MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000151 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617205149466520^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_07_K3_1.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	57.0	null	352-UNIMOD:21	0.04	57.0	1	1	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	147-UNIMOD:21,162-UNIMOD:21	0.10	50.0	3	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	7330-UNIMOD:21,7344-UNIMOD:4,4521-UNIMOD:21	0.01	50.0	2	2	2
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	211-UNIMOD:35,175-UNIMOD:35,458-UNIMOD:21	0.14	50.0	10	4	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	null	145-UNIMOD:21,136-UNIMOD:21,139-UNIMOD:21	0.10	49.0	12	3	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	20-UNIMOD:21,19-UNIMOD:21,278-UNIMOD:21,281-UNIMOD:4,279-UNIMOD:21,21-UNIMOD:21	0.11	48.0	9	4	0
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21	0.05	48.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	79-UNIMOD:21	0.05	47.0	3	1	0
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null		0.18	46.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	102-UNIMOD:21,218-UNIMOD:35	0.26	46.0	5	2	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null		0.10	45.0	7	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	237-UNIMOD:4,141-UNIMOD:21	0.18	45.0	5	2	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	94-UNIMOD:35,37-UNIMOD:21,337-UNIMOD:4,339-UNIMOD:4,349-UNIMOD:21,357-UNIMOD:4	0.28	44.0	11	8	5
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	39-UNIMOD:21,41-UNIMOD:21,40-UNIMOD:21	0.01	44.0	2	2	2
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	104-UNIMOD:4,125-UNIMOD:21	0.30	44.0	13	5	3
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	162-UNIMOD:21,173-UNIMOD:4,163-UNIMOD:21	0.08	43.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	447-UNIMOD:4	0.10	43.0	3	3	3
PRT	sp|P31749|AKT1_HUMAN	RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	308-UNIMOD:21,310-UNIMOD:4,312-UNIMOD:21,306-UNIMOD:35,129-UNIMOD:21,137-UNIMOD:21,124-UNIMOD:21,126-UNIMOD:21,146-UNIMOD:21,147-UNIMOD:35,378-UNIMOD:21,160-UNIMOD:21	0.17	43.0	18	6	2
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	617-UNIMOD:21	0.02	42.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	675-UNIMOD:21,677-UNIMOD:21,670-UNIMOD:21	0.04	42.0	3	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	193-UNIMOD:21,190-UNIMOD:21,377-UNIMOD:21,186-UNIMOD:35	0.06	42.0	6	2	1
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	296-UNIMOD:4,308-UNIMOD:21	0.05	42.0	2	2	2
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	66-UNIMOD:21,62-UNIMOD:21,64-UNIMOD:21,68-UNIMOD:21	0.06	42.0	6	2	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	495-UNIMOD:35	0.12	42.0	4	3	2
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	426-UNIMOD:21	0.04	41.0	5	1	0
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	1542-UNIMOD:21,1688-UNIMOD:21,1692-UNIMOD:4,1220-UNIMOD:21	0.02	41.0	3	3	3
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	138-UNIMOD:35	0.10	41.0	4	2	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	173-UNIMOD:4,180-UNIMOD:21,194-UNIMOD:4	0.10	41.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	235-UNIMOD:35	0.24	40.0	11	5	3
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.10	40.0	3	1	0
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	359-UNIMOD:21,207-UNIMOD:21,409-UNIMOD:21	0.13	39.0	8	6	4
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	331-UNIMOD:21,333-UNIMOD:21,334-UNIMOD:21,359-UNIMOD:4,371-UNIMOD:35,374-UNIMOD:21,375-UNIMOD:4	0.18	39.0	7	4	2
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	360-UNIMOD:4,362-UNIMOD:21,366-UNIMOD:4,360-UNIMOD:385,109-UNIMOD:35	0.12	39.0	9	4	2
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1053-UNIMOD:21,1054-UNIMOD:35	0.02	39.0	7	1	0
PRT	sp|Q16637|SMN_HUMAN	Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	25-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.13	39.0	6	4	2
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	51-UNIMOD:21,63-UNIMOD:4	0.05	39.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	183-UNIMOD:35	0.19	39.0	2	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	641-UNIMOD:21	0.02	38.0	2	1	0
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	576-UNIMOD:4,584-UNIMOD:21	0.02	38.0	3	2	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	2-UNIMOD:1,17-UNIMOD:4,16-UNIMOD:35,199-UNIMOD:21	0.13	38.0	6	3	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	152-UNIMOD:21,153-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	43-UNIMOD:21,45-UNIMOD:21	0.18	37.0	3	3	3
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	60-UNIMOD:21	0.29	37.0	6	3	1
PRT	sp|O15013|ARHGA_HUMAN	Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	1287-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	236-UNIMOD:21,260-UNIMOD:4,273-UNIMOD:21	0.07	37.0	2	2	2
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	76-UNIMOD:21	0.06	37.0	4	2	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	22-UNIMOD:21,23-UNIMOD:4,30-UNIMOD:35	0.18	36.0	8	2	1
PRT	sp|O15530|PDPK1_HUMAN	3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	241-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.09	36.0	18	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	182-UNIMOD:21,183-UNIMOD:21,186-UNIMOD:21	0.02	36.0	6	4	2
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	449-UNIMOD:21,453-UNIMOD:21	0.01	36.0	3	1	0
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	175-UNIMOD:21,454-UNIMOD:21,459-UNIMOD:35	0.06	36.0	3	2	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	188-UNIMOD:21	0.03	36.0	4	1	0
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	99-UNIMOD:21,101-UNIMOD:4	0.07	35.0	4	2	0
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	202-UNIMOD:21	0.07	35.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	18-UNIMOD:21,63-UNIMOD:21,19-UNIMOD:21,16-UNIMOD:28,17-UNIMOD:21,176-UNIMOD:21	0.26	35.0	7	4	3
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	92-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	718-UNIMOD:21,719-UNIMOD:21	0.02	35.0	2	2	2
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	776-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.08	35.0	4	1	0
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	935-UNIMOD:21,1004-UNIMOD:21	0.04	35.0	2	2	2
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	1036-UNIMOD:21,1055-UNIMOD:4,294-UNIMOD:21,303-UNIMOD:4,292-UNIMOD:21	0.05	35.0	3	3	3
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	34.0	4	1	0
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1942-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1369-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	1184-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	493-UNIMOD:21,432-UNIMOD:21	0.06	34.0	5	2	1
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	473-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q8NHG8|ZNRF2_HUMAN	E3 ubiquitin-protein ligase ZNRF2 OS=Homo sapiens OX=9606 GN=ZNRF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	19-UNIMOD:21	0.11	34.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.08	34.0	1	1	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	426-UNIMOD:35,441-UNIMOD:21	0.05	34.0	3	1	0
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	722-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	2-UNIMOD:1	0.29	34.0	4	3	2
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.06	33.0	2	2	2
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	83-UNIMOD:21,91-UNIMOD:35,6-UNIMOD:4,7-UNIMOD:21	0.17	33.0	4	2	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	346-UNIMOD:21,349-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q14444|CAPR1_HUMAN	Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	644-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	42-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	7-UNIMOD:21	0.06	33.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	1542-UNIMOD:21,1541-UNIMOD:21,1043-UNIMOD:21,952-UNIMOD:21,956-UNIMOD:4,1539-UNIMOD:21,2692-UNIMOD:21	0.02	33.0	8	5	3
PRT	sp|Q96PU5|NED4L_HUMAN	E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	448-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	33.0	3	1	0
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P47736|RPGP1_HUMAN	Rap1 GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RAP1GAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	499-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	575-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	75-UNIMOD:21	0.06	33.0	2	2	2
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	626-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	2	2	2
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	696-UNIMOD:21,910-UNIMOD:21	0.03	32.0	4	2	0
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	881-UNIMOD:21,888-UNIMOD:35,466-UNIMOD:21	0.02	32.0	3	2	1
PRT	sp|Q9NP61|ARFG3_HUMAN	ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	367-UNIMOD:21,369-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	47-UNIMOD:21	0.18	32.0	11	3	1
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	366-UNIMOD:21,330-UNIMOD:21,328-UNIMOD:21,326-UNIMOD:21	0.11	31.0	6	4	2
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	235-UNIMOD:21,236-UNIMOD:21,240-UNIMOD:21	0.05	31.0	6	1	0
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	30-UNIMOD:21,38-UNIMOD:35	0.03	31.0	5	1	0
PRT	sp|O15068|MCF2L_HUMAN	Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	412-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	37-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	46-UNIMOD:21,39-UNIMOD:21,336-UNIMOD:21,339-UNIMOD:4,36-UNIMOD:21	0.12	31.0	11	6	4
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	46-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q9BZD3|GCOM2_HUMAN	Putative GRINL1B complex locus protein 2 OS=Homo sapiens OX=9606 GN=GCOM2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	179-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q96B23|CR025_HUMAN	Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	67-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	750-UNIMOD:21,753-UNIMOD:4,588-UNIMOD:21,316-UNIMOD:385,316-UNIMOD:4,317-UNIMOD:21,597-UNIMOD:21,752-UNIMOD:21,591-UNIMOD:21	0.04	31.0	7	6	5
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1669-UNIMOD:21,1676-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	94-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	847-UNIMOD:21,864-UNIMOD:4,849-UNIMOD:21,631-UNIMOD:21	0.05	31.0	3	2	1
PRT	sp|Q5VTR2|BRE1A_HUMAN	E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens OX=9606 GN=RNF20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	517-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,3-UNIMOD:21,139-UNIMOD:4	0.23	31.0	4	3	2
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,10-UNIMOD:21	0.02	31.0	3	2	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	113-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	490-UNIMOD:35	0.08	30.0	6	4	2
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	332-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	180-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	39-UNIMOD:21,63-UNIMOD:21	0.38	30.0	3	3	3
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	189-UNIMOD:21	0.09	30.0	7	5	4
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	58-UNIMOD:21,232-UNIMOD:21,249-UNIMOD:21,255-UNIMOD:4	0.20	30.0	6	4	2
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	206-UNIMOD:21,209-UNIMOD:35	0.03	30.0	3	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1709-UNIMOD:21,429-UNIMOD:21	0.02	30.0	3	2	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	126-UNIMOD:21,363-UNIMOD:21,124-UNIMOD:21	0.11	30.0	9	4	2
PRT	sp|Q12770|SCAP_HUMAN	Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens OX=9606 GN=SCAP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	822-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	108-UNIMOD:35	0.16	30.0	3	1	0
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	1167-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	75-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	24-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4	0.06	30.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	163-UNIMOD:21	0.08	29.0	4	4	4
PRT	sp|Q8IVL1|NAV2_HUMAN	Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1591-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	93-UNIMOD:21,57-UNIMOD:21,58-UNIMOD:21	0.34	29.0	10	4	2
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	20-UNIMOD:21,21-UNIMOD:35	0.03	29.0	2	1	0
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	152-UNIMOD:4,202-UNIMOD:21,45-UNIMOD:21,49-UNIMOD:4,37-UNIMOD:21	0.11	29.0	7	5	4
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	112-UNIMOD:21	0.03	29.0	2	2	2
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	29.0	null	627-UNIMOD:21,629-UNIMOD:21	0.01	29.0	2	2	2
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	114-UNIMOD:21,123-UNIMOD:4,117-UNIMOD:21	0.03	29.0	5	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	26-UNIMOD:21,27-UNIMOD:21	0.07	29.0	2	2	2
