MTD mzTab-version 1.0 MTD mzTab-mode Complete MTD mzTab-type Identification MTD description JPST000150 -- new MTD ms_run[1]-location D:\JobRequest\ResultFiles\20220617\20220617204740166495^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_18_K4_4.pilotFin.txt MTD software[1] [MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767] MTD software[1]-setting FASTA=sprot_human_20200318.fasta MTD software[1]-setting PARAGON_VERSION=5.0.0.0, 4767 MTD software[1]-setting UI_SAMPLE_TYPE=Identification MTD software[1]-setting UI_CYS_ALKYLATION=Iodoacetamide MTD software[1]-setting UI_DIGESTION=Trypsin + Lys C MTD software[1]-setting UI_SPECIAL_FACTOR=Phosphorylation emphasis MTD software[1]-setting UI_INSTRUMENT=TripleTOF 5600 MTD software[1]-setting UI_SEARCH_EFFORT=Thorough MTD software[1]-setting UI_ID_FOCUS=Biological modifications MTD software[1]-setting UI_MIN_UNUSED_PROTSCORE=0.0458 MTD software[1]-setting MSTOLERANCE=0.05 MTD software[1]-setting MSTOLERANCE_U=Daltons MTD software[1]-setting MSMSTOLERANCE=0.1 MTD software[1]-setting MSMSTOLERANCE_U=Daltons MTD software[2] [MS, MS:1001476, X!Tandem, 2015.04.01.1] MTD software[2]-setting DB=userFasta.sprot_human_20200318 MTD software[2]-setting CLE=[RK]|{} MTD software[2]-setting MODS=Carbamidomethyl (C) MTD software[2]-setting IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y) MTD software[2]-setting TOL(-)=10 MTD software[2]-setting TOL(+)=10 MTD software[2]-setting TOLU=ppm MTD software[2]-setting ITOL=50 MTD software[2]-setting ITOLU=ppm MTD software[2]-setting PEP_ISOTOPE_ERROR=yes MTD software[2]-setting PFA=2 MTD software[3] [MS, MS:1002251, Comet, 2019.01 rev. 5] MTD software[3]-setting Taxon=userFasta.sprot_human_20200318 MTD software[3]-setting search_enzyme_number=2 MTD software[3]-setting FixMod=Carbamidomethyl (C) MTD software[3]-setting VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y) MTD software[3]-setting max_variable_mods_in_peptide=5 MTD software[3]-setting allowed_missed_cleavage=2 MTD software[3]-setting peptide_mass_tolerance=10 MTD software[3]-setting peptide_mass_units=2 MTD software[3]-setting fragment_bin_tol=0.02 MTD software[3]-setting fragment_bin_offset=0.0 MTD fixed_mod[1] [UNIMOD, UNIMOD:4, Carbamidomethyl,] MTD fixed_mod[1]-site C MTD fixed_mod[1]-position Anywhere MTD variable_mod[1] [UNIMOD, UNIMOD:35, Oxidation,] MTD variable_mod[1]-site M MTD variable_mod[1]-position Anywhere MTD variable_mod[2] [UNIMOD, UNIMOD:21, Phospho,] MTD variable_mod[2]-site S MTD variable_mod[2]-position Anywhere MTD variable_mod[3] [UNIMOD, UNIMOD:21, Phospho,] MTD variable_mod[3]-site T MTD variable_mod[3]-position Anywhere MTD variable_mod[4] [UNIMOD, UNIMOD:21, Phospho,] MTD variable_mod[4]-site Y MTD variable_mod[4]-position Anywhere MTD protein_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] MTD psm_search_engine_score[1] [http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore] PRH accession description taxid species database database_version search_engine best_search_engine_score[1] ambiguity_members modifications protein_coverage search_engine_score[1]_ms_run[1] num_psms_ms_run[1] num_peptides_distinct_ms_run[1] num_peptides_unique_ms_run[1] PRT sp|P06733|ENOA_HUMAN Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44.0 null 337-UNIMOD:4,339-UNIMOD:4 0.13 44.0 6 5 4 PRT sp|P63104|1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 43.0 null 0.10 43.0 5 1 0 PRT sp|Q9Y606|TRUA_HUMAN tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40.0 null 426-UNIMOD:21 0.04 40.0 3 1 0 PRT sp|P62258|1433E_HUMAN 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40.0 null 235-UNIMOD:35 0.12 40.0 6 2 1 PRT sp|Q9NRF9|DPOE3_HUMAN DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 null 0.18 39.0 2 1 0 PRT sp|P61981|1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 0.09 37.0 13 1 0 PRT sp|P35221|CTNA1_HUMAN Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 641-UNIMOD:21 0.02 37.0 2 1 0 PRT sp|Q58WW2|DCAF6_HUMAN DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 654-UNIMOD:21 0.03 37.0 1 1 1 PRT sp|Q9Y266|NUDC_HUMAN Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 null 145-UNIMOD:21 0.10 37.0 8 3 1 PRT sp|Q9ULX6|AKP8L_HUMAN A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 37.0 null 296-UNIMOD:4,313-UNIMOD:21,308-UNIMOD:21 0.05 37.0 2 2 2 PRT sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36.0 null 0.08 36.0 1 1 1 PRT sp|P31946|1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 null 0.14 35.0 9 2 1 PRT sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 null 0.09 34.0 5 5 5 PRT sp|P0DP23|CALM1_HUMAN Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ] 34.0 null 2-UNIMOD:1 0.29 34.0 3 3 3 PRT sp|Q9H1E3|NUCKS_HUMAN Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 null 138-UNIMOD:35 0.10 33.0 5 2 0 PRT sp|P63313|TYB10_HUMAN Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 33.0 null 2-UNIMOD:1 0.34 33.0 1 1 1 PRT sp|P07195|LDHB_HUMAN L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 0.08 32.0 2 2 2 PRT sp|Q04917|1433F_HUMAN 14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 0.08 32.0 2 1 0 PRT sp|P27348|1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 237-UNIMOD:4 0.10 32.0 2 1 0 PRT sp|O00264|PGRC1_HUMAN Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 null 57-UNIMOD:21 0.12 32.0 3 1 0 PRT sp|P04083|ANXA1_HUMAN Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.09 31.0 2 2 2 PRT sp|P33316-2|DUT_HUMAN Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 31.0 null 3-UNIMOD:4,11-UNIMOD:21 0.09 31.0 2 1 0 PRT sp|Q2TAA2|IAH1_HUMAN Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.07 31.0 1 1 1 PRT sp|Q9H3K6|BOLA2_HUMAN BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 0.20 31.0 1 1 1 PRT sp|P05187|PPB1_HUMAN Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 114-UNIMOD:21,123-UNIMOD:4 0.07 31.0 5 2 1 PRT sp|Q8WU17|RN139_HUMAN E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 663-UNIMOD:21 0.03 31.0 1 1 1 PRT sp|Q15181|IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4 0.07 31.0 1 1 1 PRT sp|P54105|ICLN_HUMAN Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 null 102-UNIMOD:21,218-UNIMOD:35 0.26 31.0 3 2 1 PRT sp|P11021|BIP_HUMAN Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 0.07 30.0 4 4 4 PRT sp|Q9UNE7|CHIP_HUMAN E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 23-UNIMOD:21 0.06 30.0 1 1 1 PRT sp|P31150|GDIA_HUMAN Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 317-UNIMOD:4 0.04 30.0 1 1 1 PRT sp|Q9UN86-2|G3BP2_HUMAN Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 227-UNIMOD:21,226-UNIMOD:21 0.05 30.0 4 1 0 PRT sp|Q15527|SURF2_HUMAN Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 null 0.09 30.0 1 1 1 PRT sp|P37802|TAGL2_HUMAN Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.06 29.0 1 1 1 PRT sp|Q6ZMR3|LDH6A_HUMAN L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 163-UNIMOD:4 0.05 29.0 1 1 1 PRT sp|P62987|RL40_HUMAN Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 0.26 29.0 3 3 3 PRT sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 290-UNIMOD:4 0.07 29.0 2 2 2 PRT sp|Q96TC7|RMD3_HUMAN Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 46-UNIMOD:21 0.04 29.0 2 1 0 PRT sp|Q5H9R7|PP6R3_HUMAN Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 null 617-UNIMOD:21 0.02 29.0 1 1 1 PRT sp|P15531|NDKA_HUMAN Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.10 28.0 1 1 1 PRT sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 1944-UNIMOD:21 0.01 28.0 1 1 1 PRT sp|Q71U36|TBA1A_HUMAN Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 null 0.13 28.0 6 4 2 PRT sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 54-UNIMOD:21,192-UNIMOD:35 0.16 27.0 4 4 4 PRT sp|P62937|PPIA_HUMAN Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 161-UNIMOD:4 0.21 27.0 4 4 4 PRT sp|Q14568|HS902_HUMAN Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.04 27.0 1 1 1 PRT sp|Q9BQA1|MEP50_HUMAN Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 186-UNIMOD:4 0.04 27.0 1 1 1 PRT sp|Q9BX95|SGPP1_HUMAN Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 112-UNIMOD:21 0.03 27.0 1 1 1 PRT sp|Q01518|CAP1_HUMAN Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 310-UNIMOD:21,308-UNIMOD:21 0.04 27.0 3 2 1 PRT sp|Q99497|PARK7_HUMAN Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 53-UNIMOD:4 0.08 27.0 1 1 1 PRT sp|P09923|PPBI_HUMAN Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 111-UNIMOD:21,120-UNIMOD:4 0.03 27.0 3 1 0 PRT sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.05 27.0 2 2 2 PRT sp|P23588|IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 0.03 27.0 1 1 1 PRT sp|Q9BRS2|RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 null 495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21 0.05 27.0 1 1 1 PRT sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 494-UNIMOD:35 0.10 26.0 8 6 4 PRT sp|Q9UGV2|NDRG3_HUMAN Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.04 26.0 1 1 1 PRT sp|Q86TC9|MYPN_HUMAN Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 928-UNIMOD:21 0.02 26.0 1 1 1 PRT sp|P31947|1433S_HUMAN 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 0.10 26.0 2 1 0 PRT sp|P29692|EF1D_HUMAN Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 147-UNIMOD:21 0.10 26.0 1 1 1 PRT sp|Q96EY7|PTCD3_HUMAN Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 null 671-UNIMOD:21,673-UNIMOD:21 0.04 26.0 2 1 0 PRT sp|P04183|KITH_HUMAN Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 26.0 null 2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21 0.07 26.0 1 1 1 PRT sp|P0DME0|SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.08 25.0 2 2 2 PRT sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.03 25.0 1 1 1 PRT sp|P06748|NPM_HUMAN Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 104-UNIMOD:4,125-UNIMOD:21 0.29 25.0 3 3 3 PRT sp|P07737|PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 0.21 25.0 2 2 2 PRT sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ] 25.0 null 1043-UNIMOD:21,534-UNIMOD:21,536-UNIMOD:21,1003-UNIMOD:21,2104-UNIMOD:21,2102-UNIMOD:21 0.02 25.0 5 4 3 PRT sp|P46108|CRK_HUMAN Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 41-UNIMOD:21,43-UNIMOD:21 0.06 25.0 2 1 0 PRT sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 136-UNIMOD:21 0.03 25.0 2 1 0 PRT sp|A2RRP1|NBAS_HUMAN Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 null 473-UNIMOD:21 0.01 25.0 1 1 1 PRT sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 25.0 null 2-UNIMOD:1,17-UNIMOD:4 0.05 25.0 1 1 1 PRT sp|P14618|KPYM_HUMAN Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 37-UNIMOD:21 0.05 24.0 2 2 2 PRT sp|P02786|TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.04 24.0 2 2 2 PRT sp|P10599|THIO_HUMAN Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.13 24.0 1 1 1 PRT sp|Q15388|TOM20_HUMAN Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.10 24.0 1 1 1 PRT sp|Q9UPR0|PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 576-UNIMOD:4,584-UNIMOD:21,592-UNIMOD:35 0.02 24.0 3 2 1 PRT sp|P16949|STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 38-UNIMOD:21 0.16 24.0 6 3 1 PRT sp|P60174|TPIS_HUMAN Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.05 24.0 1 1 1 PRT sp|Q13263|TIF1B_HUMAN Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|P25205|MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 0.02 24.0 1 1 1 PRT sp|P27816|MAP4_HUMAN Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 521-UNIMOD:21,280-UNIMOD:21 0.03 24.0 2 2 2 PRT