2108	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4237.3	50.28112	3	2436.072971	2436.061117	R	T	33	55
PSM	DNLTLWTSDSAGEECDAAEGAEN	2109	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4099.4	46.79576	3	2453.991671	2453.976507	R	-	223	246
PSM	ISPLSSPCSSPLQGTPASSLVSK	2110	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.4288.3	51.4278	3	2459.120771	2459.105625	K	I	519	542
PSM	IAQLEEELEEEQGNTELINDR	2111	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4029.6	44.99957	3	2471.183471	2471.166357	R	L	1731	1752
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	2112	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3806.5	39.25778	3	2574.011771	2573.998594	R	G	239	267
PSM	AGGAGVPAFYTPTGYGTLVQEGGSPIK	2113	sp|P55809|SCOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.4540.2	55.99015	3	2754.260171	2754.234331	R	Y	147	174
PSM	SNLVDNTNQVEVLQRDPNSPLYSVK	2114	sp|Q9NUU7|DD19A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3947.3	42.92362	4	2908.407294	2908.396782	R	S	67	92
PSM	DGDSYRSPWSNKYDPPLEDGAMPSAR	2115	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21	ms_run[1]:scan=1.1.3854.4	40.51462	4	2990.265294	2990.254217	R	L	67	93
PSM	AASQLAVPSTPLSPHSAASGTAAGSQPSSPR	2116	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,13-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.3750.6	37.83005	4	3127.356094	3127.341406	R	Y	299	330
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	2117	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.4074.5	46.16082	4	3522.496894	3522.472617	K	F	604	634
PSM	LASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICR	2118	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=1.1.4060.6	45.8069	4	3637.668894	3637.645482	R	V	592	630
PSM	QSKPVTTPEEIAQVATISANGDK	2119	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=1.1.4063.5	45.88203	3	2446.1698	2446.1623	K	E	158	181
PSM	DQLIYNLLKEEQTPQNK	2120	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4171.2	48.5785	4	2153.044494	2153.040566	K	I	6	23
PSM	QGAIVAVTGDGVNDSPALK	2121	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=1.1.4135.3	47.73228	2	1873.8972	1873.8822	R	K	708	727
PSM	DMSPLSETEMALGK	2122	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.4164.3	48.4443	2	1603.660047	1603.651077	K	D	505	519
PSM	NGSLDSPGKQDTEEDEEEDEK	2123	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3094.5	20.9415	3	2430.915371	2429.923149	K	D	134	155
PSM	ASGVAVSDGVIK	2124	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.3691.3	36.28713	2	1223.5780	1223.5794	M	V	2	14
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2125	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4306.3	51.82685	3	2829.2162	2829.1962	-	Y	1	25
PSM	AAAMDVDTPSGTNSGAGKK	2126	sp|P62877|RBX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3285.4	25.78698	3	1898.8069	1898.8076	M	R	2	21
PSM	QQPPEPEWIGDGESTSPSDK	2127	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=1.1.4043.4	45.35534	3	2245.9141	2245.9047	K	V	7	27
PSM	QREEYQPATPGLGMFVEVKDPEDK	2128	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.4177.4	48.73102	3	2825.2822	2825.2612	K	V	72	96
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	2129	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3443.5	29.90562	4	2987.325694	2987.319929	R	-	684	712
PSM	CPPGSPMNPPHKCEVW	2130	sp|P42892|ECE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,5-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3502.2	31.40593	3	1972.791671	1971.783111	R	-	755	771
PSM	SDAAVDTSSEITTK	2131	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3390.5	28.52082	2	1545.6552	1545.6442	M	D	2	16
PSM	SDAAVDTSSEITTK	2132	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.3372.6	28.0544	2	1545.6461	1545.6442	M	D	2	16
PSM	DTPENNPDTPFDFTPENYK	2133	sp|P19404|NDUV2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4085.5	46.43578	3	2319.933971	2319.920904	R	R	43	62
PSM	YLDEDTIYHLQPSGR	2134	sp|P31153|METK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3792.3	38.88662	3	1885.825271	1885.824759	K	F	235	250