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	2690-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	533-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q6NYC1|JMJD6_HUMAN	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens OX=9606 GN=JMJD6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	380-UNIMOD:4,381-UNIMOD:21,394-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1384-UNIMOD:21,1389-UNIMOD:4,1760-UNIMOD:21	0.01	29.0	2	2	2
PRT	sp|Q9BRT2|UQCC2_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	79-UNIMOD:21	0.11	28.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	317-UNIMOD:21,467-UNIMOD:21	0.12	28.0	9	7	6
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	425-UNIMOD:21,424-UNIMOD:35,427-UNIMOD:21,434-UNIMOD:35	0.03	28.0	4	1	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	24-UNIMOD:21,67-UNIMOD:21,70-UNIMOD:4,77-UNIMOD:4,126-UNIMOD:21,130-UNIMOD:35,26-UNIMOD:21	0.12	28.0	6	3	0
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4	0.03	28.0	2	1	0
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.10	28.0	2	2	2
PRT	sp|Q14573|ITPR3_HUMAN	Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	2609-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	315-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.07	28.0	1	1	1
PRT	sp|Q8N7H5|PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	499-UNIMOD:21	0.16	28.0	2	2	2
PRT	sp|P25054|APC_HUMAN	Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1861-UNIMOD:21,1387-UNIMOD:4,1389-UNIMOD:21,2570-UNIMOD:21	0.02	28.0	3	3	3
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	156-UNIMOD:21	0.07	28.0	4	3	2
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q96T51|RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	74-UNIMOD:21,81-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	74-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	76-UNIMOD:21	0.06	27.0	2	2	2
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	323-UNIMOD:21,302-UNIMOD:21	0.14	27.0	7	5	3
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	114-UNIMOD:21,112-UNIMOD:21	0.07	27.0	3	1	0
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	925-UNIMOD:21,827-UNIMOD:21	0.02	27.0	7	2	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	234-UNIMOD:4	0.03	27.0	3	2	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	453-UNIMOD:21,451-UNIMOD:28,1244-UNIMOD:21	0.01	27.0	5	3	2
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	412-UNIMOD:4,452-UNIMOD:21	0.09	27.0	6	5	4
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	163-UNIMOD:4	0.05	27.0	2	2	2
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	363-UNIMOD:21	0.00	27.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	88-UNIMOD:21	0.10	27.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1317-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.26	27.0	2	2	2
PRT	sp|Q96GS4|BORC6_HUMAN	BLOC-1-related complex subunit 6 OS=Homo sapiens OX=9606 GN=BORCS6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	196-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q9Y6Q9|NCOA3_HUMAN	Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	716-UNIMOD:4,728-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	54-UNIMOD:21,192-UNIMOD:35	0.13	27.0	5	4	3
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,13-UNIMOD:21,21-UNIMOD:21	0.09	27.0	2	2	2
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	322-UNIMOD:21	0.13	26.0	4	4	4
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	933-UNIMOD:21,936-UNIMOD:35	0.01	26.0	4	1	0
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	15-UNIMOD:21	0.10	26.0	2	1	0
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	159-UNIMOD:21	0.06	26.0	2	1	0
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	652-UNIMOD:21	0.02	26.0	3	2	1
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	45-UNIMOD:21,43-UNIMOD:35	0.09	26.0	2	1	0
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	37-UNIMOD:21,33-UNIMOD:21	0.10	26.0	3	2	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	416-UNIMOD:21,1134-UNIMOD:21	0.01	26.0	2	2	2
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	46-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	105-UNIMOD:21,113-UNIMOD:4,106-UNIMOD:35	0.01	26.0	2	1	0
PRT	sp|Q05682-4|CALD1_HUMAN	Isoform 4 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	202-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	277-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	78-UNIMOD:21,82-UNIMOD:21,80-UNIMOD:28,83-UNIMOD:21	0.19	26.0	7	3	2
PRT	sp|P51946|CCNH_HUMAN	Cyclin-H OS=Homo sapiens OX=9606 GN=CCNH PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	12-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	455-UNIMOD:21	0.02	26.0	2	2	2
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	270-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	182-UNIMOD:21	0.08	26.0	3	2	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1288-UNIMOD:21,1293-UNIMOD:21	0.01	26.0	2	2	2
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	305-UNIMOD:21	0.05	26.0	2	2	2
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	24-UNIMOD:4	0.26	26.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	8-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	485-UNIMOD:21	0.06	25.0	2	2	2
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1799-UNIMOD:21,216-UNIMOD:21	0.01	25.0	2	2	2
PRT	sp|Q96JP5|ZFP91_HUMAN	E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	83-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	432-UNIMOD:21,429-UNIMOD:35	0.05	25.0	3	2	1
PRT	sp|Q9UN36|NDRG2_HUMAN	Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	332-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	678-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9NZN8|CNOT2_HUMAN	CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	157-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	171-UNIMOD:21	0.09	25.0	4	4	4
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	5-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q9BZ23|PANK2_HUMAN	Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	189-UNIMOD:21,168-UNIMOD:21,169-UNIMOD:21	0.06	25.0	3	2	1
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	193-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	52-UNIMOD:21,51-UNIMOD:21	0.09	25.0	4	1	0
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	455-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q13510|ASAH1_HUMAN	Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	301-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.20	25.0	1	1	1
PRT	sp|Q8N6T3|ARFG1_HUMAN	ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	361-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	602-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	94-UNIMOD:21	0.11	25.0	6	5	4
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	317-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	759-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q7Z4S6|KI21A_HUMAN	Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	855-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	474-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	277-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	416-UNIMOD:4,434-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	179-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	13-UNIMOD:21,11-UNIMOD:35	0.04	24.0	4	2	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	221-UNIMOD:21,199-UNIMOD:21	0.10	24.0	2	2	2
PRT	sp|O95835|LATS1_HUMAN	Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	464-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	479-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	193-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1158-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	268-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	186-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P45974|UBP5_HUMAN	Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	783-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	131-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	467-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	572-UNIMOD:21,584-UNIMOD:4,569-UNIMOD:21,579-UNIMOD:35	0.03	24.0	4	3	2
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	686-UNIMOD:21,688-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	111-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	325-UNIMOD:21,328-UNIMOD:4	0.07	24.0	2	2	2
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9H0H5|RGAP1_HUMAN	Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	251-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	227-UNIMOD:21,226-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	412-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	153-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1,2-UNIMOD:21,175-UNIMOD:21,174-UNIMOD:21,153-UNIMOD:21	0.09	24.0	5	3	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	260-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	458-UNIMOD:21,761-UNIMOD:21,1085-UNIMOD:21,1087-UNIMOD:21	0.02	23.0	4	4	4
PRT	sp|P49959|MRE11_HUMAN	Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	619-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	262-UNIMOD:21,118-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	58-UNIMOD:21	0.13	23.0	4	4	4
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	300-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	38-UNIMOD:21	0.09	23.0	3	1	0
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	184-UNIMOD:21,76-UNIMOD:21	0.04	23.0	2	2	2
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	467-UNIMOD:21,225-UNIMOD:4	0.07	23.0	4	3	2
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	131-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	211-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:21,78-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	299-UNIMOD:21,297-UNIMOD:21	0.05	23.0	3	1	0
PRT	sp|P49419|AL7A1_HUMAN	Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	84-UNIMOD:21	0.03	23.0	3	3	3
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	154-UNIMOD:21,156-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	393-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8TEU7|RPGF6_HUMAN	Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1070-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	29-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:21	0.14	23.0	2	2	2
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.14	23.0	1	1	1
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	199-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1835-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P31751|AKT2_HUMAN	RAC-beta serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	34-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	46-UNIMOD:21	0.14	22.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	96-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21	0.24	22.0	3	3	3
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	253-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P29353|SHC1_HUMAN	SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	139-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	57-UNIMOD:21,127-UNIMOD:21,129-UNIMOD:4	0.17	22.0	4	2	1
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	779-UNIMOD:21,340-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|Q69YQ0|CYTSA_HUMAN	Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	384-UNIMOD:21,395-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	2	2	2
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	163-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q9HCN8|SDF2L_HUMAN	Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens OX=9606 GN=SDF2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	38-UNIMOD:4,40-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9Y2K2|SIK3_HUMAN	Serine/threonine-protein kinase SIK3 OS=Homo sapiens OX=9606 GN=SIK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	626-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	45-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	492-UNIMOD:21,584-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.18	22.0	1	1	1
PRT	sp|Q9NVN8|GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	513-UNIMOD:21,518-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	256-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	68-UNIMOD:21,70-UNIMOD:4	0.09	22.0	2	2	2
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	270-UNIMOD:21,268-UNIMOD:35,269-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	533-UNIMOD:21,535-UNIMOD:4,538-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	700-UNIMOD:21,708-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1456-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	928-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	386-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q8TB72|PUM2_HUMAN	Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	587-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	249-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9H6H4|REEP4_HUMAN	Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	152-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	452-UNIMOD:21,453-UNIMOD:21,791-UNIMOD:21	0.01	21.0	2	2	2