sp|P29966|MARCS_HUMAN Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 26-UNIMOD:21 0.06 24.0 1 1 1 PRT sp|P62633-4|CNBP_HUMAN Isoform 4 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 67-UNIMOD:4,75-UNIMOD:4,78-UNIMOD:4 0.09 24.0 1 1 1 PRT sp|O95218|ZRAB2_HUMAN Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 null 153-UNIMOD:21 0.06 24.0 1 1 1 PRT sp|P07355|ANXA2_HUMAN Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 335-UNIMOD:4 0.07 23.0 3 2 1 PRT sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.11 23.0 4 4 4 PRT sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 15-UNIMOD:21 0.04 23.0 1 1 1 PRT sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.01 23.0 1 1 1 PRT sp|Q9H7D7|WDR26_HUMAN WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 121-UNIMOD:21 0.02 23.0 1 1 1 PRT sp|Q9UPN3|MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 4521-UNIMOD:21 0.00 23.0 1 1 1 PRT sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.06 23.0 3 3 3 PRT sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.06 23.0 1 1 1 PRT sp|P54652|HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|P30086|PEBP1_HUMAN Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 51-UNIMOD:21 0.09 23.0 1 1 1 PRT sp|O60841|IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 186-UNIMOD:21,183-UNIMOD:21 0.02 23.0 2 2 2 PRT sp|P08195|4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 0.03 23.0 1 1 1 PRT sp|P17096|HMGA1_HUMAN High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 103-UNIMOD:21 0.19 23.0 2 1 0 PRT sp|Q13098|CSN1_HUMAN COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 474-UNIMOD:21 0.05 23.0 1 1 1 PRT sp|Q9C0C9|UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 87-UNIMOD:21,101-UNIMOD:4 0.03 23.0 1 1 1 PRT sp|P62328|TYB4_HUMAN Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1 0.34 23.0 1 1 1 PRT sp|O43865|SAHH2_HUMAN S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 null 64-UNIMOD:21,68-UNIMOD:21 0.06 23.0 1 1 1 PRT sp|P06454|PTMA_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 null 2-UNIMOD:1 0.14 23.0 1 1 1 PRT sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P62826|RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.06 22.0 1 1 1 PRT sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 249-UNIMOD:21 0.03 22.0 1 1 1 PRT sp|P09382|LEG1_HUMAN Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.08 22.0 1 1 1 PRT sp|P08758|ANXA5_HUMAN Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 316-UNIMOD:4 0.03 22.0 1 1 1 PRT sp|P00338|LDHA_HUMAN L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.17 22.0 5 5 5 PRT sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.09 22.0 2 2 2 PRT sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.01 22.0 1 1 1 PRT sp|P23528|COF1_HUMAN Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,3-UNIMOD:21 0.15 22.0 2 2 2 PRT sp|Q16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P55084|ECHB_HUMAN Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.03 22.0 1 1 1 PRT sp|P0DMV8|HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.05 22.0 2 2 2 PRT sp|P08670|VIME_HUMAN Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 0.04 22.0 1 1 1 PRT sp|Q9UH62|ARMX3_HUMAN Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 61-UNIMOD:21 0.04 22.0 1 1 1 PRT sp|O00180|KCNK1_HUMAN Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 329-UNIMOD:4 0.06 22.0 1 1 1 PRT sp|Q9NPQ8|RIC8A_HUMAN Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 441-UNIMOD:21 0.05 22.0 1 1 1 PRT sp|Q8NCF5|NF2IP_HUMAN NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 null 369-UNIMOD:21 0.04 22.0 1 1 1 PRT sp|P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,3-UNIMOD:21 0.03 22.0 1 1 1 PRT sp|O60762|DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 null 2-UNIMOD:1,9-UNIMOD:21 0.04 22.0 1 1 1 PRT sp|Q99613|EIF3C_HUMAN Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P62899|RL31_HUMAN 60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.09 21.0 1 1 1 PRT sp|Q13627|DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 321-UNIMOD:21 0.01 21.0 1 1 1 PRT sp|P39023|RL3_HUMAN 60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P18206|VINC_HUMAN Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 721-UNIMOD:21 0.01 21.0 1 1 1 PRT sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.03 21.0 1 1 1 PRT sp|P48643|TCPE_HUMAN T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.02 21.0 1 1 1 PRT sp|P63220|RS21_HUMAN 40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 0.18 21.0 1 1 1 PRT sp|P60842|IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 306-UNIMOD:35 0.06 21.0 3 2 1 PRT sp|Q9Y478|AAKB1_HUMAN 5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 173-UNIMOD:4,182-UNIMOD:21,194-UNIMOD:4 0.10 21.0 1 1 1 PRT sp|Q99460|PSMD1_HUMAN 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 270-UNIMOD:21 0.04 21.0 2 2 2 PRT sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 null 260-UNIMOD:21,262-UNIMOD:21 0.04 21.0 2 1 0 PRT sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 2 2 2 PRT sp|P18669|PGAM1_HUMAN Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 14-UNIMOD:21 0.05 20.0 1 1 1 PRT sp|Q14192|FHL2_HUMAN Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 150-UNIMOD:4,153-UNIMOD:4 0.05 20.0 1 1 1 PRT sp|P31949|S10AB_HUMAN Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.10 20.0 1 1 1 PRT sp|Q16719|KYNU_HUMAN Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.04 20.0 2 2 2 PRT sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 2 2 2 PRT sp|P04792|HSPB1_HUMAN Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ] 20.0 null 82-UNIMOD:21,78-UNIMOD:21,80-UNIMOD:28 0.07 20.0 3 2 1 PRT sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.02 20.0 2 2 2 PRT sp|Q9GZT3|SLIRP_HUMAN SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 15-UNIMOD:21 0.10 20.0 1 1 1 PRT sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.03 20.0 2 2 2 PRT sp|P98082|DAB2_HUMAN Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 401-UNIMOD:21 0.02 20.0 2 1 0 PRT sp|P11142|HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 549-UNIMOD:35 0.08 20.0 5 4 3 PRT sp|P30041|PRDX6_HUMAN Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 47-UNIMOD:4,91-UNIMOD:4 0.16 20.0 3 3 3 PRT sp|P21796|VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 104-UNIMOD:21 0.12 20.0 3 3 3 PRT sp|Q9HB90|RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 95-UNIMOD:21 0.04 20.0 1 1 1 PRT sp|O95297|MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 203-UNIMOD:4,210-UNIMOD:21 0.06 20.0 1 1 1 PRT sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 417-UNIMOD:4,420-UNIMOD:4 0.04 20.0 2 2 2 PRT sp|P06753|TPM3_HUMAN Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.06 20.0 1 1 1 PRT sp|P62070|RRAS2_HUMAN Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 183-UNIMOD:4,186-UNIMOD:21 0.08 20.0 1 1 1 PRT sp|P43487|RANG_HUMAN Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 null 0.17 20.0 1 1 1 PRT sp|P13639|EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 591-UNIMOD:4,595-UNIMOD:21 0.03 19.0 2 2 2 PRT sp|O43852|CALU_HUMAN Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.04 19.0 1 1 1 PRT sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 207-UNIMOD:21,212-UNIMOD:4 0.00 19.0 2 1 0 PRT sp|P42704|LPPRC_HUMAN Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P62269|RS18_HUMAN 40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.09 19.0 1 1 1 PRT sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.01 19.0 1 1 1 PRT sp|P52907|CAZA1_HUMAN F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 0.06 19.0 1 1 1 PRT sp|Q8TEM1|PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 null 1877-UNIMOD:21 0.01 19.0 2 1 0 PRT sp|P62273|RS29_HUMAN 40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.16 18.0 1 1 1 PRT sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 2047-UNIMOD:21 0.00 18.0 1 1 1 PRT sp|P24752|THIL_HUMAN Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q15052|ARHG6_HUMAN Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 488-UNIMOD:21,487-UNIMOD:35 0.01 18.0 2 1 0 PRT sp|Q09666|AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 177-UNIMOD:21 0.00 18.0 1 1 1 PRT sp|P63244|RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.04 18.0 1 1 1 PRT sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 808-UNIMOD:21 0.03 18.0 1 1 1 PRT sp|P36507|MP2K2_HUMAN Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 394-UNIMOD:21 0.04 18.0 2 2 2 PRT sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 234-UNIMOD:4 0.03 18.0 3 2 1 PRT sp|Q13885|TBB2A_HUMAN Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 330-UNIMOD:35 0.03 18.0 1 1 1 PRT sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 608-UNIMOD:4,612-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q14974|IMB1_HUMAN Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 345-UNIMOD:4 0.02 18.0 1 1 1 PRT sp|Q5VSL9|STRP1_HUMAN Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 335-UNIMOD:21,339-UNIMOD:21 0.02 18.0 2 1 0 PRT sp|Q13200|PSMD2_HUMAN 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 0.02 18.0 1 1 1 PRT sp|Q13442|HAP28_HUMAN 28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 60-UNIMOD:21 0.10 18.0 1 1 1 PRT sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 186-UNIMOD:35,190-UNIMOD:21,193-UNIMOD:21 0.03 18.0 1 1 1 PRT sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 null 60-UNIMOD:35,64-UNIMOD:21 0.04 18.0 1 1 1 PRT sp|Q7L2H7|EIF3M_HUMAN Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|P23381|SYWC_HUMAN Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 467-UNIMOD:21,225-UNIMOD:4 0.04 17.0 2 2 2 PRT sp|Q15185|TEBP_HUMAN Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|P40939|ECHA_HUMAN Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.01 17.0 1 1 1 PRT sp|P07602|SAP_HUMAN Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 409-UNIMOD:4,412-UNIMOD:4 0.02 17.0 1 1 1 PRT sp|O43324|MCA3_HUMAN Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.06 17.0 1 1 1 PRT sp|Q8WUM9|S20A1_HUMAN Sodium-dependent phosphate transporter 1 OS=Homo sapiens OX=9606 GN=SLC20A1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 264-UNIMOD:4,265-UNIMOD:21,269-UNIMOD:21 0.02 17.0 1 1 1 PRT sp|P12277|KCRB_HUMAN Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.03 17.0 1 1 1 PRT sp|P38646|GRP75_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 608-UNIMOD:4 0.02 17.0 1 1 1 PRT sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 460-UNIMOD:21 0.02 17.0 1 1 1 PRT sp|Q96BD0|SO4A1_HUMAN Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 40-UNIMOD:21 0.02 17.0 1 1 1 PRT sp|O00299|CLIC1_HUMAN Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.05 17.0 1 1 1 PRT sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 279-UNIMOD:21,281-UNIMOD:4 0.03 17.0 4 2 1 PRT sp|Q14157|UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 68-UNIMOD:4,75-UNIMOD:4 0.02 17.0 1 1 1 PRT sp|P18858|DNLI1_HUMAN DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 183-UNIMOD:21 0.03 17.0 1 1 1 PRT sp|P46109|CRKL_HUMAN Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 43-UNIMOD:21,44-UNIMOD:4 0.06 17.0 1 1 1 PRT sp|Q9BQE3|TBA1C_HUMAN Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 0.04 17.0 1 1 1 PRT sp|Q96SB4|SRPK1_HUMAN SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 null 51-UNIMOD:21,63-UNIMOD:4 0.05 17.0 1 1 1 PRT sp|P56537|IF6_HUMAN Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.04 16.0 1 1 1 PRT sp|Q06830|PRDX1_HUMAN Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 