PSM	VASGGGGVGDGVQEPTTGNWR	2135	sp|O00429-2|DNM1L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3484.6	30.95313	3	2079.903071	2079.901112	K	G	559	580
PSM	MNLLPNIESPVTRQEK	2136	sp|P17980|PRS6A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.4497.2	55.33173	3	1989.9689	1989.9590	-	M	1	17
PSM	ILGSLDALPMEEEEEEDK	2137	sp|Q9BWT1|CDCA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=1.1.3025.3	19.33887	4	2046.9362	2045.9342	R	Y	187	205
PSM	GTPQKDVIIK	2138	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3359.3	27.70473	2	1219.6205	1219.6208	M	S	2	12
PSM	ASLEVSRSPR	2139	sp|O60762|DPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3290.4	25.91767	2	1222.5697	1222.5702	M	R	2	12
PSM	KTGEAYVQFEEPEMANQALLK	2140	sp|Q12849|GRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	14-UNIMOD:35	ms_run[1]:scan=1.1.2922.2	17.5718	4	2411.1792	2411.1672	R	H	289	310
PSM	KNDHDGDGFISPK	2141	sp|Q9Y680|FKBP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3112.3	21.36958	3	1508.635571	1508.629688	K	E	200	213
PSM	GGLGAPPLQSAR	2142	sp|Q01433|AMPD2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3408.2	28.98182	2	1202.580447	1202.580887	R	S	88	100
PSM	EQNPPPARSEDMPFSPK	2143	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3398.5	28.72992	3	2005.863671	2005.860493	K	A	251	268
PSM	MTELSRDMNAYIRPSPTR	2144	sp|Q8IVH4|MMAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35,8-UNIMOD:35,11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	38.33192	3	2329.964171	2328.963335	R	G	197	215
PSM	ENVATTDTLESTTVGTSV	2145	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3821.3	39.64425	3	1903.833671	1903.829964	K	-	580	598
PSM	YEQGFITDPVVLSPKDR	2146	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3931.4	42.51423	3	2042.974271	2042.971423	K	V	110	127
PSM	LPTDNQTKKPETYLMPK	2147	sp|A6NI72|NCF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4413.2	53.8932	3	2083.992371	2083.006094	K	D	128	145
PSM	NHSGSRTPPVALNSSR	2148	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3048.4	19.8216	4	1758.818094	1758.816260	R	M	2098	2114
PSM	QTVAVGVIK	2149	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3290.2	25.911	2	913.558847	913.559667	R	A	431	440
PSM	NGRYSISRTEAADLCK	2150	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3297.2	26.09213	4	1919.864494	1919.856076	K	A	39	55
PSM	VLDSGAPIK	2151	sp|P06576|ATPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3303.3	26.2529	2	978.477047	978.478714	K	I	125	134
PSM	EIAEAYLGK	2152	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3382.2	28.30228	2	992.519447	992.517862	K	T	129	138
PSM	ALTSPSWGK	2153	sp|Q10571|MN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3425.2	29.42575	2	1025.459247	1025.458313	K	G	1004	1013
PSM	LLPDPGSPR	2154	sp|A6ND36|FA83G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3326.2	26.84432	2	1030.483847	1030.484862	R	L	754	763
PSM	EGLELPEDEEEKK	2155	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3327.2	26.87042	3	1543.724771	1543.725348	K	K	412	425
PSM	DGGFCEVCK	2156	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3158.2	22.52675	2	1070.413647	1070.416116	K	K	405	414
PSM	ENLSAAFSR	2157	sp|P15170-2|ERF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3555.2	32.7767	2	1073.454447	1073.454290	R	Q	59	68
PSM	DYDDMSPR	2158	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3114.5	21.42832	2	1077.348047	1077.347441	R	R	279	287
PSM	DYDDMSPR	2159	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3116.3	21.47073	2	1077.348047	1077.347441	R	R	279	287
PSM	KSSPSVKPAVDPAAAK	2160	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3053.5	19.95272	3	1631.829071	1631.828388	K	L	181	197
PSM	IGPLGLSPKK	2161	sp|P30050|RL12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3446.3	29.97728	2	1088.596847	1088.599497	K	V	32	42
PSM	INNFSADIK	2162	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3478.2	30.79077	2	1100.494047	1100.490341	K	D	289	298
PSM	WDQTADQTPGATPK	2163	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3138.4	22.01548	3	1674.635471	1674.632799	R	K	200	214
PSM	SLSYSPVER	2164	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3327.3	26.87375	2	1116.484647	1116.485256	R	R	2690	2699