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1493-UNIMOD:21,932-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q13610|PWP1_HUMAN	Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	485-UNIMOD:21	0.02	21.0	3	1	0
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	223-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	582-UNIMOD:21,608-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	161-UNIMOD:4,157-UNIMOD:21	0.21	21.0	5	3	2
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	112-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9NPD8|UBE2T_HUMAN	Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	184-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9UHY1|NRBP_HUMAN	Nuclear receptor-binding protein OS=Homo sapiens OX=9606 GN=NRBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	525-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	89-UNIMOD:21	0.14	21.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	339-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	709-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P19484|TFEB_HUMAN	Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	467-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q8N4C8|MINK1_HUMAN	Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	701-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	316-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	104-UNIMOD:21	0.05	21.0	3	2	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	310-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	305-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	89-UNIMOD:21,101-UNIMOD:4,488-UNIMOD:21	0.06	21.0	2	2	2
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	123-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|O00180|KCNK1_HUMAN	Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	329-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	2	2	2
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	42-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	370-UNIMOD:21,313-UNIMOD:21	0.02	20.0	2	2	2
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	12-UNIMOD:21,13-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	123-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	473-UNIMOD:21,2-UNIMOD:1,19-UNIMOD:21	0.07	20.0	3	3	3
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	96-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1460-UNIMOD:21,1461-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.06	20.0	3	2	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	518-UNIMOD:4,520-UNIMOD:21,518-UNIMOD:385,519-UNIMOD:21	0.01	20.0	3	1	0
PRT	sp|Q63ZY3|KANK2_HUMAN	KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	540-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1043-UNIMOD:21,1354-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	null	310-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1715-UNIMOD:21,1807-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	591-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	725-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O94763|RMP_HUMAN	Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	418-UNIMOD:21,420-UNIMOD:4,372-UNIMOD:21	0.08	20.0	2	2	2
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	401-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|Q69YH5|CDCA2_HUMAN	Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	977-UNIMOD:21,979-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	595-UNIMOD:21	0.01	20.0	2	2	2
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	105-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2336-UNIMOD:21,2152-UNIMOD:21,2160-UNIMOD:4	0.01	20.0	2	2	2
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	326-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q16875|F263_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	461-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P16615|AT2A2_HUMAN	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	493-UNIMOD:21,498-UNIMOD:4	0.01	20.0	2	1	0
PRT	sp|P68400|CSK21_HUMAN	Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	13-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1029-UNIMOD:21,1032-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	880-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	124-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|O15231|ZN185_HUMAN	Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	465-UNIMOD:21,466-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	996-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	61-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	10-UNIMOD:21	0.09	20.0	1	1	1
PRT	sp|Q86V85|GP180_HUMAN	Integral membrane protein GPR180 OS=Homo sapiens OX=9606 GN=GPR180 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	24-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	663-UNIMOD:21	0.03	20.0	2	1	0
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	199-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q676U5|A16L1_HUMAN	Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	287-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	115-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21,89-UNIMOD:21	0.20	19.0	3	3	3
PRT	sp|Q4ADV7|RIC1_HUMAN	RAB6A-GEF complex partner protein 1 OS=Homo sapiens OX=9606 GN=RIC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1019-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	369-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|O15169|AXIN1_HUMAN	Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	579-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P43897|EFTS_HUMAN	Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	57-UNIMOD:21,64-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	202-UNIMOD:21,203-UNIMOD:21,200-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	32-UNIMOD:21,135-UNIMOD:21	0.09	19.0	3	2	1
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2245-UNIMOD:21	0.00	19.0	1	1	1
PRT	sp|P60983|GMFB_HUMAN	Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	27-UNIMOD:21	0.08	19.0	1	1	1
PRT	sp|Q9HB09|B2L12_HUMAN	Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	242-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	37-UNIMOD:21	0.09	19.0	3	1	0
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	305-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	599-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	602-UNIMOD:4,604-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	601-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	114-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	306-UNIMOD:35	0.04	19.0	2	1	0
PRT	sp|O60825|F262_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	466-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P62072|TIM10_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	48-UNIMOD:21,50-UNIMOD:4	0.17	19.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	58-UNIMOD:21,61-UNIMOD:4	0.12	19.0	1	1	1
PRT	sp|Q96FS4|SIPA1_HUMAN	Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	55-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	19-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1204-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	136-UNIMOD:21	0.03	19.0	2	1	0
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	520-UNIMOD:21,618-UNIMOD:21	0.05	19.0	2	2	2
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	19.0	null	721-UNIMOD:28,726-UNIMOD:4,727-UNIMOD:21	0.02	19.0	2	2	2
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	2	2	2
PRT	sp|Q86TB9|PATL1_HUMAN	Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	179-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O75665|OFD1_HUMAN	Oral-facial-digital syndrome 1 protein OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	899-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	766-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	528-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	100-UNIMOD:21,197-UNIMOD:21	0.10	18.0	2	2	2
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	2	2	2
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	50-UNIMOD:21,52-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	520-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1442-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	205-UNIMOD:35,207-UNIMOD:21,212-UNIMOD:4	0.00	18.0	1	1	1
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	298-UNIMOD:21,387-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	561-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	815-UNIMOD:21,817-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	75-UNIMOD:21,85-UNIMOD:4,90-UNIMOD:4	0.20	18.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	206-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	746-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P15923-2|TFE2_HUMAN	Isoform E47 of Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	530-UNIMOD:21,528-UNIMOD:21	0.02	18.0	2	2	2
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	37-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	42-UNIMOD:4,46-UNIMOD:21,42-UNIMOD:385,44-UNIMOD:21	0.05	18.0	2	1	0
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1277-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9NQ39|RS10L_HUMAN	Putative 40S ribosomal protein S10-like OS=Homo sapiens OX=9606 GN=RPS10P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	157-UNIMOD:21	0.09	18.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	127-UNIMOD:21	0.13	18.0	1	1	1
PRT	sp|Q14738|2A5D_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	573-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	93-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	659-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|Q5JTD0|TJAP1_HUMAN	Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	547-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	494-UNIMOD:21,501-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	204-UNIMOD:21,211-UNIMOD:4	0.05	18.0	1	1	1
PRT	sp|Q8IX03|KIBRA_HUMAN	Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	929-UNIMOD:21,940-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2889-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	623-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9H2U1|DHX36_HUMAN	ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	162-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q86YD5|LRAD3_HUMAN	Low-density lipoprotein receptor class A domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LDLRAD3 PE=2 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	302-UNIMOD:21	0.11	18.0	1	1	1
PRT	sp|P27361|MK03_HUMAN	Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	198-UNIMOD:21,204-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	65-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	373-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	36-UNIMOD:21	0.07	17.0	2	1	0
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	249-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	464-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9BYW2|SETD2_HUMAN	Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1068-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	94-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	335-UNIMOD:4	0.06	17.0	2	2	2
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9H299|SH3L3_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	8-UNIMOD:21	0.12	17.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	97-UNIMOD:21,101-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	287-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	273-UNIMOD:21	0.04	17.0	2	2	2
PRT	sp|P25325-2|THTM_HUMAN	Isoform 2 of 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	17-UNIMOD:21,27-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|Q5TAX3|TUT4_HUMAN	Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1384-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9Y2I7|FYV1_HUMAN	1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	307-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P49590|SYHM_HUMAN	Histidine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	67-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q13480|GAB1_HUMAN	GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	387-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	633-UNIMOD:21	0.07	17.0	3	3	3
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	59-UNIMOD:21,69-UNIMOD:4	0.08	17.0	1	1	1
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	180-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q9UKV8|AGO2_HUMAN	Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	387-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q9P2N5|RBM27_HUMAN	RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	566-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P21731|TA2R_HUMAN	Thromboxane A2 receptor OS=Homo sapiens OX=9606 GN=TBXA2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	331-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	12-UNIMOD:21	0.10	17.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	47-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	240-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	182-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1153-UNIMOD:21	0.01	17.0	2	1	0