1 1 1 PRT sp|Q99471|PFD5_HUMAN Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 49-UNIMOD:4 0.06 16.0 1 1 1 PRT sp|P50990|TCPQ_HUMAN T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.02 16.0 2 1 0 PRT sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 1 1 1 PRT sp|P07437|TBB5_HUMAN Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.03 16.0 1 1 1 PRT sp|Q08J23|NSUN2_HUMAN RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 599-UNIMOD:4 0.02 16.0 1 1 1 PRT sp|P45880|VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 115-UNIMOD:21 0.05 16.0 1 1 1 PRT sp|P25788|PSA3_HUMAN Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.06 16.0 1 1 1 PRT sp|P34932|HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 0.05 16.0 2 2 2 PRT sp|Q8NHM5|KDM2B_HUMAN Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 null 221-UNIMOD:35,223-UNIMOD:21 0.01 16.0 1 1 1 PRT sp|P04075|ALDOA_HUMAN Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 36-UNIMOD:21,39-UNIMOD:21 0.04 15.0 2 1 0 PRT sp|P30048|PRDX3_HUMAN Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P39687|AN32A_HUMAN Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.04 15.0 1 1 1 PRT sp|P62249|RS16_HUMAN 40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.06 15.0 1 1 1 PRT sp|P55060|XPO2_HUMAN Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|O60361|NDK8_HUMAN Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 130-UNIMOD:4 0.07 15.0 1 1 1 PRT sp|Q7Z6Z7|HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 2889-UNIMOD:21 0.00 15.0 1 1 1 PRT sp|P55786|PSA_HUMAN Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.01 15.0 1 1 1 PRT sp|Q6DD88|ATLA3_HUMAN Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|Q5JRA6|TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 1745-UNIMOD:21 0.01 15.0 1 1 1 PRT sp|P49915|GUAA_HUMAN GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 332-UNIMOD:21 0.02 15.0 1 1 1 PRT sp|P42677|RS27_HUMAN 40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 11-UNIMOD:21 0.14 15.0 1 1 1 PRT sp|O75534|CSDE1_HUMAN Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 0.02 15.0 1 1 1 PRT sp|P17812|PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 null 559-UNIMOD:4,562-UNIMOD:21 0.02 15.0 1 1 1 PRT sp|O14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 361-UNIMOD:21 0.02 14.0 1 1 1 PRT sp|Q9Y536|PAL4A_HUMAN Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|P00558|PGK1_HUMAN Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 99-UNIMOD:4 0.02 14.0 1 1 1 PRT sp|P50991|TCPD_HUMAN T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 337-UNIMOD:4 0.02 14.0 1 1 1 PRT sp|P17987|TCPA_HUMAN T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.03 14.0 1 1 1 PRT sp|P25786|PSA1_HUMAN Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.06 14.0 1 1 1 PRT sp|Q9HAV7|GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.08 14.0 1 1 1 PRT sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.05 14.0 1 1 1 PRT sp|P05386|RLA1_HUMAN 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 0.16 14.0 1 1 1 PRT sp|P26358|DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 714-UNIMOD:21 0.01 14.0 1 1 1 PRT sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1 null null userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 null 164-UNIMOD:21 0.05 14.0 1 1 1 PSH sequence PSM_ID accession unique database database_version search_engine search_engine_score[1] modifications spectra_ref retention_time charge exp_mass_to_charge calc_mass_to_charge pre post start end PSM DATNVGDEGGFAPNILENK 1 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 44.0 ms_run[1]:scan=1.1.4351.2 42.94372 3 1959.925871 1959.917400 K E 203 222 PSM DNLTLWTSDTQGDEAEAGEGGEN 2 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 43.0 ms_run[1]:scan=1.1.4542.3 46.07092 3 2408.000171 2407.988786 R - 223 246 PSM VPSPLEGSEGDGDTD 3 sp|Q9Y606|TRUA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40.0 14-UNIMOD:21 ms_run[1]:scan=1.1.3683.3 31.64337 2 1553.582447 1553.577043 K - 413 428 PSM DNLTLWTSDMQGDGEEQNK 4 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 40.0 ms_run[1]:scan=1.1.4404.2 43.64275 3 2179.942571 2179.932792 R E 226 245 PSM DNLTLWTSDMQGDGEEQNK 5 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 ms_run[1]:scan=1.1.4388.2 43.45218 3 2179.942571 2179.932792 R E 226 245 PSM SRDEDNDEDEERLEEEEQNEEEEVDN 6 sp|Q9NRF9|DPOE3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 39.0 ms_run[1]:scan=1.1.3661.3 31.2939 4 3223.246894 3223.230486 K - 122 148 PSM DNLTLWTSDQQDDDGGEGNN 7 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 ms_run[1]:scan=1.1.4450.2 44.3956 3 2192.882171 2192.873028 R - 228 248 PSM TPEELDDSDFETEDFDVR 8 sp|P35221|CTNA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 8-UNIMOD:21 ms_run[1]:scan=1.1.4675.2 47.43372 3 2237.864771 2237.852550 R S 634 652 PSM DSALQDTDDSDDDPVLIPGAR 9 sp|Q58WW2|DCAF6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 7-UNIMOD:21 ms_run[1]:scan=1.1.4515.2 45.63498 3 2293.970471 2293.958746 R Y 648 669 PSM NGSLDSPGKQDTEEDEEEDEK 10 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 12-UNIMOD:21 ms_run[1]:scan=1.1.2968.2 18.946 3 2429.930471 2429.923149 K D 134 155 PSM TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK 11 sp|Q9ULX6|AKP8L_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 37.0 3-UNIMOD:4,20-UNIMOD:21 ms_run[1]:scan=1.1.3656.2 31.15538 4 3340.230094 3340.220589 R G 294 325 PSM KVEEEQEADEEDVSEEEAESK 12 sp|Q9H3N1|TMX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 36.0 ms_run[1]:scan=1.1.3204.2 22.02297 3 2437.018271 2437.013998 K E 234 255 PSM DNLTLWTSDQQDDDGGEGNN 13 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 ms_run[1]:scan=1.1.4492.2 45.23928 3 2192.882471 2192.873028 R - 228 248 PSM DNLTLWTSENQGDEGDAGEGEN 14 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 35.0 ms_run[1]:scan=1.1.4457.2 44.57202 3 2349.958271 2349.946922 R - 225 247 PSM DATNVGDEGGFAPNILENK 15 sp|P06733|ENOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 ms_run[1]:scan=1.1.4339.2 42.72443 3 1959.925871 1959.917400 K E 203 222 PSM TPEELDDSDFETEDFDVR 16 sp|P35221|CTNA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 8-UNIMOD:21 ms_run[1]:scan=1.1.4649.2 47.22798 3 2237.864771 2237.852550 R S 634 652 PSM DNLTLWTSENQGDEGDAGEGEN 17 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 ms_run[1]:scan=1.1.4448.3 44.35102 3 2349.958271 2349.946922 R - 225 247 PSM GVVDSEDLPLNISR 18 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 34.0 ms_run[1]:scan=1.1.4234.2 41.19027 2 1512.780447 1512.778387 R E 387 401 PSM ADQLTEEQIAEFK 19 sp|P0DP23|CALM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 34.0 1-UNIMOD:1 ms_run[1]:scan=1.1.4566.2 46.42605 2 1562.7572 1562.7462 M E 2 15 PSM DSGSDEDFLMEDDDDSDYGSSK 20 sp|Q9H1E3|NUCKS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 33.0 ms_run[1]:scan=1.1.4140.2 39.56161 3 2427.875171 2427.865619 K K 129 151 PSM ADKPDMGEIASFDK 21 sp|P63313|TYB10_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 33.0 1-UNIMOD:1 ms_run[1]:scan=1.1.4051.2 38.14642 2 1564.7113 1564.7074 M A 2 16 PSM LIAPVAEEEATVPNNK 22 sp|P07195|LDHB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 ms_run[1]:scan=1.1.3710.2 32.137 3 1693.889471 1693.888666 K I 8 24 PSM DNLTLWTSDQQDEEAGEGN 23 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 ms_run[1]:scan=1.1.4486.2 45.07852 3 2120.884571 2120.877051 R - 228 247 PSM DNLTLWTSDQQDDDGGEGNN 24 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 ms_run[1]:scan=1.1.4484.2 45.0377 3 2192.882471 2192.873028 R - 228 248 PSM DNLTLWTSENQGDEGDAGEGEN 25 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 ms_run[1]:scan=1.1.4440.2 44.1594 3 2349.958271 2349.946922 R - 225 247 PSM DNLTLWTSDSAGEECDAAEGAEN 26 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 15-UNIMOD:4 ms_run[1]:scan=1.1.4617.3 46.98326 3 2453.991071 2453.976507 R - 223 246 PSM IVRGDQPAASGDSDDDEPPPLPR 27 sp|O00264|PGRC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 32.0 13-UNIMOD:21 ms_run[1]:scan=1.1.3546.3 29.03195 3 2483.103971 2483.096577 K L 45 68 PSM GDRSEDFGVNEDLADSDAR 28 sp|P04083|ANXA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 ms_run[1]:scan=1.1.3634.2 30.84137 3 2066.884571 2066.877720 K A 186 205 PSM PCSEETPAISPSK 29 sp|P33316-2|DUT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 31.0 2-UNIMOD:4,10-UNIMOD:21 ms_run[1]:scan=1.1.3192.2 21.83345 2 1481.6131 1481.6104 M R 2 15 PSM DVAEAKPELSLLGDGDH 30 sp|Q2TAA2|IAH1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 ms_run[1]:scan=1.1.4112.2 39.2085 3 1764.855671 1764.853008 R - 232 249 PSM DLEAEHVEVEDTTLNR 31 sp|Q9H3K6|BOLA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 ms_run[1]:scan=1.1.3709.2 32.10145 3 1868.876771 1868.875201 R C 15 31 PSM DGARPDVTESESGSPEYR 32 sp|P05187|PPB1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 ms_run[1]:scan=1.1.3198.2 21.92863 3 1950.864971 1950.855528 K Q 425 443 PSM NGVIQHTGAAAEEFNDDTD 33 sp|Q8WU17|RN139_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 18-UNIMOD:21 ms_run[1]:scan=1.1.3612.3 30.37003 3 2082.822071 2082.816773 R - 646 665 PSM HTGCCGDNDPIDVCEIGSK 34 sp|Q15181|IPYR_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4 ms_run[1]:scan=1.1.3562.2 29.34285 3 2132.865071 2132.856139 K V 110 129 PSM DNLTLWTSDQQDDDGGEGNN 35 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 ms_run[1]:scan=1.1.4460.2 44.6253 3 2192.882171 2192.873028 R - 228 248 PSM DNLTLWTSDQQDDDGGEGNN 36 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 ms_run[1]:scan=1.1.4503.2 45.44238 3 2192.882471 2192.873028 R - 228 248 PSM DNLTLWTSDMQGDGEEQNK 37 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 10-UNIMOD:35 ms_run[1]:scan=1.1.4029.3 37.69842 3 2195.932871 2195.927707 R E 226 245 PSM FEEESKEPVADEEEEDSDDDVEPITEFR 38 sp|P54105|ICLN_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 31.0 17-UNIMOD:21 ms_run[1]:scan=1.1.4282.3 41.8521 4 3393.359294 3393.345713 K F 86 114 PSM VEIIANDQGNR 39 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 ms_run[1]:scan=1.1.3225.3 22.49405 2 1227.622047 1227.620764 R I 50 61 PSM VPSPLEGSEGDGDTD 40 sp|Q9Y606|TRUA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 14-UNIMOD:21 ms_run[1]:scan=1.1.3670.3 31.44063 2 1553.582447 1553.577043 K - 413 428 PSM LGAGGGSPEKSPSAQELK 41 sp|Q9UNE7|CHIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 11-UNIMOD:21 ms_run[1]:scan=1.1.3183.2 21.6625 3 1791.846371 1791.840409 R E 13 31 PSM NTNDANSCQIIIPQNQVNR 42 sp|P31150|GDIA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 8-UNIMOD:4 ms_run[1]:scan=1.1.3629.2 30.71363 3 2198.055071 2198.049828 K K 310 329 PSM STTPPPAEPVSLPQEPPKPR 43 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3706.2 32.03485 3 2204.094671 2204.087850 K V 225 245 PSM DLGSTEDGDGTDDFLTDKEDEK 44 sp|Q15527|SURF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 ms_run[1]:scan=1.1.3829.2 34.48095 3 2401.005371 2400.992869 K A 180 202 PSM DNLTLWTSDSAGEECDAAEGAEN 45 sp|P27348|1433T_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 30.0 15-UNIMOD:4 ms_run[1]:scan=1.1.4594.2 46.77785 3 2453.991071 2453.976507 R - 223 246 PSM NFSDNQLQEGK 46 sp|P37802|TAGL2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 ms_run[1]:scan=1.1.3222.3 22.4187 2 1278.586247 1278.584044 R N 161 172 PSM NRVIGSGCNLDSAR 47 sp|Q6ZMR3|LDH6A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 8-UNIMOD:4 ms_run[1]:scan=1.1.3153.2 21.19822 3 1517.737571 1517.736873 K F 156 170 PSM NQLTSNPENTVFDAK 48 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 