PSM	STLTDSLVCK	2165	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3426.3	29.4551	2	1122.559847	1122.559075	K	A	33	43
PSM	NYLQSLPSK	2166	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3521.2	31.90232	2	1128.521047	1128.521641	R	T	279	288
PSM	NYLQSLPSK	2167	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3529.2	32.11106	2	1128.521047	1128.521641	R	T	279	288
PSM	TEDEVLTSKGDAWAK	2168	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3437.3	29.74255	3	1728.766571	1728.760762	K	Y	138	153
PSM	LKGEATVSFDDPPSAK	2169	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3399.5	28.75598	3	1740.800171	1740.797147	K	A	333	349
PSM	SCAHDWVYE	2170	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3396.2	28.66767	2	1165.455647	1165.449859	K	-	129	138
PSM	VKPETPPRQSHSGSISPYPK	2171	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3124.3	21.67052	4	2351.072494	2351.071228	K	V	979	999
PSM	GNDPLTSSPGR	2172	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3269.3	25.36703	2	1179.489847	1179.492132	R	S	20	31
PSM	QLEDGRTLSDYNIQK	2173	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3394.3	28.61882	3	1778.881571	1778.879892	K	E	49	64
PSM	DNSTMGYMAAK	2174	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3235.2	24.51047	2	1187.496247	1187.495094	R	K	621	632
PSM	DLLTPCYSR	2175	sp|P07686|HEXB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3651.2	35.25077	2	1203.500047	1203.499526	K	Q	304	313
PSM	IPGSPPESMGR	2176	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3265.3	25.2631	2	1206.516247	1206.510425	K	G	58	69
PSM	AVGSPLCVPAR	2177	sp|Q9NYZ3|GTSE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3448.3	30.02948	2	1205.564247	1205.562795	R	R	533	544
PSM	EVPWSPSAEK	2178	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3517.2	31.79772	2	1208.512847	1208.511470	K	A	552	562
PSM	VPASPLPGLER	2179	sp|Q7KZI7|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3622.2	34.52263	2	1214.605447	1214.606039	K	K	453	464
PSM	LEGQGDVPTPK	2180	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3160.4	22.58527	2	1219.550847	1219.548584	K	Q	257	268
PSM	VNTPTTTVYR	2181	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3171.3	22.86687	2	1230.563247	1230.564569	K	C	244	254
PSM	GQPSPLAQVQQ	2182	sp|P45983-2|MK08_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3443.3	29.89895	2	1231.559647	1231.559818	R	-	374	385
PSM	DVGRPNFEEGGPTSVGR	2183	sp|Q6Y7W6|GGYF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3415.3	29.16768	3	1852.812971	1852.810506	K	K	176	193
PSM	SSEHINEGETAMLVCK	2184	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3380.3	28.25332	3	1883.785571	1883.779466	K	S	228	244
PSM	NQSPVLEPVGR	2185	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3340.3	27.21147	2	1274.602047	1274.602017	R	S	713	724
PSM	LNQSDSIEDPNSPAGRR	2186	sp|Q86VS8|HOOK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3093.3	20.9056	3	1934.850071	1934.848348	R	H	227	244
PSM	AVLIDKDQSPK	2187	sp|Q6NVY1|HIBCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3091.2	20.85073	3	1292.637371	1292.637734	R	W	348	359
PSM	TKSPFEQHIK	2188	sp|Q92520|FAM3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3043.2	19.69167	3	1293.606671	1293.611853	K	N	192	202
PSM	SKWDEEWDK	2189	sp|Q14677|EPN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3442.3	29.87268	2	1301.500047	1301.496549	K	N	182	191
PSM	DFAARSPSASITDEDSNV	2190	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3666.3	35.63607	3	1960.810571	1960.805146	K	-	994	1012
PSM	EKFEAGQFEPSETTAKS	2191	sp|Q5JTJ3|COA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	28.49143	3	1964.839871	1964.840469	K	-	109	126
PSM	NSTLNSAAVTVSS	2192	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3453.2	30.15595	2	1329.584247	1329.581341	R	-	523	536
PSM	NGLAAELGPASPR	2193	sp|Q9BX95|SGPP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3543.4	32.47113	2	1331.624047	1331.623480	R	R	91	104
PSM	QEMQEVQSSRSGRGGNFGFGDSR	2194	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:35,8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3320.6	26.70242	4	2691.054894	2691.053423	R	G	191	214