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	357-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	331-UNIMOD:21,620-UNIMOD:21,623-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	169-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q9NX55|HYPK_HUMAN	Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	38-UNIMOD:21	0.16	17.0	1	1	1
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	524-UNIMOD:21	0.03	17.0	2	2	2
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	417-UNIMOD:4,420-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	546-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1015-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9C0A0|CNTP4_HUMAN	Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	520-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	286-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	487-UNIMOD:35,488-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	43-UNIMOD:21,53-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	56-UNIMOD:21,57-UNIMOD:21	0.12	17.0	1	1	1
PRT	sp|Q8NHM5|KDM2B_HUMAN	Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1142-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	188-UNIMOD:4,190-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	110-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	127-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P53814|SMTN_HUMAN	Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	301-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P02686|MBP_HUMAN	Myelin basic protein OS=Homo sapiens OX=9606 GN=MBP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	169-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P27482|CALL3_HUMAN	Calmodulin-like protein 3 OS=Homo sapiens OX=9606 GN=CALML3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	377-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	637-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9P2B2|FPRP_HUMAN	Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	875-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	46-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	274-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q8TEB1|DCA11_HUMAN	DDB1- and CUL4-associated factor 11 OS=Homo sapiens OX=9606 GN=DCAF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	147-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q69YN4|VIR_HUMAN	Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1432-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	174-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1134-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	339-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	16.0	null	293-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	52-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|O94875|SRBS2_HUMAN	Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	843-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|O75592|MYCB2_HUMAN	E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	3478-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	246-UNIMOD:21,249-UNIMOD:4,263-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|Q9Y536|PAL4A_HUMAN	Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	40-UNIMOD:21	0.09	16.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	337-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	132-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	658-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	53-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1874-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q92609|TBCD5_HUMAN	TBC1 domain family member 5 OS=Homo sapiens OX=9606 GN=TBC1D5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	726-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9ULJ3|ZBT21_HUMAN	Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	411-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	23-UNIMOD:21,27-UNIMOD:4	0.30	16.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	79-UNIMOD:21	0.11	16.0	1	1	1
PRT	sp|Q9H8S9|MOB1A_HUMAN	MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:21,9-UNIMOD:21	0.05	16.0	2	2	2

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	SRTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRK	1	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	57.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3700.2	40.55337	5	4312.743618	4312.731332	R	C	350	386
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	2	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3772.2	41.78448	3	2988.165971	2988.155727	K	E	144	170
PSM	RGSDASDFDLLETQSACSDTSESSAAGGQGNSR	3	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.3688.2	40.34018	4	3442.398094	3442.385244	R	R	7328	7361
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	4	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0		ms_run[1]:scan=1.1.3325.3	31.82472	4	4445.562894	4445.553592	K	G	177	218
PSM	NGSLDSPGKQDTEEDEEEDEK	5	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	49.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2858.2	20.4621	3	2429.923271	2429.923149	K	D	134	155
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	6	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2971.3	23.05518	3	2739.157571	2739.163428	R	A	17	51
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	7	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2837.4	19.9743	4	3178.160894	3178.161241	R	K	494	522
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	8	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	38.45687	4	3724.482494	3724.469745	R	N	77	111
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	9	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3032.2	24.5906	3	2512.026671	2512.025203	R	A	19	51
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	10	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0		ms_run[1]:scan=1.1.3429.3	34.35007	4	3223.236894	3223.230486	K	-	122	148
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	11	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3844.3	43.24903	3	3393.356171	3393.345713	K	F	86	114
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	12	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=1.1.3392.4	33.45957	4	4118.446894	4118.435708	K	A	142	177
PSM	DNLTLWTSDTQGDEAEAGEGGEN	13	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=1.1.4100.2	47.89383	3	2407.997771	2407.988786	R	-	223	246
PSM	DNLTLWTSDSAGEECDAAEGAEN	14	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4155.2	48.60017	3	2453.985371	2453.976507	R	-	223	246
PSM	DATNVGDEGGFAPNILENK	15	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3895.2	44.11845	3	1959.924671	1959.917400	K	E	203	222
PSM	DNLTLWTSDTQGDEAEAGEGGEN	16	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.4090.2	47.68756	3	2407.997771	2407.988786	R	-	223	246
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	17	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3040.5	24.7955	3	2512.026671	2512.025203	R	A	19	51
PSM	SRTSSFTEQLDEGTPNRESGDTQSFAQK	18	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3478.2	35.4829	4	3262.355294	3262.345291	R	L	37	65
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	19	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3355.5	32.57018	3	3722.207171	3722.195067	K	A	158	190
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	20	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3316.3	31.6314	3	3722.207171	3722.195067	K	A	158	190
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	21	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3768.2	41.70547	4	3001.319694	3001.312460	K	E	160	186
PSM	LVQDVANNTNEEAGDGTTTATVLAR	22	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3417.6	34.063	3	2559.245171	2559.241253	K	S	97	122
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	23	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	7-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.4889.2	55.42907	3	3208.292171	3208.280765	K	A	302	329
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	24	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	12-UNIMOD:35	ms_run[1]:scan=1.1.3831.3	42.9952	4	3472.448894	3472.437249	R	-	207	238
PSM	ERIQQFDDGGSDEEDIWEEK	25	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3812.3	42.6475	3	2504.007671	2504.001674	K	H	607	627
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	26	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3861.5	43.61738	3	3014.195171	3014.188484	K	-	661	690
PSM	MLAESDESGDEESVSQTDKTELQNTLR	27	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3644.2	39.29958	4	3091.326494	3091.317665	K	T	186	213
PSM	TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	28	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3367.3	32.87508	3	3340.229171	3340.220589	R	G	294	325
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	29	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3433.2	34.43218	3	3351.386171	3351.389978	R	E	62	93
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	30	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3596.2	38.25652	4	3724.482494	3724.469745	R	N	77	111
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	31	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.4231.2	49.47432	4	3756.450894	3756.438824	K	A	469	503
PSM	VPSPLEGSEGDGDTD	32	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3360.2	32.68793	2	1553.578247	1553.577043	K	-	413	428
PSM	RASQGLLSSIENSESDSSEAK	33	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3656.3	39.61633	3	2274.006371	2274.001280	R	E	1540	1561
PSM	DSGSDEDFLMEDDDDSDYGSSK	34	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3560.5	37.4525	3	2443.867871	2443.860534	K	K	129	151
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	35	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	1-UNIMOD:4,8-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3407.2	33.82452	4	3213.350894	3213.342046	K	F	173	200
PSM	DNLTLWTSDMQGDGEEQNK	36	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3983.2	45.77423	3	2179.941371	2179.932792	R	E	226	245
PSM	TFCGTPEYLAPEVLEDNDYGR	37	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.4864.2	55.25408	3	2525.054471	2525.045787	K	A	308	329
PSM	DNLTLWTADNAGEEGGEAPQEPQS	38	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.4101.2	47.91952	3	2528.102471	2528.093920	R	-	225	249
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	39	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	5-UNIMOD:35,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.4383.2	50.8239	4	3144.318494	3144.309349	K	A	302	329
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	40	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3363.6	32.77263	3	3722.207171	3722.195067	K	A	158	190
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	41	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	35-UNIMOD:35	ms_run[1]:scan=1.1.3142.6	27.26973	4	4461.558894	4461.548507	K	G	177	218
PSM	AASIFGGAKPVDTAAR	42	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3351.2	32.4608	3	1610.787971	1610.781772	R	E	357	373
PSM	THSTSSSLGSGESPFSR	43	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3229.3	29.45592	3	1802.750171	1802.747237	R	S	329	346
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	44	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3615.2	38.68025	4	3724.482494	3724.469745	R	N	77	111
PSM	DKGDEEEEGEEKLEEK	45	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.2927.2	22.06068	3	1891.819571	1891.817077	K	Q	536	552
PSM	TMQGEGPQLLLSEAVSR	46	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4429.2	51.48405	3	1910.887571	1910.880894	K	A	1053	1070
PSM	TMQGEGPQLLLSEAVSR	47	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4420.2	51.28705	3	1910.887571	1910.880894	K	A	1053	1070
PSM	RGTGQSDDSDIWDDTALIK	48	sp|Q16637|SMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4039.2	46.83955	3	2171.940371	2171.937223	R	A	23	42
PSM	DNLTLWTSDMQGDGEEQNK	49	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3971.3	45.56405	3	2179.941371	2179.932792	R	E	226	245
PSM	DYEEVGVDSVEGEGEEEGEEY	50	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3929.2	44.78768	3	2347.905071	2347.897571	K	-	431	452
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	51	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	20-UNIMOD:21,32-UNIMOD:4	ms_run[1]:scan=1.1.3690.2	40.39132	4	3813.492494	3813.463279	R	G	32	65
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	52	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.4616.2	53.24412	4	3128.328494	3128.314434	K	A	302	329
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	53	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	5-UNIMOD:35,7-UNIMOD:21,9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=1.1.4594.2	53.08618	4	3224.289294	3224.275680	K	A	302	329
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	54	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3246.6	29.89208	4	4245.554894	4245.543285	K	S	158	195
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	55	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3653.3	39.53965	4	4267.678894	4267.667337	K	L	164	202