ms_run[1]:scan=1.1.3716.2 32.29053 3 1676.802071 1676.800579 K R 82 97 PSM TITLEVEPSDTIENVK 49 sp|P62987|RL40_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 ms_run[1]:scan=1.1.4195.2 40.39186 3 1786.923971 1786.920025 K A 12 28 PSM DKPHVNVGTIGHVDHGK 50 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 ms_run[1]:scan=1.1.3193.2 21.85848 4 1808.926494 1808.928179 R T 54 71 PSM SQSLPNSLDYTQTSDPGR 51 sp|Q96TC7|RMD3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3836.2 34.61293 3 2044.877471 2044.873894 R H 44 62 PSM DNLTLWTSDMQGDGEEQNK 52 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 10-UNIMOD:35 ms_run[1]:scan=1.1.4042.2 37.9183 3 2195.932871 2195.927707 R E 226 245 PSM ERIQQFDDGGSDEEDIWEEK 53 sp|Q5H9R7|PP6R3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 29.0 11-UNIMOD:21 ms_run[1]:scan=1.1.4182.2 40.23642 3 2504.017871 2504.001674 K H 607 627 PSM EALQDVEDENQ 54 sp|P62258|1433E_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 ms_run[1]:scan=1.1.3382.3 25.47027 2 1288.543447 1288.541905 K - 245 256 PSM NIIHGSDSVESAEK 55 sp|P15531|NDKA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 ms_run[1]:scan=1.1.3136.2 20.91118 3 1484.707271 1484.710701 R E 115 129 PSM LAELPAAAQPSAEDSDTEDDSEAEQTER 56 sp|O95714|HERC2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 17-UNIMOD:21 ms_run[1]:scan=1.1.3798.3 33.96805 4 3054.255694 3054.246274 K N 1928 1956 PSM NPDDITNEEYGEFYK 57 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 ms_run[1]:scan=1.1.3989.2 37.10548 3 1832.775971 1832.774089 R S 300 315 PSM DNLTLWTSDQQDDDGGEGNN 58 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 ms_run[1]:scan=1.1.4475.2 44.8185 3 2192.882171 2192.873028 R - 228 248 PSM DYEEVGVDSVEGEGEEEGEEY 59 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 ms_run[1]:scan=1.1.4310.2 42.32022 3 2347.906571 2347.897571 K - 431 452 PSM DNLTLWTSENQGDEGDAGEGEN 60 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 28.0 ms_run[1]:scan=1.1.4501.2 45.3913 3 2349.958271 2349.946922 R - 225 247 PSM HQGVMVGMGQKDSYVGDEAQSK 61 sp|P62736|ACTA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 13-UNIMOD:21 ms_run[1]:scan=1.1.3450.4 26.93133 4 2430.042094 2430.034511 R R 42 64 PSM KITIADCGQLE 62 sp|P62937|PPIA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 7-UNIMOD:4 ms_run[1]:scan=1.1.3572.2 29.59375 2 1246.624047 1246.622738 K - 155 166 PSM EGMNIVEAMER 63 sp|P62937|PPIA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4155.2 39.87568 2 1277.576447 1277.574407 K F 134 145 PSM ELISNSSDALDK 64 sp|Q14568|HS902_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.3436.3 26.60965 2 1290.629047 1290.630326 R I 47 59 PSM DSVFLSCSEDNR 65 sp|Q9BQA1|MEP50_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 7-UNIMOD:4 ms_run[1]:scan=1.1.3584.2 29.8073 2 1427.600647 1427.598708 K I 180 192 PSM RNSLTGEEGQLAR 66 sp|Q9BX95|SGPP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3304.4 23.72947 3 1509.696971 1509.693685 R V 110 123 PSM PFSAPKPQTSPSPK 67 sp|Q01518|CAP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 12-UNIMOD:21 ms_run[1]:scan=1.1.3238.3 22.67083 3 1547.741171 1547.738510 K R 299 313 PSM DVVICPDASLEDAKK 68 sp|Q99497|PARK7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 5-UNIMOD:4 ms_run[1]:scan=1.1.3658.2 31.21683 3 1658.822471 1658.818537 R E 49 64 PSM HVPDSGATATAYLCGVK 69 sp|P05187|PPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.3811.2 34.21455 3 1825.809071 1825.807001 K G 110 127 PSM HVPDSGATATAYLCGVK 70 sp|P05187|PPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.3800.2 34.01898 3 1825.809071 1825.807001 K G 110 127 PSM QVPDSAATATAYLCGVK 71 sp|P09923|PPBI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.4259.2 41.5496 3 1830.824171 1830.822317 R A 107 124 PSM VVVAENFDEIVNNENK 72 sp|P30101|PDIA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4199.2 40.48378 3 1831.900571 1831.895208 K D 380 396 PSM DKGDEEEEGEEKLEEK 73 sp|P27824|CALX_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.3073.2 20.04065 4 1891.819294 1891.817077 K Q 536 552 PSM YAALSVDGEDENEGEDYAE 74 sp|P23588|IF4B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.3963.2 36.70005 3 2074.817471 2074.812719 K - 593 612 PSM DNLTLWTSDMQGDGEEQNK 75 sp|P62258|1433E_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4426.2 43.998 3 2179.938371 2179.932792 R E 226 245 PSM DNLTLWTSDQQDDDGGEGNN 76 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4441.3 44.18472 3 2192.882171 2192.873028 R - 228 248 PSM DNLTLWTSENQGDEGDAGEGEN 77 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4680.2 47.48465 3 2349.959471 2349.946922 R - 225 247 PSM DNLTLWTSDTQGDEAEAGEGGEN 78 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4571.2 46.4966 3 2408.000171 2407.988786 R - 223 246 PSM DNLTLWTSDTQGDEAEAGEGGEN 79 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 ms_run[1]:scan=1.1.4554.2 46.27345 3 2408.000171 2407.988786 R - 223 246 PSM TCSDSEDIGSSECSDTDSEEQGDHARPK 80 sp|Q9BRS2|RIOK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21 ms_run[1]:scan=1.1.2943.2 18.68097 4 3178.171694 3178.161241 R K 494 522 PSM TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH 81 sp|P54105|ICLN_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 27.0 12-UNIMOD:35 ms_run[1]:scan=1.1.4248.2 41.43192 4 3472.452894 3472.437249 R - 207 238 PSM SADTLWDIQK 82 sp|P07195|LDHB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.3932.2 36.33555 2 1175.584047 1175.582253 K D 320 330 PSM EGLELPEDEEEK 83 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.3623.2 30.57825 2 1415.634047 1415.630385 K K 412 424 PSM VPSPLEGSEGDGDTD 84 sp|Q9Y606|TRUA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 14-UNIMOD:21 ms_run[1]:scan=1.1.3694.3 31.85142 2 1553.582447 1553.577043 K - 413 428 PSM DLEIERPILGQNDNK 85 sp|Q9UGV2|NDRG3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.3876.2 35.44328 3 1752.900671 1752.900627 R S 234 249 PSM QVPDSAATATAYLCGVK 86 sp|P09923|PPBI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.4243.2 41.36133 3 1830.824171 1830.822317 R A 107 124 PSM ESEDKPEIEDVGSDEEEEK 87 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.3332.2 24.2819 3 2191.920071 2191.912828 K K 251 270 PSM DNLTLWTSDQQDDDGGEGNN 88 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.4516.2 45.6602 3 2192.882471 2192.873028 R - 228 248 PSM TPVDESDDEIQHDEIPTGK 89 sp|Q86TC9|MYPN_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3563.2 29.37197 3 2203.922771 2203.915819 R C 923 942 PSM DYEEVGVDSVEGEGEEEGEEY 90 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.4326.2 42.52202 3 2347.906571 2347.897571 K - 431 452 PSM DNLTLWTADNAGEEGGEAPQEPQS 91 sp|P31947|1433S_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 ms_run[1]:scan=1.1.4593.2 46.75248 3 2528.107271 2528.093920 R - 225 249 PSM NGSLDSPGKQDTEEDEEEDEKDK 92 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 12-UNIMOD:21 ms_run[1]:scan=1.1.2896.3 18.11122 4 2673.047694 2673.045055 K G 134 157 PSM KPATPAEDDEDDDIDLFGSDNEEEDK 93 sp|P29692|EF1D_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 4-UNIMOD:21 ms_run[1]:scan=1.1.4147.3 39.71338 3 2988.166871 2988.155727 K E 144 170 PSM EALSNLTALTSDSDTDSSSDSDSDTSEGK 94 sp|Q96EY7|PTCD3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 11-UNIMOD:21 ms_run[1]:scan=1.1.4312.4 42.37063 3 3014.204171 3014.188484 K - 661 690 PSM FEEESKEPVADEEEEDSDDDVEPITEFR 95 sp|P54105|ICLN_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 26.0 17-UNIMOD:21 ms_run[1]:scan=1.1.4263.3 41.6454 4 3393.359294 3393.345713 K F 86 114 PSM SCINLPTVLPGSPSK 96 sp|P04183|KITH_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 26.0 1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21 ms_run[1]:scan=1.1.5573.2 54.72313 3 1690.8040 1690.7996 M T 2 17 PSM STTPPPAEPVSLPQEPPKPR 97 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 2-UNIMOD:21 ms_run[1]:scan=1.1.3714.2 32.23948 4 2204.089694 2204.087850 K V 225 245 PSM VEVTEFEDIK 98 sp|P0DME0|SETLP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 ms_run[1]:scan=1.1.3901.2 35.80143 2 1207.595847 1207.597235 K S 133 143 PSM IVRGDQPAASGDSDDDEPPPLPR 99 sp|O00264|PGRC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 13-UNIMOD:21 ms_run[1]:scan=1.1.3556.2 29.19188 4 2483.103294 2483.096577 K L 45 68 PSM DVIELTDDSFDK 100 sp|Q15084|PDIA6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 ms_run[1]:scan=1.1.4262.2 41.62025 2 1395.643847 1395.640556 K N 161 173 PSM CGSGPVHISGQHLVAVEEDAESEDEEEEDVK 101 sp|P06748|NPM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 1-UNIMOD:4,22-UNIMOD:21 ms_run[1]:scan=1.1.3879.2 35.50023 4 3459.449294 3459.429735 K L 104 135 PSM DRSSFYVNGLTLGGQK 102 sp|P07737|PROF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 ms_run[1]:scan=1.1.4050.2 38.11115 3 1740.881171 1740.879498 K C 55 71 PSM HVPDSGATATAYLCGVK 103 sp|P05187|PPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.3827.2 34.4165 3 1825.809071 1825.807001 K G 110 127 PSM QVPDSAATATAYLCGVK 104 sp|P09923|PPBI_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.4272.2 41.76357 3 1830.824171 1830.822317 R A 107 124 PSM SSTPPGESYFGVSSLQLK 105 sp|Q9UQ35|SRRM2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 3-UNIMOD:21 ms_run[1]:scan=1.1.4937.2 49.7516 3 1962.906671 1962.897590 K G 1041 1059 PSM DSSTSPGDYVLSVSENSR 106 sp|P46108|CRK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 3-UNIMOD:21 ms_run[1]:scan=1.1.4378.2 43.31098 3 1978.823471 1978.815711 R V 39 57 PSM DKSPVREPIDNLTPEER 107 sp|Q14498|RBM39_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3570.2 29.54292 3 2073.976571 2073.973214 K D 134 151 PSM AGEEDEGEEDSDSDYEISAK 108 sp|A2RRP1|NBAS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 11-UNIMOD:21 ms_run[1]:scan=1.1.3398.3 25.88022 3 2253.802271 2253.795823 R A 463 483 PSM DYHFKVDNDENEHQLSLR 109 sp|P06748|NPM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 ms_run[1]:scan=1.1.3631.2 30.75487 4 2258.043294 2258.035223 K T 28 46 PSM DNLTLWTSENQGDEGDAGEGEN 110 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 25.0 ms_run[1]:scan=1.1.4490.3 45.189 3 2349.958271 2349.946922 R - 225 247 PSM DDDIAALVVDNGSGMCK 111 sp|P60709|ACTB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 25.0 1-UNIMOD:1,16-UNIMOD:4 ms_run[1]:scan=1.1.5445.2 53.89833 2 1820.8052 1820.7912 M A 2 19 PSM GDLGIEIPAEK 112 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3903.2 35.84257 2 1140.603447 1140.602654 R V 295 306 PSM DSAQNSVIIVDK 113 sp|P02786|TFR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3491.3 27.80828 2 1287.668247 1287.667045 K N 194 206 PSM TAFQEALDAAGDK 114 sp|P10599|THIO_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3888.2 35.66393 2 1335.632647 1335.630660 K L 9 22 PSM IVSAQSLAEDDVE 115 sp|Q15388|TOM20_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3883.3 35.6023 2 1374.654047 1374.651455 R - 133 146 PSM KLSSNCSGVEGDVTDEDEGAEMSQR 116 sp|Q9UPR0|PLCL2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35 ms_run[1]:scan=1.1.3294.4 23.51558 4 2795.090894 2795.089914 K M 571 596 PSM ESVPEFPLSPPK 117 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 9-UNIMOD:21 ms_run[1]:scan=1.1.4479.2 44.91051 2 1405.659247 1405.653049 K K 30 42 PSM EGLELPEDEEEK 118 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3632.4 30.78392 2 1415.634047 1415.630385 K K 412 424 PSM HVFGESDELIGQK 119 sp|P60174|TPIS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3583.2 29.7719 3 1457.715371 1457.715058 R V 138 151 PSM DHQYQFLEDAVR 120 sp|Q13263|TIF1B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.4008.2 