PSM	NLYPSSSPYTR	2195	sp|Q9Y2Z0|SGT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3467.5	30.52578	2	1363.584047	1363.580947	K	N	275	286
PSM	EMPQDLRSPARTPPSEEDSAEAER	2196	sp|O43765|SGTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3300.5	26.1806	4	2777.200894	2777.196368	K	L	70	94
PSM	SMGTGDTPGLEVPSSPLRK	2197	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:35,7-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3630.5	34.74265	3	2103.901571	2103.894904	R	A	381	400
PSM	DTPTSAGPNSFNK	2198	sp|Q8WW12|PCNP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3175.3	22.97372	2	1414.577847	1414.576590	R	G	138	151
PSM	GAVDGGLSIPHSTK	2199	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3366.5	27.89403	2	1417.663047	1417.660260	K	R	165	179
PSM	SGTPPRQGSITSPQANEQSVTPQRR	2200	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=1.1.3158.5	22.53675	4	2838.282894	2838.281115	K	S	846	871
PSM	EAVREGSPANWK	2201	sp|O96019|ACL6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3141.2	22.08583	3	1422.629771	1422.629294	K	R	227	239
PSM	SGAQASSTPLSPTR	2202	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3096.6	20.99335	2	1438.647647	1438.645338	R	I	12	26
PSM	SIDTQTPSVQER	2203	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3120.4	21.57287	2	1439.634447	1439.629354	R	S	345	357
PSM	DNPGVVTCLDEAR	2204	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3515.4	31.75203	2	1444.662447	1444.661643	K	H	227	240
PSM	EVDEQMLNVQNK	2205	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:35	ms_run[1]:scan=1.1.3144.3	22.16733	3	1461.679271	1461.676959	K	N	325	337
PSM	ANTPDSDITEKTEDSSVPETPDNERK	2206	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	20-UNIMOD:21	ms_run[1]:scan=1.1.3211.4	23.90647	4	2954.280094	2954.266615	R	A	52	78
PSM	LSLEGERQPKSPGSTPTTPTSSQAPQK	2207	sp|P35658|NU214_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3262.4	25.19045	4	2968.368094	2968.358028	R	L	420	447
PSM	AESSSGGGTVPSSAGILEQGPSPGDGSPPKPK	2208	sp|Q68EM7|RHG17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3524.4	31.98743	4	3014.402894	3014.387005	R	D	549	581
PSM	AIEINPDSAQPYK	2209	sp|P50502|F10A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3551.6	32.6866	2	1524.688847	1524.686140	R	W	174	187
PSM	YLLGDAPVSPSSQK	2210	sp|Q9NYB0|TE2IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3636.4	34.89225	2	1540.723047	1540.717440	K	L	195	209
PSM	HGSYEDAVHSGALND	2211	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3218.3	24.07833	2	1570.673647	1570.664814	K	-	542	557
PSM	GIETPQCDQSTGQCVCVEGVEGPRCDK	2212	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,7-UNIMOD:4,14-UNIMOD:4,16-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=1.1.3499.6	31.34125	4	3145.270894	3145.261036	R	C	1138	1165
PSM	DINAYNCEEPTEK	2213	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3198.5	23.5723	2	1581.665647	1581.661702	K	L	85	98
PSM	GQSTGKGPPQSPVFEGVYNNSR	2214	sp|Q8WWM7|ATX2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3513.4	31.69967	3	2385.077471	2385.075054	R	M	101	123
PSM	ESEPESPMDVDNSK	2215	sp|Q86W56|PARG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3172.6	22.90283	2	1642.610847	1642.606963	K	N	297	311
PSM	GGKPEPPAMPQPVPTA	2216	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3546.5	32.5525	2	1652.766647	1652.763345	K	-	228	244
PSM	NQLTSNPENTVFDAK	2217	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3540.5	32.39877	2	1676.806247	1676.800579	K	R	82	97
PSM	STAGDTHLGGEDFDNR	2218	sp|P54652|HSP72_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3198.6	23.57563	2	1690.722047	1690.718306	K	M	224	240
PSM	GGRGDVGSADIQDLEK	2219	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3416.3	29.19388	3	1695.744971	1695.746509	K	W	250	266
PSM	DMFPGPYPRTPEER	2220	sp|O95169|NDUB8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3663.2	35.55438	3	1770.745271	1770.743672	K	A	35	49
PSM	AGGSPAPGPETPAISPSK	2221	sp|P33316|DUT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3285.3	25.78365	3	1779.751571	1779.748163	K	R	85	103