PSM	TMQGEGPQLLLSEAVSR	56	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4700.2	53.92177	3	1894.893371	1894.885979	K	A	1053	1070
PSM	DATNVGDEGGFAPNILENK	57	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3881.2	43.93297	3	1959.924671	1959.917400	K	E	203	222
PSM	TPEELDDSDFETEDFDVR	58	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4190.3	49.08243	3	2237.858171	2237.852550	R	S	634	652
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	59	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3206.6	28.88892	3	2779.103771	2779.094999	K	M	571	596
PSM	DDDIAALVVDNGSGMCK	60	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4839.2	55.02427	2	1820.7965	1820.7915	M	A	2	19
PSM	RRNSCNVGGGGGGFK	61	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2717.2	18.1193	3	1601.692571	1601.688223	K	H	149	164
PSM	MLAESDESGDEESVSQTDKTELQNTLR	62	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3655.2	39.59075	4	3091.326494	3091.317665	K	T	186	213
PSM	TLTTVQGIADDYDK	63	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3816.2	42.72945	2	1618.715647	1618.712749	K	K	43	57
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	64	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3852.3	43.45208	4	3393.359694	3393.345713	K	F	86	114
PSM	TMQGEGPQLLLSEAVSR	65	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4676.2	53.7146	3	1894.893371	1894.885979	K	A	1053	1070
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	66	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3797.2	42.2925	4	3932.722494	3932.709658	K	T	6	40
PSM	SDLSSSSGSLSLSHGSSSLEHR	67	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3253.2	30.05813	4	2296.002494	2295.996863	K	S	1279	1301
PSM	RFSQGPTPAAAVPEGTAAEGAPR	68	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3307.2	31.40003	3	2317.092971	2317.085224	R	Q	234	257
PSM	DNLTLWTSDTQGDEAEAGEGGEN	69	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.4114.2	48.09613	3	2407.997771	2407.988786	R	-	223	246
PSM	DSGSDEDFLMEDDDDSDYGSSK	70	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3779.3	41.92405	3	2427.873671	2427.865619	K	K	129	151
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	71	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3758.4	41.58135	3	2988.165971	2988.155727	K	E	144	170
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	72	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3160.6	27.72767	4	3365.456094	3365.451593	K	K	799	833
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	73	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3152.3	27.52445	4	3365.456094	3365.451593	K	K	799	833
PSM	ATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	74	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	6-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3248.4	29.93665	4	3668.420494	3668.406493	K	G	291	325
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	75	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3333.6	32.03131	4	4445.562894	4445.553592	K	G	177	218
PSM	RGQTCVVHYTGMLEDGK	76	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3396.4	33.56142	3	2029.878371	2029.875097	K	K	19	36
PSM	ANSFVGTAQYVSPELLTEK	77	sp|O15530|PDPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4395.2	50.9207	3	2133.010871	2133.003118	R	S	239	258
PSM	DNLTLWTSDQQDDDGGEGNN	78	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4044.2	46.94652	3	2192.876771	2192.873028	R	-	228	248
PSM	SRINSSGESGDESDEFLQSR	79	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3308.3	31.41598	3	2278.940471	2278.933928	R	K	178	198
PSM	CESAPGCGVWQRPVIDNPNYK	80	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3637.4	39.12992	3	2526.090371	2526.082130	R	G	360	381
PSM	SQTTTERDSDTDVEEEELPVENR	81	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3344.4	32.29519	3	2758.149971	2758.145437	R	E	445	468
PSM	KASSDLDQASVSPSEEENSESSSESEK	82	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3038.3	24.74405	3	2922.180671	2922.177526	R	T	172	199
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	83	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3284.6	30.8652	4	4431.618894	4431.610713	K	A	139	177
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	84	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3281.3	30.78832	5	4431.625118	4431.610713	K	A	139	177
PSM	RDSFDDRGPSLNPVLDYDHGSR	85	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3577.3	37.86467	4	2597.140094	2597.129609	R	S	186	208
PSM	MLAESDESGDEESVSQTDKTELQNTLR	86	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3812.2	42.6375	4	3171.295294	3171.283996	K	T	186	213
PSM	RVSVCAETYNPDEEEEDTDPR	87	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3270.6	30.5072	3	2590.022471	2590.016672	R	V	97	118
PSM	TLSNAEDYLDDEDSD	88	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4136.2	48.34767	2	1780.625047	1780.620031	R	-	200	215
PSM	QYTSPEEIDAQLQAEK	89	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3748.3	41.3998	3	1928.845271	1928.840469	R	Q	16	32
PSM	SVSTPSEAGSQDSGDGAVGSR	90	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2938.4	22.29402	3	2029.826471	2029.822587	K	T	92	113
PSM	RSYSSPDITQAIQEEEK	91	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3586.2	38.07513	3	2059.916471	2059.909945	K	R	715	732
PSM	KLSLGQYDNDAGGQLPFSK	92	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3925.3	44.72365	3	2116.988771	2116.983051	R	C	774	793
PSM	DNLTLWTSDQQDEEAGEGN	93	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4035.2	46.77807	3	2120.882171	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	94	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3997.3	46.09605	3	2192.877071	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	95	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4006.2	46.30752	3	2192.877071	2192.873028	R	-	228	248
PSM	TPEELDDSDFETEDFDVR	96	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4210.4	49.285	3	2237.858171	2237.852550	R	S	634	652
PSM	RNTTQNTGYSSGTQNANYPVR	97	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3004.5	23.89248	3	2408.053871	2408.050630	R	A	933	954
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	98	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3897.2	44.18023	3	3014.201171	3014.188484	K	-	661	690
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	99	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	1-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=1.1.3564.6	37.55535	4	3431.369694	3431.356309	R	E	62	93
PSM	WVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPK	100	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	11-UNIMOD:21,30-UNIMOD:4	ms_run[1]:scan=1.1.3461.5	35.04685	4	4316.574894	4316.565632	K	K	1026	1063
PSM	PCSEETPAISPSK	101	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2944.4	22.42652	2	1481.6101	1481.6104	M	R	2	15
PSM	PCSEETPAISPSK	102	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2954.4	22.63802	2	1481.6101	1481.6104	M	R	2	15
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	103	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3460.5	35.0177	4	3054.257694	3054.246274	K	N	1928	1956
PSM	RSSLSSHSHQSQIYR	104	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2770.3	18.78775	4	1851.845694	1851.837724	R	S	1367	1382
PSM	QYTSPEEIDAQLQAEK	105	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3737.3	41.17977	3	1928.845271	1928.840469	R	Q	16	32
PSM	SNSVGIQDAFNDGSDSTFQK	106	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3848.2	43.3507	3	2195.903771	2195.900837	R	R	1182	1202
PSM	DNLTLWTSDMQGDGEEQNK	107	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3652.3	39.51408	3	2195.933171	2195.927707	R	E	226	245
PSM	ARSVDALDDLTPPSTAESGSR	108	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3536.2	36.85507	3	2224.004471	2224.000886	R	S	491	512
PSM	AGEEDEGEEDSDSDYEISAK	109	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3171.5	27.99125	3	2253.800471	2253.795823	R	A	463	483
PSM	AYSGSDLPSSSSGGANGTAGGGGGAR	110	sp|Q8NHG8|ZNRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3051.4	25.07575	3	2276.933171	2276.929512	R	A	17	43
PSM	DNLTLWTSDTQGDEAEAGEGGEN	111	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4131.2	48.29738	3	2407.997771	2407.988786	R	-	223	246
PSM	KVEEEQEADEEDVSEEEAESK	112	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3015.5	24.1545	3	2437.015271	2437.013998	K	E	234	255
PSM	TFCGTPEYLAPEVLEDNDYGR	113	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.4840.3	55.04895	3	2525.054471	2525.045787	K	A	308	329
PSM	CESAPGCGVWQRPVIDNPNYK	114	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3628.2	38.91891	3	2526.090371	2526.082130	R	G	360	381
PSM	RVSVCAETYNPDEEEEDTDPR	115	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3278.5	30.70793	3	2590.022471	2590.016672	R	V	97	118
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	116	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3138.4	27.1686	3	2758.062071	2758.058931	R	E	424	448
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	117	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4007.2	46.34143	3	2881.101071	2881.094982	K	T	701	725
PSM	SISQSSTDSYSSAASYTDSSDDEVSPR	118	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3452.6	34.85238	3	2908.149371	2908.140746	R	E	66	93
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	119	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3850.6	43.4012	3	3014.195171	3014.188484	K	-	661	690
PSM	ADQLTEEQIAEFK	120	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4096.2	47.81408	2	1562.7483	1562.7459	M	E	2	15
PSM	VAEDEAEAAAAAK	121	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.2903.2	21.47818	2	1244.592047	1244.588461	K	F	148	161
PSM	AITGASLADIMAK	122	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4127.3	48.25293	2	1340.643247	1340.641104	R	R	81	94
PSM	LVEDERSDREETESSEGEEAAAGGGAK	123	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2910.4	21.65488	4	2967.166894	2967.165595	K	S	335	362
PSM	GGYDGYRPSFSNTPNSGYTQSQFSAPR	124	sp|Q14444|CAPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3648.2	39.41215	4	3020.285294	3020.272644	R	D	634	661
PSM	SSSSSSGGGLLPYPR	125	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3605.2	38.4821	2	1530.674247	1530.671553	R	R	40	55
PSM	GYSFSLTTFSPSGK	126	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4495.2	52.2721	2	1557.678047	1557.675241	R	L	5	19
PSM	SRSGSSQELDVKPSASPQER	127	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2917.4	21.83192	4	2224.017694	2224.012119	R	S	1537	1557
PSM	SLSSPTVTLSAPLEGAK	128	sp|Q96PU5|NED4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3906.2	44.38137	2	1736.865247	1736.859748	R	D	446	463
PSM	QVPDSAATATAYLCGVK	129	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3818.2	42.78015	3	1830.825971	1830.822317	R	A	107	124
PSM	DAGDKDKEQELSEEDK	130	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.2750.2	18.50573	3	1834.809971	1834.806846	R	Q	35	51
PSM	RSSAIGIENIQEVQEK	131	sp|P47736|RPGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3450.4	34.79445	3	1879.908671	1879.904072	R	R	497	513
PSM	QLDETNALLRTESDTAAR	132	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3442.2	34.63057	3	2082.957371	2082.958293	R	L	563	581
PSM	DNLTLWTSDQQDDDGGEGNN	133	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.4016.2	46.51333	3	2192.876771	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	134	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3660.3	39.71777	3	2195.933171	2195.927707	R	E	226	245
PSM	ARSVDALDDLTPPSTAESGSR	135	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3540.3	36.95837	3	2224.004471	2224.000886	R	S	491	512
PSM	KQTIDNSQGAYQEAFDISKK	136	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3437.2	34.52483	4	2350.085694	2350.084221	R	E	139	159
PSM	DNLTLWTSDTQGDEAEAGEGGEN	137	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.4078.2	47.48478	3	2407.997771	2407.988786	R	-	223	246
PSM	RDSFDDRGPSLNPVLDYDHGSR	138	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3572.2	37.74582	5	2597.137118	2597.129609	R	S	186	208
PSM	RDSFDDRGPSLNPVLDYDHGSR	139	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3571.2	37.72012	5	2597.137118	2597.129609	R	S	186	208
PSM	RLSESSALKQPATPTAAESSEGEGEEGDDGGETESR	140	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3184.6	28.32685	4	3743.594894	3743.591925	R	E	73	109
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	141	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3276.4	30.66012	4	4431.618894	4431.610713	K	A	139	177
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	142	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	37-UNIMOD:35	ms_run[1]:scan=1.1.3087.5	25.99505	4	4447.606894	4447.605628	K	A	139	177
PSM	RGQTCVVHYTGMLEDGK	143	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3404.2	33.7664	4	2029.879694	2029.875097	K	K	19	36
PSM	AITGASLADIMAK	144	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4110.3	48.05173	2	1340.643247	1340.641104	R	R	81	94
PSM	KHTLSYVDVGTGK	145	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3086.2	25.96005	3	1483.709171	1483.707210	R	V	624	637
PSM	LAVDEEENADNNTK	146	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.2883.2	21.0691	2	1560.688047	1560.690360	K	A	40	54