37.33875 3 1519.708271 1519.705556 K N 239 251 PSM DHQTITIQEMPEK 121 sp|P25205|MCM3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3489.3 27.75738 3 1568.750471 1568.750458 K A 195 208 PSM DVTPPPETEVVLIK 122 sp|P27816|MAP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 3-UNIMOD:21 ms_run[1]:scan=1.1.4531.2 45.88093 3 1615.814171 1615.811007 K N 519 533 PSM NLDIERPTYTNLNR 123 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3685.2 31.69208 3 1717.879271 1717.874747 R L 216 230 PSM SGKYDLDFKSPDDPSR 124 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.3501.3 28.04232 4 1825.849694 1825.848257 R Y 254 270 PSM GEAAAERPGEAAVASSPSK 125 sp|P29966|MARCS_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 15-UNIMOD:21 ms_run[1]:scan=1.1.2959.3 18.79185 3 1863.838271 1863.836387 K A 12 31 PSM DCDLQEDEACYNCGR 126 sp|P62633-4|CNBP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4 ms_run[1]:scan=1.1.3407.2 26.11657 3 1903.682771 1903.677112 K G 66 81 PSM EVEDKESEGEEEDEDEDLSK 127 sp|O95218|ZRAB2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 7-UNIMOD:21 ms_run[1]:scan=1.1.3139.2 20.98595 3 2418.903671 2418.895931 K Y 147 167 PSM NGSLDSPGKQDTEEDEEEDEKDK 128 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 24.0 ms_run[1]:scan=1.1.2983.3 19.07457 4 2594.068894 2593.078724 K G 134 157 PSM ALLYLCGGDD 129 sp|P07355|ANXA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 6-UNIMOD:4 ms_run[1]:scan=1.1.4390.2 43.4834 2 1095.490647 1095.490661 K - 330 340 PSM STTPPPAEPVSLPQEPPKPR 130 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 2-UNIMOD:21 ms_run[1]:scan=1.1.3705.2 31.99932 4 2204.091294 2204.087850 K V 225 245 PSM ITIADCGQLE 131 sp|P62937|PPIA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 6-UNIMOD:4 ms_run[1]:scan=1.1.3835.2 34.58758 2 1118.528447 1118.527775 K - 156 166 PSM DRVTDALNATR 132 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3445.2 26.83708 3 1230.630371 1230.631663 K A 419 430 PSM DQVANSAFVER 133 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3382.2 25.46693 2 1234.595847 1234.594215 K L 500 511 PSM IGEGTYGVVYK 134 sp|P06493|CDK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3511.2 28.25352 2 1264.574647 1264.574071 K G 10 21 PSM GYFEYIEENK 135 sp|Q00839|HNRPU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.4025.3 37.61503 2 1290.578047 1290.576833 R Y 256 266 PSM RLSQSDEDVIR 136 sp|Q9H7D7|WDR26_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3319.3 24.01367 3 1396.633871 1396.634773 K L 119 130 PSM AFLAELEQNSPK 137 sp|Q9UPN3|MACF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 10-UNIMOD:21 ms_run[1]:scan=1.1.4212.3 40.7522 2 1425.659247 1425.654112 K I 4512 4524 PSM YHTSQSGDEMTSLSEYVSR 138 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3874.3 35.39292 3 2175.941771 2175.937877 R M 457 476 PSM PCSEETPAISPSK 139 sp|P33316-2|DUT_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 2-UNIMOD:4,10-UNIMOD:21 ms_run[1]:scan=1.1.3181.3 21.61222 2 1481.6131 1481.6104 M R 2 15 PSM RGPGLYYVDSEGNR 140 sp|P28074|PSB5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3453.3 27.0144 3 1581.752771 1581.753569 K I 166 180 PSM DMESPTKLDVTLAK 141 sp|P27816|MAP4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3988.2 37.0801 3 1626.759671 1626.757591 K D 277 291 PSM GRSRSPQRPGWSR 142 sp|Q9UQ35|SRRM2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1000663, ProteinPilot, ] 23.0 3-UNIMOD:21,5-UNIMOD:21 ms_run[1]:scan=1.1.2942.2 18.6556 4 1685.72809419132 1685.7301015848898 R S 532 545 PSM STAGDTHLGGEDFDNR 143 sp|P54652|HSP72_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3292.3 23.47193 3 1690.722671 1690.718306 K M 224 240 PSM NRPTSISWDGLDSGK 144 sp|P30086|PEBP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3927.2 36.21655 3 1711.757171 1711.756680 K L 48 63 PSM NLDIERPTYTNLNR 145 sp|Q71U36|TBA1A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3672.3 31.49152 3 1717.879271 1717.874747 R L 216 230 PSM DSSTSPGDYVLSVSENSR 146 sp|P46108|CRK_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 5-UNIMOD:21 ms_run[1]:scan=1.1.4392.2 43.51525 3 1978.823471 1978.815711 R V 39 57 PSM SGPKPFSAPKPQTSPSPK 147 sp|Q01518|CAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 14-UNIMOD:21,16-UNIMOD:21 ms_run[1]:scan=1.1.3287.2 23.36432 4 1996.906894 1996.906060 R R 295 313 PSM INSSGESGDESDEFLQSR 148 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 7-UNIMOD:21 ms_run[1]:scan=1.1.3725.2 32.4928 3 2035.805471 2035.800789 R K 180 198 PSM DKSPVREPIDNLTPEER 149 sp|Q14498|RBM39_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3569.3 29.51737 4 2073.972494 2073.973214 K D 134 151 PSM DLLLTSSYLSDSGSTGEHTK 150 sp|P08195|4F2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.4172.2 40.10333 3 2110.017971 2110.006609 K S 397 417 PSM KLEKEEEEGISQESSEEEQ 151 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.3118.2 20.66403 3 2235.993371 2235.986661 K - 89 108 PSM DNLTLWTSENQGDEGDAGEGEN 152 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.4473.2 44.77798 3 2349.958271 2349.946922 R - 225 247 PSM DNLTLWTSDTQGDEAEAGEGGEN 153 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.4530.3 45.86577 3 2408.000171 2407.988786 R - 223 246 PSM NQIHVKSPPREGSQGELTPANSQSR 154 sp|Q13098|CSN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 13-UNIMOD:21 ms_run[1]:scan=1.1.3207.4 22.07893 4 2796.337694 2796.330434 R M 462 487 PSM LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR 155 sp|Q9C0C9|UBE2O_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 7-UNIMOD:21,21-UNIMOD:4 ms_run[1]:scan=1.1.2936.2 18.58205 5 3423.328118 3423.317893 R A 81 114 PSM NPDDITQEEYGEFYK 156 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 ms_run[1]:scan=1.1.4029.2 37.68842 3 1846.792871 1846.789740 R S 292 307 PSM SDKPDMAEIEKFDK 157 sp|P62328|TYB4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 1-UNIMOD:1 ms_run[1]:scan=1.1.3835.3 34.59758 3 1693.7873 1693.7864 M S 2 16 PSM SLSRSISQSSTDSYSSAASYTDSSDDEVSPR 158 sp|O43865|SAHH2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 23.0 3-UNIMOD:21,7-UNIMOD:21 ms_run[1]:scan=1.1.3904.5 35.87831 4 3431.373294 3431.356309 R E 62 93 PSM SDAAVDTSSEITTK 159 sp|P06454|PTMA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 23.0 1-UNIMOD:1 ms_run[1]:scan=1.1.3501.5 28.04898 2 1465.6810 1465.6779 M D 2 16 PSM DLHDANTDLIGRHPK 160 sp|P53985|MOT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3290.2 23.42108 4 1700.856894 1700.859431 K Q 225 240 PSM LVLVGDGGTGK 161 sp|P62826|RAN_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3449.2 26.91255 2 1014.568847 1014.570960 K T 13 24 PSM NNAYLAQSPQLYK 162 sp|P14868|SYDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 8-UNIMOD:21 ms_run[1]:scan=1.1.3786.2 33.74443 3 1588.726871 1588.728674 K Q 242 255 PSM DGGAWGTEQR 163 sp|P09382|LEG1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3110.2 20.52035 2 1075.469047 1075.468286 K E 65 75 PSM ALLLLCGEDD 164 sp|P08758|ANXA5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 6-UNIMOD:4 ms_run[1]:scan=1.1.4817.2 48.4954 2 1117.534647 1117.532526 K - 311 321 PSM VTLTSEEEAR 165 sp|P00338|LDHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3154.3 21.23362 2 1133.556847 1133.556432 K L 306 316 PSM FEDENFILK 166 sp|P62937|PPIA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.4068.2 38.42347 2 1153.565647 1153.565540 K H 83 92 PSM NFEDVAFDEK 167 sp|P07237|PDIA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3823.2 34.34627 2 1212.530047 1212.529883 K K 376 386 PSM DSPSVWAAVPGK 168 sp|P07737|PROF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3898.2 35.75182 2 1212.615247 1212.613888 K T 27 39 PSM DNSTMGYMMAK 169 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3598.3 30.07293 2 1247.499447 1247.498465 R K 486 497 PSM EQVANSAFVER 170 sp|Q58FF7|H90B3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3343.2 24.54578 2 1248.610647 1248.609865 K V 365 376 PSM AQTPPGPSLSGSK 171 sp|Q9UQ35|SRRM2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3218.3 22.31875 2 1305.599047 1305.596597 K S 1001 1014 PSM GQNQPVLNITNK 172 sp|P31327|CPSM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3451.2 26.96352 2 1324.709047 1324.709913 R Q 317 329 PSM DNNQFASASLDR 173 sp|P35606|COPB2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3452.4 26.98227 2 1336.603047 1336.600757 K T 154 166 PSM YALYDATYETK 174 sp|P23528|COF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3677.2 31.57138 2 1336.620047 1336.618698 R E 82 93 PSM DKKDEEEDMSLD 175 sp|Q16186|ADRM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3208.2 22.10455 3 1452.591971 1452.592620 K - 396 408 PSM DNGIRPSSLEQMAK 176 sp|P55084|ECHB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3618.2 30.48687 3 1544.761571 1544.761691 K L 278 292 PSM NGRVEIIANDQGNR 177 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3171.3 21.4199 3 1554.786971 1554.786266 K I 47 61 PSM ATAGDTHLGGEDFDNR 178 sp|P0DMV8|HS71A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3301.2 23.66082 3 1674.725471 1674.723391 K L 221 237 PSM DGQVINETSQHHDDLE 179 sp|P08670|VIME_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.3265.5 23.05193 3 1835.796371 1835.792199 R - 451 467 PSM YNDWSDDDDDSNESK 180 sp|Q9UH62|ARMX3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 5-UNIMOD:21 ms_run[1]:scan=1.1.3228.2 22.5507 3 1883.607071 1883.600692 R S 57 72 PSM QNEPFVATQSSACVDGPANH 181 sp|O00180|KCNK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 13-UNIMOD:4 ms_run[1]:scan=1.1.3585.2 29.8228 3 2127.932771 2127.927981 K - 317 337 PSM INSSGESGDESDEFLQSRK 182 sp|O60841|IF2P_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3486.2 27.68762 3 2163.903671 2163.895752 R G 180 199 PSM DNLTLWTSENQGDEGDAGEGEN 183 sp|P31946|1433B_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.4482.2 44.9869 3 2349.958271 2349.946922 R - 225 247 PSM DSGSDEDFLMEDDDDSDYGSSK 184 sp|Q9H1E3|NUCKS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.4149.3 39.75552 3 2427.875171 2427.865619 K K 129 151 PSM GLMAGGRPEGQYSEDEDTDTDEYK 185 sp|Q9NPQ8|RIC8A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 18-UNIMOD:21 ms_run[1]:scan=1.1.3531.3 28.69107 3 2742.075671 2742.064016 R E 424 448 PSM NGSLDSPGKQDTEEDEEEDEKDK 186 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 12-UNIMOD:21 ms_run[1]:scan=1.1.2984.2 19.09922 4 2674.035294 2673.045055 K G 134 157 PSM DNLTLWTSDQQDDDGGEGNN 187 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 ms_run[1]:scan=1.1.4542.2 46.06092 3 2194.880171 2192.873028 R - 228 248 PSM HQTLEVSLSRDSPLK 188 sp|Q8NCF5|NF2IP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 22.0 12-UNIMOD:21 ms_run[1]:scan=1.1.3580.3 29.72368 3 1788.875771 1788.877129 K T 358 373 PSM GTPQKDVIIK 189 sp|P53611|PGTB2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 1-UNIMOD:1,2-UNIMOD:21 ms_run[1]:scan=1.1.3484.2 27.63657 2 1219.6201 1219.6208 M S 2 12 PSM ASLEVSRSPR 190 sp|O60762|DPM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 22.0 1-UNIMOD:1,8-UNIMOD:21 ms_run[1]:scan=1.1.3399.2 25.91223 2 1222.5733 1222.5702 M R 2 12 PSM DAHNALLDIQSSGR 191 sp|Q99613|EIF3C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3662.2 31.31958 3 1495.738571 1495.737919 K A 628 642 PSM NLQTVNVDEN 192 sp|P62899|RL31_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3388.3 25.62507 2 1144.536647 1144.536031 K - 116 126 PSM IYQYIQSR 193 sp|Q13627|DYR1A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3291.2 23.44678 2 1149.521647 1149.521975 R F 318 326 PSM QVVESAYEVIK 194 