PSM	DQELSPREPVLPPQK	2222	sp|O95139|NDUB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3491.2	31.11945	3	1811.882771	1811.881880	K	M	25	40
PSM	DQELSPREPVLPPQK	2223	sp|O95139|NDUB6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3507.2	31.53643	3	1811.882171	1811.881880	K	M	25	40
PSM	DGQVINETSQHHDDLE	2224	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3182.6	23.16083	2	1835.798847	1835.792199	R	-	451	467
PSM	NHSGSRTPPVALNSSR	2225	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3100.3	21.08638	3	1838.784371	1838.782591	R	M	2098	2114
PSM	SPSDSSTASTPVAEQIER	2226	sp|Q16643|DREB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3336.2	27.10422	3	1940.836271	1940.836446	R	A	337	355
PSM	RRDEDMLYSPELAQR	2227	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3503.3	31.43543	3	1957.875671	1957.871726	R	G	229	244
PSM	AGEAPTENPAPPTQQSSAE	2228	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3141.4	22.0925	3	1960.810871	1960.805146	K	-	354	373
PSM	TQPDGTSVPGEPASPISQR	2229	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3370.4	27.99533	3	2002.903271	2002.899715	R	L	1744	1763
PSM	LSLEGDHSTPPSAYGSVK	2230	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3577.4	33.35815	3	2003.829071	2003.827870	K	A	11	29
PSM	STPSHGSVSSLNSTGSLSPK	2231	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3231.5	24.41655	3	2008.917671	2008.910280	R	H	238	258
PSM	EAGVEMGDEDDLSTPNEK	2232	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3419.4	29.2757	3	2014.776071	2014.771463	R	L	357	375
PSM	SETIQDTDTQSLVGSPSTR	2233	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3509.3	31.5918	3	2100.922871	2100.921238	K	I	327	346
PSM	TPVDESDDEIQHDEIPTGK	2234	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3426.4	29.45843	3	2203.919771	2203.915819	R	C	923	942
PSM	ETCVSGEDPTQGADLSPDEK	2235	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3344.6	27.3251	3	2213.871371	2213.867154	K	V	468	488
PSM	DQQNLPYGVTPASPSGHSQGR	2236	sp|Q7KZI7|MARK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3417.6	29.23015	3	2275.009871	2275.001889	R	R	607	628
PSM	ESAAPASPAPSPAPSPTPAPPQK	2237	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3253.4	24.96278	3	2312.019671	2312.012710	K	E	538	561
PSM	EHYPVSSPSSPSPPAQPGGVSR	2238	sp|O75179|ANR17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3358.5	27.68543	3	2378.999171	2378.993372	K	N	2036	2058
PSM	LQQGAGLESPQGQPEPGAASPQR	2239	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3304.5	26.28578	3	2382.099671	2382.096517	R	Q	72	95
PSM	IVRGDQPAASGDSDDDEPPPLPR	2240	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3421.6	29.33455	3	2483.106671	2483.096577	K	L	45	68
PSM	ELEKPIQSKPQSPVIQAAAVSPK	2241	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3481.4	30.87123	4	2604.303294	2604.296537	R	F	207	230
PSM	QEDSESSEEESDSEEAAASPAQVK	2242	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3122.5	21.62958	3	2618.012771	2618.002856	K	T	759	783
PSM	NSSTGDGAPSSACTSDSKDPSLRPAQPVRK	2243	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3077.3	20.50623	5	3152.4216177391495	3152.4193844090196	R	G	234	264
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2244	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3658.6	35.43805	4	3459.445694	3459.429735	K	L	104	135
PSM	DLSLDDFK	2245	sp|P30048|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3851.2	40.4292	2	951.451647	951.454927	K	G	84	92
PSM	DVIEEYFK	2246	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3926.2	42.37718	2	1041.500247	1041.501878	K	C	122	130
PSM	ESAFEFLSSA	2247	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4861.2	59.93653	2	1166.457447	1166.453287	K	-	325	335
PSM	DLKPENILCESPEKVSPVK	2248	sp|Q9BUB5|MKNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:4,11-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3852.2	40.45542	4	2341.076094	2341.067783	R	I	211	230
PSM	DVTNFTVGGFAPMSPR	2249	sp|O00267|SPT5H_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=1.1.4114.2	47.1806	3	1790.772971	1790.769887	R	I	653	669
PSM	SSDEENGPPSSPDLDRIAASMR	2250	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3893.2	41.5153	4	2410.016094	2410.010799	R	A	202	224