PSM	DVAEAKPELSLLGDGDH	147	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3684.2	40.22438	3	1764.856871	1764.853008	R	-	232	249
PSM	RSTQGVTLTDLQEAEK	148	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3429.2	34.34007	3	1854.873671	1854.872438	R	T	694	710
PSM	TMQGEGPQLLLSEAVSR	149	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4406.2	51.08507	3	1910.887571	1910.880894	K	A	1053	1070
PSM	SESLDPDSSMDTTLILK	150	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4232.2	49.49915	3	1930.853471	1930.848256	R	D	879	896
PSM	SGSSQELDVKPSASPQER	151	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3018.4	24.22423	3	1980.880571	1980.878980	R	S	1539	1557
PSM	SSSFSSWDDSSDSYWKK	152	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3775.2	41.86063	3	2077.800671	2077.794247	R	E	365	382
PSM	QFYDQALQQAVVDDDANNAK	153	sp|P60033|CD81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3833.3	43.04547	3	2252.037671	2252.034555	K	A	125	145
PSM	DNLTLWTSENQGDEGDAGEGEN	154	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3994.4	46.02362	3	2349.953171	2349.946922	R	-	225	247
PSM	DNLTLWTSDSAGEECDAAEGAEN	155	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4138.2	48.39775	3	2453.985371	2453.976507	R	-	223	246
PSM	DNLTLWTADNAGEEGGEAPQEPQS	156	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4115.2	48.12088	3	2528.102471	2528.093920	R	-	225	249
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	157	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4061.3	47.21757	4	3456.456894	3456.442334	R	-	207	238
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	158	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3364.6	32.79845	4	3722.204894	3722.195067	K	A	158	190
PSM	SRSHTSEGAHLDITPNSGAAGNSAGPK	159	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2992.3	23.57953	4	2698.212894	2698.209650	R	S	362	389
PSM	RLSSLRASTSK	160	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2972.2	23.08568	2	1364.621247	1364.621446	R	S	233	244
PSM	TLTIVDTGIGMTK	161	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4080.2	47.53539	2	1428.696847	1428.693534	R	A	28	41
PSM	ALSLDGEQLIGNK	162	sp|O15068|MCF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3936.3	44.96307	2	1436.694447	1436.691226	R	H	410	423
PSM	TMSEVGGSVEDLIAK	163	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4521.3	52.47533	2	1614.726247	1614.721205	R	G	35	50
PSM	RLQSIGTENTEENRR	164	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2921.4	21.9269	4	1881.875694	1881.869418	K	F	43	58
PSM	TMQGEGPQLLLSEAVSR	165	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4721.2	54.1273	3	1894.893371	1894.885979	K	A	1053	1070
PSM	SQSLPNSLDYTQTSDPGR	166	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3502.3	36.02633	3	2044.877171	2044.873894	R	H	44	62
PSM	DYEEVGADSADGEDEGEEY	167	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3485.6	35.66353	2	2077.743447	2077.739614	K	-	431	450
PSM	VSSQAEDTSSSFDNLFIDR	168	sp|Q9BZD3|GCOM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4705.2	54.00852	3	2196.928871	2196.921238	R	L	177	196
PSM	RDSSESQLASTESDKPTTGR	169	sp|Q96B23|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2866.6	20.6628	4	2230.974894	2230.970314	R	V	64	84
PSM	RTSSTCSNESLSVGGTSVTPR	170	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3166.4	27.87553	3	2261.996771	2261.994755	K	R	748	769
PSM	RNSEGSELSCTEGSLTSSLDSR	171	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3640.4	39.20016	3	2451.029171	2451.022092	R	R	1667	1689
PSM	TFCGTPEYLAPEVLEDNDYGR	172	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.4640.2	53.4324	3	2525.048171	2525.045787	K	A	308	329
PSM	DNLTLWTADNAGEEGGEAPQEPQS	173	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4092.2	47.71757	3	2528.102471	2528.093920	R	-	225	249
PSM	LGADESEEEGRRGSLSNAGDPEIVK	174	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3199.6	28.71438	4	2694.224894	2694.213398	R	S	81	106
PSM	TASISSSPSEGTPTVGSYGCTPQSLPK	175	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.3565.6	37.58065	3	2775.239771	2775.231022	R	F	845	872
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	176	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3747.3	41.3679	3	2988.165071	2988.155727	K	E	144	170
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	177	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3539.6	36.93267	4	3459.439294	3459.429735	K	L	104	135
PSM	SGSALLQSQSSTEDPKDEPAELKPDSEDLSSQSSASK	178	sp|Q5VTR2|BRE1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3457.4	34.94373	4	3914.755694	3914.743006	R	A	515	552
PSM	ASGVAVSDGVIK	179	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3651.2	39.48872	2	1223.5818	1223.5794	M	V	2	14
PSM	ADEAPRKGSFSALVGR	180	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3467.6	35.20142	3	1781.8504	1781.8456	M	T	2	18
PSM	RSSQPSPTAVPASDSPPTK	181	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2932.5	22.14348	3	1988.920871	1988.920451	R	Q	111	130
PSM	EGLELPEDEEEK	182	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3351.3	32.4708	2	1415.632447	1415.630385	K	K	412	424
PSM	KGSLESPATDVFGSTEEGEK	183	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3551.4	37.2224	3	2146.935971	2146.930741	R	R	330	350
PSM	AGSISTLDSLDFAR	184	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4307.2	50.08947	2	1531.694847	1531.691954	R	Y	178	192
PSM	KHHEEEIVHHKK	185	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2673.2	17.57027	3	1549.815671	1549.811359	K	E	72	84
PSM	NGRVEIIANDQGNR	186	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2948.2	22.5163	3	1554.787871	1554.786266	K	I	47	61
PSM	KQSLGELIGTLNAAK	187	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4045.2	46.97152	3	1621.849571	1621.844038	R	V	56	71
PSM	RGSLEMSSDGEPLSR	188	sp|Q6ZN18|AEBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3196.2	28.62327	3	1699.728371	1699.723665	R	M	204	219
PSM	SSGSEGSSPNWLQALK	189	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4350.2	50.45913	3	1726.761371	1726.756345	K	L	1708	1724
PSM	TSSLTQFPPSQSEER	190	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3578.4	37.89005	3	1772.763071	1772.761825	R	S	124	139
PSM	RDSGVGSGLEAQESWER	191	sp|Q12770|SCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3419.3	34.1078	3	1941.825071	1941.821799	R	L	820	837
PSM	KEESEESDDDMGFGLFD	192	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4467.2	52.01797	2	1948.757847	1948.752033	K	-	98	115
PSM	ANSGGVDLDSSGEFASIEK	193	sp|Q92766|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	43.23903	3	1961.828771	1961.825547	R	M	1165	1184
PSM	INSSGESGDESDEFLQSR	194	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3458.2	34.95947	3	2035.804571	2035.800789	R	K	180	198
PSM	SRTHSTSSSLGSGESPFSR	195	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3098.2	26.23403	4	2045.884894	2045.880377	R	S	327	346
PSM	ALRTDYNASVSVPDSSGPER	196	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3296.4	31.17315	3	2199.985871	2199.979756	K	I	67	87
PSM	ARSVDALDDLTPPSTAESGSR	197	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3544.2	37.04508	3	2224.004471	2224.000886	R	S	491	512
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	198	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.3686.3	40.27893	4	2861.134494	2861.124466	R	L	22	47
PSM	DNLTLWTSDQQDDDGGEGNN	199	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4068.2	47.36298	3	2194.879271	2192.873028	R	-	228	248
PSM	DAGTIAGLNVLR	200	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4160.2	48.66953	2	1278.635447	1278.633317	K	I	160	172
PSM	NGRKTLTTVQGIADDYDK	201	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3402.2	33.70538	3	2073.976871	2073.973214	R	K	39	57
PSM	THSLSNADGQYDPYTDSR	202	sp|Q8IVL1|NAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3208.5	28.93932	3	2105.841071	2105.832758	R	F	1589	1607
PSM	FASENDLPEWK	203	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3899.4	44.22923	2	1414.582647	1414.580613	R	E	58	69
PSM	FASENDLPEWK	204	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3887.3	44.00968	2	1414.582647	1414.580613	R	E	58	69
PSM	TPELNLDQFHDK	205	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3466.3	35.16855	3	1455.701771	1455.699408	K	T	171	183
PSM	STGGAPTFNVTVTK	206	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3495.4	35.87715	2	1458.679247	1458.675576	K	T	92	106
PSM	SGSMDPSGAHPSVR	207	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2869.3	20.73143	3	1463.586671	1463.586443	R	Q	18	32
PSM	CDENILWLDYK	208	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4213.2	49.3216	2	1467.673647	1467.670417	K	N	152	163
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	209	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3755.3	41.49748	4	3001.319694	3001.312460	K	E	160	186
PSM	RNSLTGEEGQLAR	210	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3060.3	25.29675	3	1509.693071	1509.693685	R	V	110	123
PSM	VPSPLEGSEGDGDTD	211	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3352.5	32.49245	2	1553.578247	1553.577043	K	-	413	428
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	212	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	27-UNIMOD:21	ms_run[1]:scan=1.1.2935.3	22.21865	4	3173.333694	3173.326984	K	E	337	367
PSM	DSGSDEDFLMEDDDDSDYGSSK	213	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3790.4	42.13213	3	2427.873671	2427.865619	K	K	129	151
PSM	RPSESDKEDELDK	214	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2712.2	18.03325	3	1626.678671	1626.677426	R	V	625	638
PSM	TSSLTQFPPSQSEER	215	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3535.2	36.82975	3	1772.763371	1772.761825	R	S	124	139
PSM	TLSNAEDYLDDEDSD	216	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4116.2	48.14567	2	1780.625047	1780.620031	R	-	200	215
PSM	HVPDSGATATAYLCGVK	217	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3479.4	35.50267	3	1825.812371	1825.807001	K	G	110	127
PSM	GEAAAERPGEAAVASSPSK	218	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2815.2	19.46343	3	1863.839771	1863.836387	K	A	12	31
PSM	TMQGEGPQLLLSEAVSR	219	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4647.2	53.51402	3	1894.893371	1894.885979	K	A	1053	1070
PSM	AMSLVSSDSEGEQNELR	220	sp|Q14643|ITPR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3532.2	36.73963	3	1930.802171	1930.797952	R	N	2688	2705
PSM	SSSFSSWDDSSDSYWK	221	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4177.3	48.92577	2	1949.704447	1949.699284	R	K	365	381
PSM	QLLTLSSELSQARDENK	222	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3958.3	45.34842	3	2010.969371	2010.962315	R	R	530	547
PSM	INSSGESGDESDEFLQSR	223	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3466.4	35.17522	3	2035.804571	2035.800789	R	K	180	198
PSM	YAALSVDGEDENEGEDYAE	224	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3612.2	38.60433	3	2074.819871	2074.812719	K	-	593	612
PSM	TCSMVGNGDTTSQDDCVSK	225	sp|Q6NYC1|JMJD6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4,3-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.2977.5	23.20572	3	2140.781771	2140.774851	R	E	379	398
PSM	DNLTLWTSDQQDDDGGEGNN	226	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.4033.3	46.72161	3	2192.876771	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	227	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.4095.2	47.78987	3	2192.877371	2192.873028	R	-	228	248
PSM	KGSSSSVCSVASSSDISLGSTK	228	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3333.5	32.02798	3	2209.984871	2209.977373	R	T	1382	1404
PSM	SGSPSDNSGAEEMEVSLAKPK	229	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3411.2	33.9274	3	2278.911371	2278.906590	R	H	122	143
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	230	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3347.5	32.3722	3	3722.207171	3722.195067	K	A	158	190
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	231	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3249.5	29.96562	5	4245.559118	4245.543285	K	S	158	195
PSM	DDDIAALVVDNGSGMCK	232	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4398.2	50.96773	2	1836.7922	1836.7865	M	A	2	19
PSM	NGSLDSPGKQDTEEDEEEDEK	233	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2902.2	21.453	3	2430.906671	2429.923149	K	D	134	155
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	234	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3806.2	42.50445	5	3933.727118	3932.709658	K	T	6	40
PSM	EALQDVEDENQ	235	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3148.4	27.41552	2	1288.542847	1288.541905	K	-	245	256
PSM	DNLTLWTSDMQGDGEEQNK	236	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3995.2	46.04128	3	2179.941071	2179.932792	R	E	226	245
PSM	DTSFSGLSLEEYK	237	sp|Q9BRT2|UQCC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4097.2	47.8384	2	1554.653247	1554.649086	R	L	77	90
PSM	SLTNDWEDHLAVK	238	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3804.2	42.45183	3	1606.704371	1606.702853	K	H	315	328
PSM	RMTGSEFDFEEMK	239	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3731.2	41.0453	3	1685.655671	1685.646660	K	R	423	436
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	240	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3864.2	43.67208	4	3393.359694	3393.345713	K	F	86	114