sp|P00338|LDHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3721.2 32.39045 2 1263.671447 1263.671068 K L 233 244 PSM NNASTDYDLSDK 195 sp|P39023|RL3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3176.3 21.50825 2 1341.566647 1341.568454 K S 301 313 PSM SLLDASEEAIKK 196 sp|P18206|VINC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 1-UNIMOD:21 ms_run[1]:scan=1.1.3719.2 32.34828 3 1382.664071 1382.669428 K D 721 733 PSM ESVPEFPLSPPK 197 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 9-UNIMOD:21 ms_run[1]:scan=1.1.4487.2 45.1036 2 1405.659247 1405.653049 K K 30 42 PSM EQFLDGDGWTSR 198 sp|P27797|CALR_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.4023.2 37.56408 2 1409.623047 1409.621158 K W 25 37 PSM HKLDVTSVEDYK 199 sp|P48643|TCPE_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3415.2 26.26467 3 1432.721471 1432.719809 K A 264 276 PSM EFHLNESGDPSSK 200 sp|P0DME0|SETLP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3268.2 23.08928 3 1445.643671 1445.642287 K S 165 178 PSM DHASIQMNVAEVDK 201 sp|P63220|RS21_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3533.2 28.729 3 1555.732571 1555.730056 K V 28 42 PSM DFTVSAMHGDMDQK 202 sp|P60842|IF4A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3628.2 30.67803 3 1580.662571 1580.659928 R E 296 310 PSM CSDVSELSSSPPGPYHQEPYVCKPEER 203 sp|Q9Y478|AAKB1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4 ms_run[1]:scan=1.1.3721.3 32.40045 4 3213.354494 3213.342046 K F 173 200 PSM DNLTLWTSDQQDDDGGEGNN 204 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.4712.2 47.76507 3 2192.883371 2192.873028 R - 228 248 PSM TVGTPIASVPGSTNTGTVPGSEK 205 sp|Q99460|PSMD1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 1-UNIMOD:21 ms_run[1]:scan=1.1.3760.3 33.24683 3 2236.068971 2236.062423 R D 270 293 PSM ESEDKPEIEDVGSDEEEEKK 206 sp|P07900|HS90A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 ms_run[1]:scan=1.1.3213.3 22.21177 4 2320.012894 2320.007791 K D 251 271 PSM LSSNCSGVEGDVTDEDEGAEMSQR 207 sp|Q9UPR0|PLCL2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 5-UNIMOD:4,13-UNIMOD:21 ms_run[1]:scan=1.1.3559.3 29.27268 3 2651.010371 2651.000036 K M 572 596 PSM RRSPSPYYSR 208 sp|Q13595|TRA2A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 21.0 3-UNIMOD:21 ms_run[1]:scan=1.1.2849.2 17.71203 3 1347.608171 1347.608499 R Y 258 268 PSM SKAELMEISEDK 209 sp|P05455|LA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3401.2 25.95028 3 1378.663871 1378.664997 K T 75 87 PSM HGESAWNLENR 210 sp|P18669|PGAM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3488.3 27.73187 3 1391.560271 1391.561943 R F 11 22 PSM SCNCLLLK 211 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 2-UNIMOD:4,4-UNIMOD:4 ms_run[1]:scan=1.1.3477.3 27.45783 2 1006.495447 1006.493973 K V 336 344 PSM DNQNFCVPCYEK 212 sp|Q14192|FHL2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 6-UNIMOD:4,9-UNIMOD:4 ms_run[1]:scan=1.1.3701.2 31.94362 3 1572.634571 1572.633714 K Q 145 157 PSM DGYNYTLSK 213 sp|P31949|S10AB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3383.3 25.49877 2 1059.486447 1059.487290 K T 28 37 PSM SADTLWGIQK 214 sp|P00338|LDHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3825.2 34.37808 2 1117.575247 1117.576774 K E 319 329 PSM TYLEEELDK 215 sp|Q16719|KYNU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3630.2 30.73928 2 1138.546047 1138.539385 K W 85 94 PSM YIDQEELNK 216 sp|Q58FF8|H90B2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3219.2 22.33375 2 1150.549847 1150.550619 K T 198 207 PSM QLSSGVSEIR 217 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3474.4 27.39273 2 1154.533047 1154.533268 R H 80 90 PSM NSFREQLEEEEEAK 218 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3525.2 28.54618 3 1736.787071 1736.785323 K H 1339 1353 PSM DQIYDIFQK 219 sp|P60842|IF4A1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.4402.2 43.60172 2 1168.579247 1168.576440 K L 194 203 PSM YLSEVASGDNK 220 sp|P31946|1433B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3134.2 20.86142 2 1181.554447 1181.556432 R Q 130 141 PSM SINQPVAFVR 221 sp|Q9GZT3|SLIRP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 1-UNIMOD:21 ms_run[1]:scan=1.1.3964.2 36.72548 2 1209.589047 1209.590724 R R 15 25 PSM DGNGYISAAELR 222 sp|P0DP23|CALM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3750.2 32.98707 2 1264.605847 1264.604780 K H 96 108 PSM ELISNASDALDK 223 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3604.3 30.19757 2 1274.637047 1274.635411 R I 103 115 PSM SSPNPFVGSPPK 224 sp|P98082|DAB2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 9-UNIMOD:21 ms_run[1]:scan=1.1.3712.2 32.17845 2 1292.580447 1292.580219 K G 393 405 PSM NSLESYAFNMK 225 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 10-UNIMOD:35 ms_run[1]:scan=1.1.3699.3 31.91172 2 1318.587647 1318.586353 K A 540 551 PSM DFTPVCTTELGR 226 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 6-UNIMOD:4 ms_run[1]:scan=1.1.3881.2 35.55157 2 1394.650647 1394.650015 R A 42 54 PSM LTFDSSFSPNTGKK 227 sp|P21796|VDAC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 8-UNIMOD:21 ms_run[1]:scan=1.1.3739.3 32.79443 2 1607.730047 1607.723254 K N 97 111 PSM MSPNETLFLESTNK 228 sp|Q9HB90|RRAGC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 11-UNIMOD:21 ms_run[1]:scan=1.1.4235.2 41.2152 3 1689.735071 1689.732104 K I 85 99 PSM DYTGCSTSESLSPVK 229 sp|O95297|MPZL1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 5-UNIMOD:4,12-UNIMOD:21 ms_run[1]:scan=1.1.3499.2 27.99115 3 1709.691671 1709.685548 R Q 199 214 PSM NQTAEKEEFEHQQK 230 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.2748.2 16.92187 4 1744.804094 1744.801642 K E 584 598 PSM DCEECIQLEPTFIK 231 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 2-UNIMOD:4,5-UNIMOD:4 ms_run[1]:scan=1.1.4505.2 45.49278 3 1780.808171 1780.801173 K G 416 430 PSM SYELPDGQVITIGNER 232 sp|P62736|ACTA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.4477.2 44.86553 3 1789.890071 1789.884643 K F 241 257 PSM HIAEEADRKYEEVAR 233 sp|P06753|TPM3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3221.2 22.38362 4 1814.894894 1814.891125 K K 154 169 PSM FQEQECPPSPEPTRK 234 sp|P62070|RRAS2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 6-UNIMOD:4,9-UNIMOD:21 ms_run[1]:scan=1.1.3140.2 21.00093 3 1908.810371 1908.807729 K E 178 193 PSM SGPKPFSAPKPQTSPSPK 235 sp|Q01518|CAP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 14-UNIMOD:21 ms_run[1]:scan=1.1.3205.3 22.04797 4 1916.941294 1916.939729 R R 295 313 PSM SRDEDNDEDEERLEEEEQNEEEEVDN 236 sp|Q9NRF9|DPOE3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.3672.4 31.49818 4 3223.246894 3223.230486 K - 122 148 PSM DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK 237 sp|P43487|RANG_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 ms_run[1]:scan=1.1.4241.2 41.31095 5 3932.724618 3932.709658 K T 6 40 PSM DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK 238 sp|Q9Y266|NUDC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 20.0 22-UNIMOD:21 ms_run[1]:scan=1.1.3257.3 22.88663 5 3566.445118 3565.448950 K D 124 155 PSM ASGVAVSDGVIK 239 sp|P23528|COF1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 20.0 1-UNIMOD:1,2-UNIMOD:21 ms_run[1]:scan=1.1.4101.3 38.98955 2 1223.5838 1223.5794 M V 2 14 PSM LDIKLDSEDK 240 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3465.2 27.24505 3 1174.609871 1174.608134 K D 319 329 PSM DRVHHEPQLSDK 241 sp|O43852|CALU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.2745.2 16.8849 3 1459.716371 1459.716790 K V 26 38 PSM AGFAGDDAPR 242 sp|P62736|ACTA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3100.2 20.3349 2 975.437847 975.441009 K A 21 31 PSM DANNGNLQLR 243 sp|P05455|LA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3218.2 22.30875 2 1113.553247 1113.552684 K N 288 298 PSM NNNTDLMILK 244 sp|Q99460|PSMD1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3834.2 34.57218 2 1174.600447 1174.601608 R N 345 355 PSM LGMLSPEGTCK 245 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 5-UNIMOD:21,10-UNIMOD:4 ms_run[1]:scan=1.1.3711.2 32.15282 2 1271.529847 1271.529111 R A 203 214 PSM DIQEESTFSSR 246 sp|P42704|LPPRC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3345.4 24.60942 2 1297.576847 1297.578624 K K 67 78 PSM NSLESYAFNMK 247 sp|P11142|HSP7C_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.4034.2 37.77878 2 1302.591447 1302.591438 K A 540 551 PSM NELESYAYSLK 248 sp|P11021|BIP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3973.2 36.90002 2 1315.629647 1315.629597 R N 563 574 PSM YSQVLANGLDNK 249 sp|P62269|RS18_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3494.3 27.86312 2 1320.668847 1320.667380 K L 95 107 PSM DSSSTNLESMDTS 250 sp|Q86VP6|CAND1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3443.3 26.79575 2 1372.533847 1372.530019 K - 1218 1231 PSM ESVPEFPLSPPKKK 251 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 9-UNIMOD:21 ms_run[1]:scan=1.1.3753.2 33.07705 3 1661.845271 1661.842975 K D 30 44 PSM DVQDSLTVSNEAQTAK 252 sp|P52907|CAZA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3472.4 27.34133 3 1704.817271 1704.816623 K E 211 227 PSM DNLTLWTSDTQGDEAEAGEGGEN 253 sp|P63104|1433Z_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.4588.2 46.70167 3 2408.000171 2407.988786 R - 223 246 PSM LVQDVANNTNEEAGDGTTTATVLAR 254 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 ms_run[1]:scan=1.1.3755.3 33.1281 3 2559.245471 2559.241253 K S 97 122 PSM KLSSNCSGVEGDVTDEDEGAEMSQR 255 sp|Q9UPR0|PLCL2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 6-UNIMOD:4,14-UNIMOD:21 ms_run[1]:scan=1.1.3450.5 26.938 3 2779.105871 2779.094999 K M 571 596 PSM KASPPSGLWSPAYASH 256 sp|Q8TEM1|PO210_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 19.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3926.2 36.20112 3 1734.778871 1734.776687 R - 1872 1888 PSM DIGFIKLD 257 sp|P62273|RS29_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.4785.2 48.27077 2 919.502247 919.501484 K - 49 57 PSM VSDQNSPVLPKK 258 sp|Q9UPU5|UBP24_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3007.2 19.27813 3 1390.688471 1390.685746 R S 2042 2054 PSM EIAEAYLGK 259 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3512.2 28.27903 2 992.515847 992.517862 K T 129 138 PSM DGLTDVYNK 260 sp|P24752|THIL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3437.2 26.64243 2 1023.485847 1023.487290 K I 182 191 PSM QQEGESRLNLVQR 261 sp|P00338|LDHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3309.2 23.79642 3 1555.806971 1555.806667 R N 100 113 PSM DLSLEEIQK 262 sp|P16949|STMN1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3803.2 34.07697 2 1073.561447 1073.560455 K K 44 53 PSM ALLYLCGGDD 263 sp|P07355|ANXA2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 6-UNIMOD:4 ms_run[1]:scan=1.1.4406.2 43.68447 2 1095.490647 1095.490661 K - 330 340 PSM MSGFIYQGK 264 sp|Q15052|ARHG6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 2-UNIMOD:21 ms_run[1]:scan=1.1.3795.3 33.89175 2 1109.463847 1109.461683 R I 487 496 PSM DQLIYNLLK 265 sp|P00338|LDHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.4843.2 48.71965 2 1118.635647 1118.633560 K E 6 15 PSM MSGFIYQGK 266 sp|Q15052|ARHG6_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 1-UNIMOD:35,2-UNIMOD:21 ms_run[1]:scan=1.1.3530.4 28.66555 2 1125.459647 1125.456598 R I 487 496 PSM DITSDTSGDFR 267 sp|P04083|ANXA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3446.5 26.87275 2 1212.526647 1212.525861 K N 167 178 PSM NAGVEGSLIVEK 268 