PSM	SLNILTAFQK	2251	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4391.3	53.55877	2	1213.611847	1213.610790	K	K	244	254
PSM	AIVDALPPPCESACTVPTDVDK	2252	sp|Q15181|IPYR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:4,12-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3956.2	43.1544	4	2434.081294	2434.079730	R	W	261	283
PSM	KAPLNIPGTPVLEDFPQNDDEK	2253	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4120.2	47.33572	4	2516.192894	2516.183601	R	E	41	63
PSM	RDSFDDRGPSLNPVLDYDHGSR	2254	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3688.4	36.21135	4	2597.1300	2597.1291	R	S	186	208
PSM	DVLSVAFSSDNR	2255	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3886.2	41.33163	2	1308.629647	1308.630994	K	Q	107	119
PSM	ELFQTPGPSEESMTDEK	2256	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3743.5	37.65088	3	2003.809571	2003.807120	K	T	1107	1124
PSM	ETYTDDLPPPPVPPPAIKSPTAQSK	2257	sp|Q9Y6N7|ROBO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	21-UNIMOD:21	ms_run[1]:scan=1.1.3884.2	41.27979	4	2725.330494	2725.325180	R	T	1474	1499
PSM	DNGDLVLSSPSNVTLPQVK	2258	sp|P04150|GCR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4165.2	48.45713	3	2062.006871	2061.998367	K	T	259	278
PSM	VEVKVPPAPVPCPPPSPGPSAVPSSPK	2259	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:4,16-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.3858.3	40.6167	4	2833.364494	2833.352672	K	S	362	389
PSM	DILAQSPAAEPLK	2260	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3705.2	36.6498	2	1431.704047	1431.701062	K	N	1232	1245
PSM	GLPTGDSPLGPMTHRGEEDWLYER	2261	sp|Q9NVS9|PNPO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=1.1.4115.3	47.21	4	2872.206894	2872.192876	R	L	235	259
PSM	NVMLLPVGSADDGAHSQNEK	2262	sp|Q96KP4|CNDP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3764.2	38.17535	3	2160.962471	2160.951099	K	L	431	451
PSM	IADPEHDHTGFLTEYVATRWYR	2263	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21,15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4151.2	48.13885	4	2916.186894	2916.171093	R	A	190	212
PSM	GYISPYFINTSK	2264	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3961.2	43.28528	2	1468.671047	1468.663948	R	G	222	234
PSM	GDGSPSPEYTLFR	2265	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3936.2	42.63792	2	1504.627847	1504.623540	R	L	293	306
PSM	TLTIVDTGIGMTK	2266	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3900.6	41.71115	2	1524.657647	1524.654780	R	A	28	41
PSM	TSESTGSLPSPFLR	2267	sp|O95456|PSMG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3923.3	42.302	2	1557.712047	1557.707604	K	A	177	191
PSM	TQVLSPDSLFTAK	2268	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4395.3	53.63515	2	1565.684247	1565.677958	K	F	1717	1730
PSM	DSLSRYDSDGDKSDDLVVDVSNEDPATPR	2269	sp|Q04726|TLE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3787.6	38.76542	4	3246.396094	3246.383770	K	V	233	262
PSM	DNLTLWTSDSAGEECDAAEGAEN	2270	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4123.4	47.41897	3	2453.991671	2453.976507	R	-	223	246
PSM	HASSSDDFSDFSDDSDFSPSEK	2271	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3722.6	37.10785	3	2487.901271	2487.886369	R	G	129	151
PSM	FVLSSGKFYGDEEK	2272	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3698.2	36.4671	3	1684.737371	1684.738570	K	D	49	63
PSM	AAAGPLDMSLPSTPDIK	2273	sp|P17544-2|ATF7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4146.2	48.01257	3	1762.828271	1762.821254	K	I	89	106
PSM	FVCSPDEVMDTIDEGK	2274	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.4183.2	48.87612	3	1920.757571	1920.752248	R	S	172	188
PSM	GTDECAIESIAVAATPIPK	2275	sp|P53634|CATC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.4036.2	45.1677	3	2021.940671	2021.938075	R	L	444	463
PSM	ELQSAVPRDVEDVPITVE	2276	sp|Q13895|BYST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4226.2	49.98492	3	2074.99027064349	2074.98238148546	R	-	420	438
PSM	EMFPYEASTPTGISASCR	2277	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3940.4	42.74809	3	2082.850571	2082.842794	K	R	347	365