PSM	GVSLTNHHFYDESK	241	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3228.2	29.42828	3	1712.723171	1712.719566	R	P	22	36
PSM	GGSVLVTCSTSCDQPK	242	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3134.2	27.08857	3	1774.730471	1774.726702	R	L	41	57
PSM	HVPDSGATATAYLCGVK	243	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3487.3	35.70523	3	1825.812371	1825.807001	K	G	110	127
PSM	GADFLVTEVENGGSLGSK	244	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4210.3	49.27833	3	1858.837871	1858.834990	K	K	189	207
PSM	RLQSIGTENTEENRR	245	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2930.2	22.1037	3	1881.873071	1881.869418	K	F	43	58
PSM	DWILPSDYDHAEAEAR	246	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3821.2	42.85528	3	1886.849471	1886.843506	K	H	256	272
PSM	AMSLVSNEGEGEQNEIR	247	sp|Q14573|ITPR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3494.3	35.85158	3	1941.823871	1941.813937	R	I	2607	2624
PSM	SLDSDESEDEEDDYQQK	248	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3033.4	24.61655	3	2110.741271	2110.737580	K	R	57	74
PSM	AMTLSPQEEVAAGQMASSSR	249	sp|Q9Y6A5|TACC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3743.4	41.2686	3	2129.916971	2129.912270	R	S	313	333
PSM	HTGCCGDNDPIDVCEIGSK	250	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3286.5	30.91332	3	2132.857871	2132.856139	K	V	110	129
PSM	INSSGESGDESDEFLQSRK	251	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3245.4	29.85975	3	2163.899471	2163.895752	R	G	180	199
PSM	DNLTLWTSDQQDDDGGEGNN	252	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4105.2	48.00127	3	2192.877371	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	253	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4189.2	49.05757	3	2192.877371	2192.873028	R	-	228	248
PSM	RTGSNISGASSDISLDEQYK	254	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3369.6	32.92678	3	2206.977371	2206.974337	K	H	376	396
PSM	DKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQR	255	sp|Q8N7H5|PAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3156.6	27.62527	4	4505.746894	4505.722755	R	S	449	493
PSM	NDSLSSLDFDDDDVDLSREK	256	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3984.3	45.7995	3	2363.937071	2363.964226	R	A	1859	1879
PSM	DNLTLWTSDTQGDEAEAGEGGEN	257	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4145.2	48.49847	3	2407.997771	2407.988786	R	-	223	246
PSM	SISQSSTDSYSSAASYTDSSDDEVSPR	258	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3474.6	35.38075	3	2908.148471	2908.140746	R	E	66	93
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	259	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3371.6	32.97797	3	3722.207171	3722.195067	K	A	158	190
PSM	SDSSSKKDVIELTDDSFDK	260	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3569.4	37.67325	3	2194.957271	2194.951870	R	N	154	173
PSM	ADHSFSDGVPSDSVEAAK	261	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3406.3	33.79182	3	1939.7864	1939.7832	M	N	2	20
PSM	RATGNLSASCGSALR	262	sp|Q96T51|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2978.3	23.23038	3	1599.721571	1599.718854	R	A	72	87
PSM	SLGLSLSGGDQEDAGR	263	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3623.2	38.81013	3	1640.718071	1640.704310	R	I	70	86
PSM	DSGRGDSVSDSGSDALR	264	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2896.2	21.30722	3	1759.703171	1759.701015	R	S	70	87
PSM	SADTLWDIQK	265	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3603.2	38.43202	2	1175.583047	1175.582253	K	D	320	330
PSM	GGPGSTLSFVGK	266	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3521.2	36.46453	2	1185.543247	1185.543105	K	R	107	119
PSM	LATNTSAPDLK	267	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3059.2	25.28107	2	1209.563647	1209.564234	R	N	923	934
PSM	DAGTIAGLNVMR	268	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3934.2	44.91295	2	1296.590647	1296.589737	K	I	186	198
PSM	AITGASLADIMAK	269	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3570.2	37.6915	2	1356.636847	1356.636019	R	R	81	94
PSM	SQTTTERDSDTDVEEEELPVENR	270	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3352.4	32.48912	4	2758.154894	2758.145437	R	E	445	468
PSM	TLTIVDTGIGMTK	271	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4146.2	48.5233	2	1428.695447	1428.693534	R	A	28	41
PSM	DNPGVVTCLDEAR	272	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3382.2	33.22113	3	1444.664471	1444.661643	K	H	227	240
PSM	RQQSEISAAVER	273	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2997.4	23.70648	3	1452.674771	1452.672222	R	A	450	462
PSM	CLELFSELAEDK	274	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4419.2	51.26128	2	1452.684447	1452.680647	K	E	412	424
PSM	DNLTLWTSDQQDDDGGEGNN	275	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4209.2	49.2602	3	2192.877371	2192.873028	R	-	228	248
PSM	NRVIGSGCNLDSAR	276	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2944.2	22.41318	3	1517.740571	1517.736873	K	F	156	170
PSM	TGSTSSKEDDYESDAATIVQK	277	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3401.3	33.6895	3	2310.975971	2310.974062	R	C	360	381
PSM	VPSPLEGSEGDGDTD	278	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3344.3	32.28852	2	1553.578247	1553.577043	K	-	413	428
PSM	RNSSEASSGDFLDLK	279	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3565.2	37.56732	3	1704.738671	1704.735610	R	G	85	100
PSM	RGSLEMSSDGEPLSR	280	sp|Q6ZN18|AEBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2979.5	23.25202	3	1715.720771	1715.718580	R	M	204	219
PSM	NLDIERPTYTNLNR	281	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3383.4	33.24102	3	1717.879871	1717.874747	R	L	216	230
PSM	DRSSFYVNGLTLGGQK	282	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3661.2	39.74308	3	1740.881171	1740.879498	K	C	55	71
PSM	TSSGTSLSAMHSSGSSGK	283	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2850.2	20.29902	3	1747.710671	1747.708409	R	G	1315	1333
PSM	CIPALDSLTPANEDQK	284	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3697.3	40.46998	3	1770.848771	1770.845815	R	I	447	463
PSM	TITLEVEPSDTIENVK	285	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3743.2	41.26193	3	1786.923971	1786.920025	K	A	12	28
PSM	RATISSPLELEGTVSR	286	sp|Q96GS4|BORC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3652.2	39.50408	3	1794.889271	1794.887694	R	H	194	210
PSM	QVPDSAATATAYLCGVK	287	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3809.3	42.56427	3	1830.825971	1830.822317	R	A	107	124
PSM	SSTPPGESYFGVSSLQLK	288	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4411.2	51.13612	3	1962.902171	1962.897590	K	G	1041	1059
PSM	GADFLVTEVENGGSLGSKK	289	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3875.3	43.87465	3	1986.931871	1986.929953	K	G	189	208
PSM	RGQTCVVHYTGMLEDGK	290	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=1.1.3210.4	28.9842	3	2045.874971	2045.870012	K	K	19	36
PSM	DNLTLWTSDQQDEEAGEGN	291	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4018.3	46.57403	3	2120.882171	2120.877051	R	-	228	247
PSM	DNLTLWTSENQGDEGDAGEGEN	292	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3985.2	45.8149	3	2349.953171	2349.946922	R	-	225	247
PSM	DTSSITSCGDGNVVKQEQLSPK	293	sp|Q9Y6Q9|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3264.3	30.35347	3	2429.084771	2429.078150	K	K	709	731
PSM	HQGVMVGMGQKDSYVGDEAQSK	294	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3189.4	28.4487	4	2430.038894	2430.034511	R	R	42	64
PSM	DNLTLWTSDSAGEECDAAEGAEN	295	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4166.2	48.80018	3	2453.985371	2453.976507	R	-	223	246
PSM	TASISSSPSEGTPTVGSYGCTPQSLPK	296	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=1.1.3557.2	37.36628	3	2775.239771	2775.231022	R	F	845	872
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	297	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	27-UNIMOD:35	ms_run[1]:scan=1.1.4041.4	46.8833	4	3772.445694	3772.433739	K	A	469	503
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	298	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	34-UNIMOD:35	ms_run[1]:scan=1.1.3175.5	28.09102	4	4134.442894	4134.430623	K	A	142	177
PSM	DDDIAALVVDNGSGMCK	299	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4776.2	54.52288	2	1821.7772	1820.7912	M	A	2	19
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	300	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3031.6	24.56497	5	3566.445118	3565.448950	K	D	124	155
PSM	ADFDTYDDRAYSSFGGGR	301	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=1.1.4081.2	47.5504	3	2120.8205	2120.8108	M	G	2	20
PSM	DNLTLWTSDQQDDDGGEGNN	302	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4058.2	47.14915	3	2193.873671	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	303	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4082.2	47.58548	3	2194.879271	2192.873028	R	-	228	248
PSM	SADTLWGIQK	304	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3794.3	42.20947	2	1197.545447	1197.543105	K	E	319	329
PSM	SQGMALSLGDK	305	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3137.4	27.14387	2	1201.507847	1201.505005	K	I	933	944
PSM	SRINSSGESGDESDEFLQSRK	306	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3160.3	27.71767	4	2407.034494	2407.028891	R	G	178	199
PSM	SINQPVAFVR	307	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3568.2	37.64182	2	1209.591847	1209.590724	R	R	15	25
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	308	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3075.4	25.68285	4	2455.076094	2455.076510	R	S	364	389
PSM	SYGANFSWNK	309	sp|O43181|NDUS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3637.3	39.12325	2	1252.492847	1252.491404	K	R	159	169
PSM	NDSWGSFDLR	310	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4102.2	47.93464	2	1275.495847	1275.492132	R	A	650	660
PSM	MASNIFGPTEEPQNIPK	311	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3978.2	45.6664	3	1951.878071	1951.875080	R	R	43	60
PSM	KESYSVYVYK	312	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3274.3	30.60278	2	1344.603647	1344.600285	R	V	35	45
PSM	QLSMSSADSADAK	313	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3036.3	24.69268	2	1389.547847	1389.548326	R	R	414	427
PSM	GILAADESTGSIAK	314	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	32.31762	2	1411.662647	1411.659591	K	R	29	43
PSM	TASGSSVTSLDGTR	315	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3075.6	25.68952	2	1417.608647	1417.608618	R	S	328	342
PSM	SRSLSASPALGSTK	316	sp|O95544|NADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2990.3	23.52655	3	1440.698771	1440.697374	K	E	44	58
PSM	SQSMDIDGVSCEK	317	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3227.2	29.40745	2	1534.569647	1534.568076	R	S	103	116
PSM	RGSIGENQIKDEK	318	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2820.3	19.54957	3	1552.726571	1552.724651	K	I	200	213
PSM	GYSFSLTTFSPSGK	319	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4521.2	52.46533	2	1557.678047	1557.675241	R	L	5	19
PSM	SSSVVSAEMSGCSSK	320	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3070.3	25.56137	2	1581.603647	1581.605190	R	S	292	307
PSM	GSSLSGTDDGAQEVVK	321	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3112.6	26.58442	2	1628.693047	1628.693076	R	D	275	291
PSM	ALSRQLSSGVSEIR	322	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3460.2	35.0077	3	1661.757371	1661.753917	R	H	76	90
PSM	RGSLEMSSDGEPLSR	323	sp|Q6ZN18|AEBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3188.3	28.42985	3	1699.728371	1699.723665	R	M	204	219
PSM	RHWTFSSEEQLAR	324	sp|P51946|CCNH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3391.3	33.42764	3	1725.765071	1725.762434	K	L	9	22
PSM	TASFSESRADEVAPAK	325	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3071.4	25.58	3	1744.769171	1744.766910	R	K	453	469
PSM	QLVRGEPNVSYICSR	326	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3335.2	32.06365	3	1856.863571	1856.860433	K	Y	269	284
PSM	KTDPSSLGATSASFNFGK	327	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3537.3	36.87403	3	1893.858071	1893.850974	K	K	258	276
PSM	RFSEGVLQSPSQDQEK	328	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3259.2	30.21475	3	1913.856371	1913.852037	R	L	427	443
PSM	SESLDPDSSMDTTLILK	329	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.3843.3	43.21378	3	1946.847971	1946.843171	R	D	879	896
PSM	GDRSEDFGVNEDLADSDAR	330	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3366.6	32.84972	3	2066.882471	2066.877720	K	A	186	205
PSM	RGQTCVVHYTGMLEDGKK	331	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3270.3	30.4972	4	2157.975694	2157.970060	K	F	19	37
PSM	DNLTLWTSDQQDDDGGEGNN	332	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4159.2	48.6447	3	2192.877371	2192.873028	R	-	228	248
PSM	DNLTLWTSENQGDEGDAGEGEN	333	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4030.2	46.67216	3	2349.951371	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	334	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4003.3	46.23928	3	2349.953171	2349.946922	R	-	225	247
PSM	NGSLDSPGKQDTEEDEEEDEK	335	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2839.3	20.01757	3	2349.957971	2349.956818	K	D	134	155
PSM	YRTASQGPQTDSVIQNSENIK	336	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3271.6	30.53282	3	2415.114071	2415.106748	R	A	1284	1305
PSM	TSRPENAIIYNNNEDFQVGQAK	337	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3421.3	34.15602	4	2507.204894	2507.204080	R	V	472	494