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3536.2 28.80598 2 1214.651847 1214.650667 K I 482 494 PSM DIDISSPEFK 269 sp|Q09666|AHNK_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 6-UNIMOD:21 ms_run[1]:scan=1.1.4072.2 38.48892 2 1229.524447 1229.521701 K I 172 182 PSM LDIDSPPITAR 270 sp|P14618|KPYM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 5-UNIMOD:21 ms_run[1]:scan=1.1.4008.3 37.34875 2 1276.611247 1276.606433 R N 33 44 PSM SSPNPFVGSPPK 271 sp|P98082|DAB2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 9-UNIMOD:21 ms_run[1]:scan=1.1.3702.2 31.96975 2 1292.580447 1292.580219 K G 393 405 PSM DVLSVAFSSDNR 272 sp|P63244|RACK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.4242.2 41.32618 2 1308.632447 1308.630994 K Q 107 119 PSM GYSSPEPDIQDSSGSEAQSVKPSTR 273 sp|Q9BZF1|OSBL8_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 13-UNIMOD:21 ms_run[1]:scan=1.1.3444.2 26.82133 4 2688.161694 2688.155214 K R 796 821 PSM TLRLNQPGTPTR 274 sp|P36507|MP2K2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 9-UNIMOD:21 ms_run[1]:scan=1.1.3265.3 23.04193 3 1432.716971 1432.718778 K T 386 398 PSM DNPGVVTCLDEAR 275 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 8-UNIMOD:4 ms_run[1]:scan=1.1.3684.3 31.66973 2 1444.664847 1444.661643 K H 227 240 PSM EVDEQMLNVQNK 276 sp|Q13885|TBB2A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 6-UNIMOD:35 ms_run[1]:scan=1.1.3207.3 22.07227 3 1461.674771 1461.676959 K N 325 337 PSM DKDDDGGEDDDANCNLICGDEYGPETR 277 sp|Q08211|DHX9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 14-UNIMOD:4,18-UNIMOD:4 ms_run[1]:scan=1.1.3758.3 33.1952 4 3044.165294 3044.151982 K L 595 622 PSM DINAYNCEEPTEK 278 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 7-UNIMOD:4 ms_run[1]:scan=1.1.3293.3 23.49713 3 1581.658871 1581.661702 K L 85 98 PSM QDENDDDDDWNPCK 279 sp|Q14974|IMB1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 13-UNIMOD:4 ms_run[1]:scan=1.1.3394.3 25.77758 3 1764.619271 1764.616937 K A 333 347 PSM QLEDGRTLSDYNIQK 280 sp|P62987|RL40_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3522.2 28.49712 3 1778.883671 1778.879892 K E 49 64 PSM AASPPASASDLIEQQQK 281 sp|Q5VSL9|STRP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3770.4 33.45092 3 1819.837871 1819.835324 R R 333 350 PSM DAGDKDKEQELSEEDK 282 sp|Q13200|PSMD2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.2824.2 17.46323 3 1834.809371 1834.806846 R Q 35 51 PSM MKDTDSEEEIREAFR 283 sp|P0DP23|CALM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3632.3 30.78058 4 1854.840494 1854.841792 K V 77 92 PSM FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK 284 sp|P07237|PDIA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.4699.2 47.64345 4 3756.474094 3756.438824 K A 469 503 PSM SLDSDESEDEEDDYQQK 285 sp|Q13442|HAP28_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3220.3 22.36202 3 2110.745171 2110.737580 K R 57 74 PSM IVRGDQPAASGDSDDDEPPPLPR 286 sp|O00264|PGRC1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 13-UNIMOD:21 ms_run[1]:scan=1.1.3558.2 29.24042 3 2483.103971 2483.096577 K L 45 68 PSM DSGSDEDFLMEDDDDSDYGSSKK 287 sp|Q9H1E3|NUCKS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3846.2 34.76728 3 2555.967971 2555.960582 K K 129 152 PSM EALSNLTALTSDSDTDSSSDSDSDTSEGK 288 sp|Q96EY7|PTCD3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 13-UNIMOD:21 ms_run[1]:scan=1.1.4303.3 42.1617 3 3014.204171 3014.188484 K - 661 690 PSM LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK 289 sp|P06748|NPM_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 ms_run[1]:scan=1.1.3599.3 30.09842 3 3722.219171 3722.195067 K A 158 190 PSM NGSLDSPGKQDTEEDEEEDEK 290 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 12-UNIMOD:21 ms_run[1]:scan=1.1.3087.2 20.18622 3 2430.914171 2429.923149 K D 134 155 PSM MLAESDESGDEESVSQTDKTELQNTLR 291 sp|P22059|OSBP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21 ms_run[1]:scan=1.1.4047.2 38.04505 4 3187.294494 3187.278911 K T 186 213 PSM STIGVMVTASHNPEEDNGVK 292 sp|O95394|AGM1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 18.0 6-UNIMOD:35,10-UNIMOD:21 ms_run[1]:scan=1.1.3497.2 27.94 3 2179.953071 2179.945679 K L 55 75 PSM DFDTALK 293 sp|P31948|STIP1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3460.2 27.1177 2 808.394447 808.396684 K H 240 247 PSM NSLLSLSDT 294 sp|Q7L2H7|EIF3M_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.4212.2 40.7422 2 948.476447 948.476391 K - 366 375 PSM KLSFDFQ 295 sp|P23381|SYWC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 3-UNIMOD:21 ms_run[1]:scan=1.1.4311.2 42.34552 2 963.410047 963.410300 R - 465 472 PSM DVNVNFEK 296 sp|Q15185|TEBP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3410.2 26.17398 2 963.465647 963.466161 K S 26 34 PSM DATLTALDR 297 sp|P40939|ECHA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3517.2 28.3876 2 974.501047 974.503275 K G 391 400 PSM DVFQELEK 298 sp|Q16719|KYNU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.4044.2 37.9689 2 1006.497447 1006.497127 K R 413 421 PSM DLTDYLMK 299 sp|P62736|ACTA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 7-UNIMOD:35 ms_run[1]:scan=1.1.4024.2 37.58957 2 1013.473847 1013.473949 R I 186 194 PSM DGGFCEVCK 300 sp|P07602|SAP_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 5-UNIMOD:4,8-UNIMOD:4 ms_run[1]:scan=1.1.3224.3 22.46218 2 1070.414047 1070.416116 K K 405 414 PSM TLSDYNIQK 301 sp|P62987|RL40_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3328.2 24.1792 2 1080.544047 1080.545139 R E 55 64 PSM DLNSYLEDK 302 sp|O43324|MCA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3802.2 34.05085 2 1095.509647 1095.508420 K V 97 106 PSM RQAQQERDELADEIANSSGK 303 sp|P35579|MYH9_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3457.3 27.06075 4 2244.076094 2244.073066 K G 1697 1717 PSM LGIHEDSTNR 304 sp|P08238|HS90B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.2914.2 18.26757 3 1140.554471 1140.552350 K R 439 449 PSM DTQLQQIVDK 305 sp|P63098|CANB1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3646.2 31.0093 2 1186.617247 1186.619367 K T 126 136 PSM EIKCSPSESPLMEK 306 sp|Q8WUM9|S20A1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 4-UNIMOD:4,5-UNIMOD:21,9-UNIMOD:21 ms_run[1]:scan=1.1.3452.3 26.97893 3 1793.703971 1793.701806 R K 261 275 PSM DAGTIAGLNVLR 307 sp|P11142|HSP7C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.4312.3 42.36397 2 1198.669447 1198.666986 K I 160 172 PSM DLFDPIIEDR 308 sp|P12277|KCRB_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.4917.2 49.50203 2 1231.610647 1231.608468 K H 87 97 PSM MEEFKDQLPADECNK 309 sp|P38646|GRP75_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 13-UNIMOD:4 ms_run[1]:scan=1.1.3483.4 27.60447 3 1852.800671 1852.797150 K L 596 611 PSM VDSPTVTTTLK 310 sp|Q07866|KLC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3433.4 26.55902 2 1240.596847 1240.595200 K N 458 469 PSM ASPGTPLSPGSLR 311 sp|Q96BD0|SO4A1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 8-UNIMOD:21 ms_run[1]:scan=1.1.3750.3 32.99373 2 1318.629447 1318.628231 R S 33 46 PSM NSNPALNDNLEK 312 sp|O00299|CLIC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3244.3 22.77767 2 1327.639247 1327.636808 K G 120 132 PSM GEPNVSYICSR 313 sp|P49840|GSK3A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 7-UNIMOD:21,9-UNIMOD:4 ms_run[1]:scan=1.1.3489.4 27.76405 2 1360.551247 1360.548267 R Y 273 284 PSM GEPNVSYICSR 314 sp|P49840|GSK3A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 7-UNIMOD:21,9-UNIMOD:4 ms_run[1]:scan=1.1.3472.5 27.348 2 1360.551247 1360.548267 R Y 273 284 PSM ESVPEFPLSPPK 315 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 9-UNIMOD:21 ms_run[1]:scan=1.1.4465.2 44.69935 2 1405.659247 1405.653049 K K 30 42 PSM NQDECVIALHDCNGDVNR 316 sp|Q14157|UBP2L_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 5-UNIMOD:4,12-UNIMOD:4 ms_run[1]:scan=1.1.3480.2 27.52445 3 2127.912671 2127.906200 K A 64 82 PSM TPELNLDQFHDK 317 sp|P27824|CALX_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3770.3 33.44758 3 1455.700271 1455.699408 K T 171 183 PSM LTFDSSFSPNTGK 318 sp|P21796|VDAC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 8-UNIMOD:21 ms_run[1]:scan=1.1.4052.2 38.17188 2 1479.631647 1479.628291 K K 97 110 PSM ESLTEAEVATEKEGEDGDQPTTPPKPLK 319 sp|P18858|DNLI1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 22-UNIMOD:21 ms_run[1]:scan=1.1.3708.3 32.08588 4 3075.425694 3075.417302 K T 162 190 PSM ALSRQLSSGVSEIR 320 sp|P04792|HSPB1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 3-UNIMOD:21,7-UNIMOD:21 ms_run[1]:scan=1.1.3784.2 33.69348 3 1661.754671 1661.753917 R H 76 90 PSM HVPDSGATATAYLCGVK 321 sp|P05187|PPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 5-UNIMOD:21,14-UNIMOD:4 ms_run[1]:scan=1.1.3837.2 34.63502 3 1825.809071 1825.807001 K G 110 127 PSM QLVRGEPNVSYICSR 322 sp|P49840|GSK3A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 11-UNIMOD:21,13-UNIMOD:4 ms_run[1]:scan=1.1.3627.3 30.65575 3 1856.862671 1856.860433 K Y 269 284 PSM DSSTCPGDYVLSVSENSR 323 sp|P46109|CRKL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 4-UNIMOD:21,5-UNIMOD:4 ms_run[1]:scan=1.1.4337.2 42.66328 3 2051.819771 2051.814331 R V 40 58 PSM DYEEVGADSADGEDEGEEY 324 sp|Q9BQE3|TBA1C_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.3769.2 33.43212 3 2077.744871 2077.739614 K - 431 450 PSM DNLTLWTSDQQDDDGGEGNN 325 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.4555.2 46.29847 3 2192.881871 2192.873028 R - 228 248 PSM DNLTLWTSDQQDDDGGEGNN 326 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 ms_run[1]:scan=1.1.4689.2 47.56045 3 2192.883371 2192.873028 R - 228 248 PSM KLEKEEEEGISQESSEEEQ 327 sp|P17096|HMGA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 15-UNIMOD:21 ms_run[1]:scan=1.1.3099.2 20.31983 3 2315.961371 2315.952992 K - 89 108 PSM DSGSDEDFLMEDDDDSDYGSSK 328 sp|Q9H1E3|NUCKS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 10-UNIMOD:35 ms_run[1]:scan=1.1.3858.3 35.0601 3 2443.868771 2443.860534 K K 129 151 PSM GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK 329 sp|Q96SB4|SRPK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 17.0 20-UNIMOD:21,32-UNIMOD:4 ms_run[1]:scan=1.1.4067.2 38.40722 4 3813.476494 3813.463279 R G 32 65 PSM DSLIDSLT 330 sp|P56537|IF6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.4655.2 47.28528 2 862.427247 862.428378 R - 238 246 PSM ADEGISFR 331 sp|Q06830|PRDX1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3396.2 25.83565 2 893.422247 893.424296 K G 121 129 PSM DCLNVLNK 332 sp|Q99471|PFD5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 2-UNIMOD:4 ms_run[1]:scan=1.1.3495.2 27.8888 2 974.482247 974.485516 K S 48 56 PSM DWDDDQND 333 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3182.3 21.63075 2 1021.323847 1021.326098 K - 541 549 PSM SGKYDLDFK 334 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3439.2 26.68012 3 1071.523271 1071.523676 R S 254 263 PSM EIIDLVLDR 335 sp|Q71U36|TBA1A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.4862.2 48.89757 2 1084.613047 1084.612825 K I 113 122 PSM SIYYITGESK 336 sp|Q58FF8|H90B2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3561.2 29.32048 2 1159.576647 1159.576105 K E 258 268 PSM NQDNLQGWNK 337 sp|P30085|KCY_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3311.4 23.85048 2 1215.565247 1215.563249 R T 97 107 PSM DNSTMGYMMAK 338 sp|Q58FF7|H90B3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 9-UNIMOD:35 ms_run[1]:scan=1.1.3353.2 24.78588 2 1263.495247 1263.493380 R K 486 497 PSM ISVYYNEATGGK 339 