PSM	SMGTGDTPGLEVPSSPLRK	2278	sp|Q86WB0|NIPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3749.3	37.79537	3	2087.906771	2087.899989	R	A	381	400
PSM	LHIIEVGTPPTGNQPFPK	2279	sp|Q00610|CLH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4091.2	46.58058	3	2103.991571	2103.979560	K	K	228	246
PSM	TLEMNPCTPNNVEVLETR	2280	sp|P42702|LIFR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3921.5	42.25643	3	2195.968871	2195.959221	K	S	897	915
PSM	AHASPFSGALTPSAPPGPEMNR	2281	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3786.4	38.73283	3	2350.989671	2350.980699	R	S	119	141
PSM	ISPLSSPCSSPLQGTPASSLVSK	2282	sp|Q14432|PDE3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.4276.2	51.21192	3	2459.120771	2459.105625	K	I	519	542
PSM	ASYHFSPEELDENTSPLLGDAR	2283	sp|O75410|TACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4043.5	45.35867	3	2527.105571	2527.090429	K	F	262	284
PSM	NGQHVASSPIPVVISQSEIGDASR	2284	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3853.6	40.495	3	2527.219871	2527.206796	K	V	2026	2050
PSM	IADPEHDHTGFLTEYVATRWYR	2285	sp|P27361|MK03_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	15-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4070.2	46.05292	5	2836.215618	2836.204762	R	A	190	212
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	2286	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3909.6	41.94535	4	3393.361294	3393.345713	K	F	86	114
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	2287	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	24-UNIMOD:21	ms_run[1]:scan=1.1.4483.2	55.00207	4	3425.488094	3425.458138	K	-	610	647
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	2288	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4109.3	47.05637	4	3536.435294	3536.408665	R	-	207	238
PSM	IRYESLTD	2289	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0		ms_run[1]:scan=1.1.3301.2	26.19672	2	995.4906	995.4919	K	P	54	62
PSM	AAVPSGASTGIYEALELRDNDK	2290	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.4246.5	50.49527	3	2436.072971	2436.061117	R	T	33	55
PSM	DDDIAALVVDNGSGMCK	2291	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4397.5	53.68693	2	1821.7862	1820.7912	M	A	2	19
PSM	VTNGAFTGEISPGMIK	2292	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4047.5	45.46632	2	1701.777247	1700.784474	K	D	107	123
PSM	SSPNPFVGSPPK	2293	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3610.3	34.21228	2	1373.550847	1372.546550	K	G	393	405
PSM	ADLSLADALTEPSPDIEGEIKR	2294	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,10-UNIMOD:21	ms_run[1]:scan=1.1.4722.2	58.5138	3	2461.1812	2461.1622	M	D	2	24
PSM	GPPASSPAPAPKFSPVTPK	2295	sp|Q15942|ZYX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3558.5	32.86452	3	1992.918371	1991.915897	R	F	254	273
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	2296	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,3-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.3819.5	39.59822	3	2588.0572	2588.0422	M	R	2	32
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2297	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.4249.4	50.56244	3	2829.2172	2829.1962	-	Y	1	25
PSM	MEDLDQSPLVSSSDSPPRPQPAFK	2298	sp|Q9NQC3|RTN4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=1.1.4109.4	47.06303	3	2749.2532	2749.2302	-	Y	1	25
PSM	QLPLEPESPSGQVGPRPAPPQEESPSSEAK	2299	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3645.6	35.11602	4	3204.513294	3204.497618	K	S	63	93
PSM	NLNNSNLFSPVNRDSENLASPSEYPENGER	2300	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,22-UNIMOD:21	ms_run[1]:scan=1.1.4180.3	48.81015	4	3523.482494	3522.472617	K	F	604	634
PSM	PCSEETPAISPSK	2301	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	2-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3099.2	21.05738	3	1561.5787	1561.5767	M	R	2	15
PSM	TSGAPGSPQTPPERHDSGGSLPLTPR	2302	sp|Q96MH2|HEXI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,10-UNIMOD:21,24-UNIMOD:21	ms_run[1]:scan=1.1.3470.3	30.59345	4	2838.188894	2838.177635	K	M	23	49