sp|P07437|TBB5_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3458.4 27.08605 2 1300.635247 1300.629932 R Y 47 59 PSM GEPNVSYICSR 340 sp|P49840|GSK3A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 7-UNIMOD:21,9-UNIMOD:4 ms_run[1]:scan=1.1.3481.3 27.56 2 1360.551247 1360.548267 R Y 273 284 PSM NNSGEEFDCAFR 341 sp|Q08J23|NSUN2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 9-UNIMOD:4 ms_run[1]:scan=1.1.3628.3 30.68803 2 1444.572247 1444.567742 R L 591 603 PSM DNPGVVTCLDEAR 342 sp|P22314|UBA1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 8-UNIMOD:4 ms_run[1]:scan=1.1.3685.3 31.70208 2 1444.664847 1444.661643 K H 227 240 PSM LTFDTTFSPNTGK 343 sp|P45880|VDAC2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 8-UNIMOD:21 ms_run[1]:scan=1.1.4209.2 40.66248 2 1507.665047 1507.659591 K K 108 121 PSM ESLKEEDESDDDNM 344 sp|P25788|PSA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3135.2 20.88623 3 1654.617671 1654.615206 K - 242 256 PSM ESVPEFPLSPPKKK 345 sp|P16949|STMN1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 9-UNIMOD:21 ms_run[1]:scan=1.1.3743.2 32.87558 3 1661.845271 1661.842975 K D 30 44 PSM STTPPPAEPVSLPQEPPKPR 346 sp|Q9UN86-2|G3BP2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 2-UNIMOD:21 ms_run[1]:scan=1.1.3693.2 31.83265 3 2204.094671 2204.087850 K V 225 245 PSM DSGSDEDFLMEDDDDSDYGSSKK 347 sp|Q9H1E3|NUCKS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 10-UNIMOD:35 ms_run[1]:scan=1.1.3645.2 30.99395 3 2571.968171 2571.955497 K K 129 152 PSM NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK 348 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3432.3 26.53357 4 3365.462894 3365.451593 K K 799 833 PSM ATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEK 349 sp|Q9ULX6|AKP8L_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 16.0 6-UNIMOD:4,18-UNIMOD:21 ms_run[1]:scan=1.1.3505.3 28.15505 4 3668.4272 3668.4062 K G 291 325 PSM EKQTEATNAIAEMKYPK 350 sp|Q8NHM5|KDM2B_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 13-UNIMOD:35,15-UNIMOD:21 ms_run[1]:scan=1.1.3008.2 19.303 4 2046.940494 2046.933324 K V 209 226 PSM NGSEADIDEGLYSR 351 sp|P22314|UBA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 16.0 ms_run[1]:scan=1.1.3740.4 32.8191 2 1525.659047 1524.669230 K Q 44 58 PSM GILAADESTGSIAK 352 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 8-UNIMOD:21 ms_run[1]:scan=1.1.3735.2 32.70537 2 1411.659847 1411.659591 K R 29 43 PSM NFDEILR 353 sp|P30041|PRDX6_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3809.2 34.18267 2 905.460847 905.460681 R V 156 163 PSM DLSLDDFK 354 sp|P30048|PRDX3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.4194.2 40.36587 2 951.455047 951.454927 K G 84 92 PSM DLSTIEPLK 355 sp|P39687|AN32A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3873.2 35.36768 2 1014.559447 1014.559727 K K 102 111 PSM DVNAAIATIK 356 sp|Q71U36|TBA1A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3684.2 31.66307 2 1014.569247 1014.570960 K T 327 337 PSM DWDDDQND 357 sp|P50990|TCPQ_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3171.2 21.4099 2 1021.323847 1021.326098 K - 541 549 PSM DILIQYDR 358 sp|P62249|RS16_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3806.2 34.1164 2 1034.539047 1034.539660 K T 110 118 PSM DLEGSDIDTR 359 sp|P55060|XPO2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3239.2 22.68677 2 1119.504047 1119.504397 R R 373 383 PSM SCAHDWVYE 360 sp|O60361|NDK8_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 2-UNIMOD:4 ms_run[1]:scan=1.1.3529.2 28.63997 2 1165.451847 1165.449859 K - 129 138 PSM IDIIPNPQER 361 sp|Q58FF7|H90B3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3798.2 33.95805 2 1193.642647 1193.640437 K T 73 83 PSM AGSSTPGDAPPAVAEVQGR 362 sp|Q7Z6Z7|HUWE1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 5-UNIMOD:21 ms_run[1]:scan=1.1.3548.4 29.08317 3 1845.831671 1845.825822 R S 2885 2904 PSM DNWEELYNR 363 sp|P55786|PSA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3930.3 36.27807 2 1237.534847 1237.536366 K Y 833 842 PSM DQHSFELDEK 364 sp|Q6DD88|ATLA3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3319.2 24.01033 3 1246.546271 1246.546596 K A 35 45 PSM LMIEMDGTENK 365 sp|P06733|ENOA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3671.2 31.45927 2 1279.580447 1279.578824 K S 93 104 PSM DISTNYYASQK 366 sp|P14625|ENPL_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3346.5 24.63155 2 1288.592647 1288.593546 K K 672 683 PSM SENGLEFTSSGSANTETTK 367 sp|P21796|VDAC1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3442.3 26.77008 3 1958.875571 1958.870509 K V 35 54 PSM GSSPTRVLDEGK 368 sp|Q5JRA6|TGO1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3230.2 22.60142 3 1324.601171 1324.602411 R V 1743 1755 PSM TLNMTTSPEEK 369 sp|P49915|GUAA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 7-UNIMOD:21 ms_run[1]:scan=1.1.3300.3 23.62917 2 1329.554447 1329.552349 K R 326 337 PSM DIISDTSGDFRK 370 sp|P07355|ANXA2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3674.2 31.51723 3 1352.657771 1352.657209 K L 158 170 PSM DLLHPSPEEEK 371 sp|P42677|RS27_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3513.2 28.30447 3 1372.591271 1372.591177 K R 6 17 PSM GILAADESTGSIAK 372 sp|P04075|ALDOA_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 11-UNIMOD:21 ms_run[1]:scan=1.1.3663.2 31.33525 2 1411.661447 1411.659591 K R 29 43 PSM EDQTEYLEERR 373 sp|Q58FF7|H90B3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3215.2 22.2621 3 1466.664371 1466.663751 K V 166 177 PSM DNFGFIETANHDK 374 sp|O75534|CSDE1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3796.2 33.90717 3 1506.673871 1506.673922 K E 528 541 PSM EGLELPEDEEEKK 375 sp|Q58FF7|H90B3_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.3445.3 26.84708 3 1543.727171 1543.725348 K K 412 425 PSM DFTVSAMHGDMDQK 376 sp|P60842|IF4A1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 11-UNIMOD:35 ms_run[1]:scan=1.1.3416.3 26.29088 3 1596.654971 1596.654843 R E 296 310 PSM GCRLSPRDTYSDR 377 sp|P17812|PYRG1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 2-UNIMOD:4,5-UNIMOD:21 ms_run[1]:scan=1.1.3111.2 20.53527 3 1661.697371 1661.698119 K S 558 571 PSM NHSGSRTPPVALNSSR 378 sp|Q9UQ35|SRRM2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 7-UNIMOD:21 ms_run[1]:scan=1.1.3055.2 19.77713 3 1758.818471 1758.816260 R M 2098 2114 PSM AASPPASASDLIEQQQK 379 sp|Q5VSL9|STRP1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 7-UNIMOD:21 ms_run[1]:scan=1.1.3760.2 33.2435 3 1819.837871 1819.835324 R R 333 350 PSM NHSGSRTPPVALNSSR 380 sp|Q9UQ35|SRRM2_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 5-UNIMOD:21,7-UNIMOD:21 ms_run[1]:scan=1.1.3141.2 21.03583 3 1838.781371 1838.782591 R M 2098 2114 PSM DNLTLWTSDQQDDDGGEGNN 381 sp|P61981|1433G_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 ms_run[1]:scan=1.1.4530.2 45.85577 3 2192.882471 2192.873028 R - 228 248 PSM NGSLDSPGKQDTEEDEEEDEK 382 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 12-UNIMOD:21 ms_run[1]:scan=1.1.3046.2 19.702 3 2430.914171 2429.923149 K D 134 155 PSM QLSSGVSEIR 383 sp|P04792|HSPB1_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1001476, X!Tandem, ] 15.0 1-UNIMOD:28,3-UNIMOD:21 ms_run[1]:scan=1.1.4151.2 39.79813 2 1137.5067 1137.5062 R H 80 90 PSM KASPPSGLWSPAYASH 384 sp|Q8TEM1|PO210_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3944.3 36.4669 3 1734.778871 1734.776687 R - 1872 1888 PSM RRSPSPYYSR 385 sp|Q13595|TRA2A_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 15.0 3-UNIMOD:21,5-UNIMOD:21 ms_run[1]:scan=1.1.2861.2 17.82342 3 1427.578871 1427.574830 R Y 258 268 PSM LISPYK 386 sp|O14929|HAT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3395.2 25.79983 2 799.387447 799.388108 R K 359 365 PSM TEWLDGK 387 sp|Q9Y536|PAL4A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3411.2 26.20003 2 847.406247 847.407583 K H 119 126 PSM LSDGVAVLK 388 sp|P10809|CH60_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3477.2 27.44783 2 900.525847 900.528033 K V 397 406 PSM KLPEMDID 389 sp|P34932|HSP74_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3708.2 32.07588 2 959.463447 959.463384 K - 833 841 PSM DCVGPEVEK 390 sp|P00558|PGK1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 2-UNIMOD:4 ms_run[1]:scan=1.1.3025.2 19.49712 2 1031.459647 1031.459361 K A 98 107 PSM DIIACGFDINK 391 sp|P23381|SYWC_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 5-UNIMOD:4 ms_run[1]:scan=1.1.4255.2 41.50348 2 1264.614847 1264.612173 K T 221 232 PSM LGMLSPEGTCK 392 sp|P49327|FAS_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 5-UNIMOD:21,10-UNIMOD:4 ms_run[1]:scan=1.1.3720.2 32.36472 2 1271.529847 1271.529111 R A 203 214 PSM LNQPGTPTRTAV 393 sp|P36507|MP2K2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 6-UNIMOD:21 ms_run[1]:scan=1.1.3264.3 23.02625 2 1333.640047 1333.639131 R - 389 401 PSM KGDECELLGHSK 394 sp|P49411|EFTU_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 5-UNIMOD:4 ms_run[1]:scan=1.1.3041.2 19.65175 3 1371.646871 1371.645264 K N 286 298 PSM TTPSYVAFTDTER 395 sp|P0DMV8|HS71A_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3751.2 33.01598 2 1486.695447 1486.693989 R L 37 50 PSM LAVDEEENADNNTK 396 sp|P02786|TFR1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3071.4 19.98422 3 1560.689771 1560.690360 K A 40 54 PSM DIEREDIEFICK 397 sp|P50991|TCPD_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 11-UNIMOD:4 ms_run[1]:scan=1.1.3962.2 36.67385 3 1565.742071 1565.739559 K T 327 339 PSM HGSYEDAVHSGALND 398 sp|P17987|TCPA_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3318.2 23.9882 3 1570.663871 1570.664814 K - 542 557 PSM NQYDNDVTVWSPQGR 399 sp|P25786|PSA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3851.3 34.88637 3 1777.806371 1777.801976 R I 4 19 PSM NSGQNLEEDMGQSEQK 400 sp|Q9HAV7|GRPE1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3294.2 23.50892 3 1792.755071 1792.753371 K A 35 51 PSM TAENATSGETLEENEAGD 401 sp|Q9UQ80|PA2G4_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.3298.2 23.58452 2 1836.758447 1836.749725 K - 377 395 PSM KEESEESDDDMGFGLFD 402 sp|P05386|RLA1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.4928.3 49.64773 2 1948.763247 1948.752033 K - 98 115 PSM SQSLPNSLDYTQTSDPGR 403 sp|Q96TC7|RMD3_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 3-UNIMOD:21 ms_run[1]:scan=1.1.3826.2 34.39097 3 2044.877471 2044.873894 R H 44 62 PSM DNLTLWTSDQQDEEAGEGN 404 sp|Q04917|1433F_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.4477.3 44.8722 3 2120.884571 2120.877051 R - 228 247 PSM EADDDEEVDDNIPEMPSPKK 405 sp|P26358|DNMT1_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 17-UNIMOD:21 ms_run[1]:scan=1.1.3777.2 33.56223 3 2351.939771 2351.935234 K M 698 718 PSM DNLTLWTADNAGEEGGEAPQEPQS 406 sp|P31947|1433S_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 ms_run[1]:scan=1.1.4573.2 46.5369 3 2528.107271 2528.093920 R - 225 249 PSM NGSLDSPGKQDTEEDEEEDEKDK 407 sp|Q9Y266|NUDC_HUMAN 0 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 12-UNIMOD:21 ms_run[1]:scan=1.1.2959.4 18.79852 4 2674.038894 2673.045055 K G 134 157 PSM ETVSEESNVLCLSKSPNK 408 sp|P13639|EF2_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 11-UNIMOD:4,15-UNIMOD:21 ms_run[1]:scan=1.1.3712.3 32.18845 3 2099.949671 2099.944617 R H 581 599 PSM SFGSPNRAYTHQVVTR 409 sp|P50613|CDK7_HUMAN 1 userFasta.sprot_human_20200318 userFasta.sprot_human_20200318 [MS, MS:1002251, Comet, ] 14.0 4-UNIMOD:21 ms_run[1]:scan=1.1.3343.3 24.55245 3 1898.883071 1898.878860 K W 161 177