PSM	SAMPFTASPASSTTAR	2303	sp|O00151|PDLI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3578.5	33.38777	2	1661.717047	1661.712038	R	V	123	139
PSM	GEPNVSYICSR	2304	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3355.4	27.60393	2	1360.550847	1360.548267	R	Y	273	284
PSM	IPGSPPESMGR	2305	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3284.4	25.76082	2	1206.516247	1206.510425	K	G	58	69
PSM	QREEYQPATPGLGMFVEVKDPEDK	2306	sp|Q9BVK6|TMED9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:28,9-UNIMOD:21	ms_run[1]:scan=1.1.4178.3	48.74723	4	2825.2722	2825.2612	K	V	72	96
PSM	QLIFTTEDNGKENKTPSSDAQDK	2307	sp|Q99598|TSNAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3340.4	27.2148	4	2645.192494	2645.185786	K	Q	151	174
PSM	AGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPK	2308	sp|Q9H2V7|SPNS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=1.1.4463.2	54.7305	4	3356.4962	3356.4712	M	S	2	36
PSM	MNPVYSPVQPGAPYGNPK	2309	sp|Q92567|F168A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=1.1.4018.2	44.70427	3	2036.9153	2036.9062	-	N	1	19
PSM	LFVSGACDASAK	2310	sp|P62873|GBB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3353.3	27.54822	2	1304.549847	1304.547204	R	L	198	210
PSM	SAMDSPVPASMFAPEPSSPGAAR	2311	sp|O00178|GTPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	10-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=1.1.4238.4	50.30062	3	2418.979871	2418.962665	R	A	8	31
PSM	GMGPGTPAGYGR	2312	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:35,6-UNIMOD:21	ms_run[1]:scan=1.1.3024.6	19.3137	2	1215.473047	1215.474374	R	G	682	694
PSM	KAPAGQEEPGTPPSSPLSAEQLDR	2313	sp|P13051|UNG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3475.6	30.72983	3	2541.181871	2541.174827	K	I	50	74
PSM	SDQQAQVHQLLTPASAISNK	2314	sp|Q8NDV7|TNR6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3685.6	36.14068	3	2295.037571	2295.029757	R	E	1033	1053
PSM	LQPQEISPPPTANLDRSNDK	2315	sp|Q05397|FAK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3508.3	31.56572	4	2379.050894	2379.050887	K	V	904	924
PSM	VYWDNGAQIISPHDK	2316	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3691.2	36.2838	3	1821.808571	1821.808715	K	G	176	191
PSM	LPPMPWNVPPDLSPR	2317	sp|Q9ULD8|KCNH3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=1.1.3465.2	30.46528	3	1811.858171	1810.847744	R	V	809	824
PSM	ETMTVTFAEGNSPGESITTK	2318	sp|Q8N187|CARTF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	3-UNIMOD:35	ms_run[1]:scan=1.1.3203.3	23.6953	4	2116.9682	2114.9672	K	V	511	531
PSM	DCSYGAVTSPTSTLESR	2319	sp|Q9HCD6|TANC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3636.6	34.89892	2	1909.786447	1909.776489	K	D	161	178
PSM	SSFYPDGGDQETAKTGK	2320	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3176.3	22.99623	3	1866.773171	1866.767304	R	F	319	336
PSM	VSDQNSPVLPKK	2321	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3024.3	19.3037	3	1390.688171	1390.685746	R	S	2042	2054
PSM	AAPREEPLTPR	2322	sp|O15357|SHIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3048.3	19.81827	3	1315.629371	1315.628566	R	L	950	961
PSM	SWNETLTSR	2323	sp|O75947|ATP5H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3384.3	28.35803	2	1172.489047	1172.486318	K	L	33	42
PSM	SISQSSTDSYSSAASYTDSSDDEVSPREK	2324	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	25-UNIMOD:21	ms_run[1]:scan=1.1.3392.4	28.56993	4	3165.290094	3165.278302	R	Q	66	95
PSM	SPQLSLSPRPASPK	2325	sp|O95785|WIZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=1.1.3443.2	29.89562	3	1623.744371	1623.742289	K	A	1006	1020
PSM	TLDQSPELR	2326	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	39.77153	2	1137.504047	1137.506719	R	S	1162	1171
PSM	IVSAQSLAEDDVE	2327	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3855.4	40.54095	2	1454.621647	1454.617786	R	-	133	146
PSM	TSSCSSLQREPVSTAVTSLR	2328	sp|A6NCI8|CB078_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21,4-UNIMOD:4,14-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.4073.3	46.12967	3	2406.999971	2404.973639	K	S	817	837
PSM	WPDPEDLLTPR	2329	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4289.3	51.45367	2	1417.634047	1417.627897	R	W	39	50