PSM	NADMSEEMQQDSVECATQALEK	338	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3932.4	44.85615	3	2513.046671	2513.035619	K	Y	10	32
PSM	TSSISGPLSPAYTGQVPYNYNQLEGR	339	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4278.2	49.86598	3	2878.321871	2878.317469	R	F	6	32
PSM	DRSSFYVNGLTLGGQK	340	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3924.2	44.69847	3	1821.832271	1820.845829	K	C	55	71
PSM	QQSEISAAVER	341	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3701.2	40.57855	2	1279.5463	1279.5440	R	A	451	462
PSM	VVVAENFDEIVNNENK	342	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3786.3	42.02007	3	1831.899371	1831.895208	K	D	380	396
PSM	VIGSGCNLDSAR	343	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2989.3	23.50447	2	1247.594247	1247.592835	R	F	158	170
PSM	DGNGYISAAELR	344	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3451.2	34.82662	2	1264.605647	1264.604780	K	H	96	108
PSM	LFSQGQDVSNK	345	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3266.2	30.39108	2	1301.568047	1301.565297	R	V	1797	1808
PSM	SSPSARPPDVPGQQPQAAK	346	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2996.5	23.68767	3	1996.938671	1996.936769	R	S	82	101
PSM	YALYDATYETK	347	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3396.3	33.55475	2	1336.620447	1336.618698	R	E	82	93
PSM	DMRQTVAVGVIK	348	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3310.3	31.46733	3	1395.699071	1395.694537	R	A	428	440
PSM	EGLELPEDEEEK	349	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3343.6	32.2697	2	1415.632447	1415.630385	K	K	412	424
PSM	DMRQTVAVGVIK	350	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3149.4	27.44128	3	1411.691471	1411.689452	R	A	428	440
PSM	TASLTSAASVDGNR	351	sp|Q9UN36|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3116.6	26.68682	2	1428.625647	1428.624603	R	S	330	344
PSM	RNSLGGDVLFVGK	352	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3643.3	39.27392	3	1440.714671	1440.712630	R	H	676	689
PSM	TNSMSSSGLGSPNR	353	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2954.3	22.63135	2	1473.592647	1473.591922	R	S	155	169
PSM	GVVDSDDLPLNVSR	354	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3630.2	38.96987	2	1484.748047	1484.747087	K	E	435	449
PSM	VRYSLDPENPTK	355	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3243.4	29.8085	3	1497.6889	1497.6859	M	S	2	14
PSM	SRSVSPCSNVESR	356	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2777.3	18.91092	3	1543.650371	1543.645021	R	L	950	963
PSM	DRLGSYSGPTSVSR	357	sp|Q9BZ23|PANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3161.3	27.7467	3	1560.696371	1560.693351	R	Q	185	199
PSM	EATNPPVIQEEKPK	358	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2974.2	23.13335	3	1658.799971	1658.791668	R	K	483	497
PSM	TASESISNLSEAGSIK	359	sp|P30622|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3577.2	37.85467	3	1672.758071	1672.755677	K	K	191	207
PSM	NRPTSISWDGLDSGK	360	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3504.2	36.05843	3	1711.760471	1711.756680	K	L	48	63
PSM	NRPTSISWDGLDSGK	361	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	38.39437	2	1711.759647	1711.756680	K	L	48	63
PSM	RNSNSPPSPSSMNQR	362	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2829.3	19.77257	3	1737.726671	1737.725396	R	R	453	468
PSM	RNSNSPPSPSSMNQR	363	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2837.3	19.96763	3	1737.726671	1737.725396	R	R	453	468
PSM	DRKESLDVYELDAK	364	sp|Q13510|ASAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3395.3	33.526	3	1759.806071	1759.802961	R	Q	297	311
PSM	RSTQGVTLTDLQEAEK	365	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	34.12705	3	1854.873671	1854.872438	R	T	694	710
PSM	GADFLVTEVENGGSLGSK	366	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4190.2	49.07243	3	1858.837871	1858.834990	K	K	189	207
PSM	DLEAEHVEVEDTTLNR	367	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3401.2	33.6795	3	1868.879471	1868.875201	R	C	15	31
PSM	RLQSIGTENTEENRR	368	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2920.4	21.90797	3	1881.873071	1881.869418	K	F	43	58
PSM	RSSDSWEVWGSASTNR	369	sp|Q8N6T3|ARFG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3645.4	39.33535	3	1903.790771	1903.785020	R	N	359	375
PSM	SQSTTFNPDDMSEPEFK	370	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3843.4	43.21712	3	2038.791971	2038.786719	R	R	599	616
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	371	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3383.6	33.24768	4	4117.458894	4117.448322	K	K	158	194
PSM	SRTSSFTEQLDEGTPNR	372	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3414.3	33.98507	3	2083.828871	2083.824910	R	E	37	54
PSM	TSSTCSNESLSVGGTSVTPR	373	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3311.4	31.49643	3	2105.898071	2105.893644	R	R	749	769
PSM	DNLTLWTSDQQDEEAGEGN	374	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4046.2	46.99638	3	2120.882171	2120.877051	R	-	228	247
PSM	SPSKPLPEVTDEYKNDVK	375	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.3	31.69878	4	2125.004894	2124.998032	R	N	92	110
PSM	DNLTLWTSDQQDDDGGEGNN	376	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4122.2	48.20187	3	2192.877371	2192.873028	R	-	228	248
PSM	NTNDANSCQIIIPQNQVNR	377	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3327.5	31.8771	3	2198.055071	2198.049828	K	K	310	329
PSM	RLSSASTGKPPLSVEDDFEK	378	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3436.2	34.50932	4	2242.053294	2242.051859	R	L	756	776
PSM	AAVPSGASTGIYEALELRDNDK	379	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3846.2	43.29982	3	2276.135471	2276.128455	R	T	33	55
PSM	SGSPSDNSGAEEMEVSLAKPK	380	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3561.5	37.47818	3	2358.878471	2358.872921	R	H	122	143
PSM	KLSSSDAPAQDTGSSAAAVETDASR	381	sp|Q7Z4S6|KI21A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3155.5	27.59683	3	2501.094371	2501.091886	R	T	851	876
PSM	NQIHVKSPPREGSQGELTPANSQSR	382	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2976.5	23.17807	4	2796.332894	2796.330434	R	M	462	487
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	383	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3563.5	37.52645	4	3562.500894	3562.491898	K	V	60	92
PSM	SHSRSASPFPSGSEHSAQEDGSEAAASDSSEADSDSD	384	sp|Q8N7H5|PAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3111.5	26.55858	4	3760.422494	3760.415418	R	-	495	532
PSM	NGSLDSPGKQDTEEDEEEDEKDK	385	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2806.4	19.33293	4	2673.050094	2673.045055	K	G	134	157
PSM	QQSEISAAVER	386	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3689.3	40.36577	2	1279.5463	1279.5440	R	A	451	462
PSM	DNLTLWTSDQQDDDGGEGNN	387	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4171.2	48.8505	3	2193.874271	2192.873028	R	-	228	248
PSM	RKTLDAEVVEK	388	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2897.3	21.3458	3	1366.687271	1366.685746	R	P	275	286
PSM	IACEEEFSDSEEEGEGGRKNSSNFK	389	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3170.3	27.96508	4	2914.168094	2914.160042	R	K	414	439
PSM	DNLTLWTSDQQDEEAGEGN	390	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4060.2	47.19907	3	2120.887271	2120.877051	R	-	228	247
PSM	SGTSEFLNK	391	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3131.2	27.00207	2	1061.444647	1061.443056	K	M	169	178
PSM	ANTFVAELK	392	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3553.2	37.2777	2	1071.501247	1071.500177	R	G	177	186
PSM	DNLTLWTSDQQDDDGGEGNN	393	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3997.2	46.08938	4	2192.874894	2192.873028	R	-	228	248
PSM	MESALDQLK	394	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3473.5	35.35188	2	1113.479247	1113.477727	R	Q	11	20
PSM	NLQTVNVDEN	395	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3125.2	26.90775	2	1144.535647	1144.536031	K	-	116	126
PSM	RGGSGSHNWGTVKDELTESPK	396	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3288.4	30.96117	4	2321.051294	2321.043754	K	Y	216	237
PSM	SQGMALSLGDK	397	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3417.5	34.05967	2	1185.510447	1185.510090	K	I	933	944
PSM	SQGMALSLGDK	398	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3126.2	26.92192	2	1201.503847	1201.505005	K	I	933	944
PSM	RSSSVVSAEMSGCSSK	399	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3075.3	25.67952	3	1817.673671	1817.672632	R	S	291	307
PSM	EQVANSAFVER	400	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3082.5	25.86828	2	1248.607847	1248.609865	K	V	365	376
PSM	SYGANFSWNK	401	sp|O43181|NDUS4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3645.3	39.32868	2	1252.492847	1252.491404	K	R	159	169
PSM	EALQDVEDENQ	402	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3140.4	27.21198	2	1288.542847	1288.541905	K	-	245	256
PSM	SNSFNNPLGNR	403	sp|O95835|LATS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3363.5	32.7693	2	1298.542047	1298.540479	R	A	462	473
PSM	SNVSDAVAQSTR	404	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2977.3	23.19572	2	1313.563847	1313.561274	K	I	232	244
PSM	NLESTVSQIEK	405	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3790.3	42.12547	2	1326.609447	1326.606827	R	E	476	487
PSM	DNNQFASASLDR	406	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3201.4	28.75952	2	1336.603847	1336.600757	K	T	154	166
PSM	KESYSVYVYK	407	sp|P62807|H2B1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3266.3	30.39775	2	1344.603647	1344.600285	R	V	35	45
PSM	SVSLTGAPESVQK	408	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3211.5	29.01632	2	1381.649847	1381.649027	R	A	191	204
PSM	TMSVSDFNYSR	409	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3584.4	38.01743	2	1385.534447	1385.532282	R	T	1156	1167
PSM	VTDSSVSVQLRE	410	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3260.5	30.24713	2	1398.640447	1398.639190	R	-	264	276
PSM	DSVFLSCSEDNR	411	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3317.4	31.65737	2	1427.600647	1427.598708	K	I	180	192
PSM	HVFGESDELIGQK	412	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3300.4	31.26923	3	1457.720471	1457.715058	R	V	138	151
PSM	SAADSISESVPVGPK	413	sp|P45974|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3370.3	32.94565	2	1522.692847	1522.691620	R	V	779	794
PSM	SLTNDWEDHLAVK	414	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3600.2	38.35788	3	1526.739971	1526.736522	K	H	315	328
PSM	DNLTLWTSENQGDEGDAGEGEN	415	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4012.4	46.4621	3	2349.954071	2349.946922	R	-	225	247
PSM	SVSSPTSSNTPTPTK	416	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.2831.4	19.82288	2	1569.691847	1569.692348	K	H	131	146
PSM	SLDPENSETELER	417	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3360.3	32.69793	2	1597.652247	1597.650877	K	I	467	480
PSM	HRVTMNEFEYLK	418	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3502.2	36.01633	3	1645.739171	1645.732379	K	L	143	155
PSM	TRVTDSSVSVQLRE	419	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3199.3	28.70438	3	1655.793371	1655.787980	R	-	262	276
PSM	SRTASGSSVTSLDGTR	420	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2958.4	22.7322	3	1660.745471	1660.741758	R	S	326	342
PSM	YRTTSSANNPNLMYQDECDR	421	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3233.3	29.56407	3	2514.002471	2513.994103	R	R	567	587
PSM	ARPATDSFDDYPPR	422	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3180.4	28.22358	3	1686.708671	1686.703916	R	R	201	215
PSM	SRTASGSSVTSLDGTR	423	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3046.5	24.94877	3	1740.711971	1740.708089	R	S	326	342
PSM	GGSISVQVNSIKFDSE	424	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3937.2	44.98807	3	1745.791271	1745.787311	R	-	684	700
PSM	THSTSSSLGSGESPFSR	425	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3220.4	29.23753	3	1802.750171	1802.747237	R	S	329	346
PSM	RQAVTNPNNTFYATK	426	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3104.4	26.3733	3	1803.832271	1803.830513	K	R	107	122
PSM	DGQVINETSQHHDDLE	427	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3030.5	24.5393	3	1835.795471	1835.792199	R	-	451	467
PSM	TAENATSGETLEENEAGD	428	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3062.5	25.35777	2	1836.747047	1836.749725	K	-	377	395
PSM	TGTLQPWNSDSTLNSR	429	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	39.11658	3	1855.814771	1855.810172	K	Q	249	265
PSM	STTPPPAEPVSLPQEPPKPR	430	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3350.2	32.43602	4	2204.094494	2204.087850	K	V	225	245
PSM	TAAKGEAAAERPGEAAVASSPSK	431	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2782.2	19.01593	4	2235.056094	2235.053256	K	A	8	31
PSM	FVEWLQNAEEESESEGEEN	432	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4643.2	53.4694	3	2333.890871	2333.884913	K	-	401	420
PSM	EVEDKESEGEEEDEDEDLSK	433	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2961.6	22.81517	3	2418.896771	2418.895931	K	Y	147	167
PSM	DGEDQTQDTELVETRPAGDGTFQK	434	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3339.4	32.16685	3	2636.190371	2636.183798	R	W	244	268
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	435	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3278.6	30.71127	3	2742.071471	2742.064016	R	E	424	448
PSM	SQTTTERDSDTDVEEEELPVENR	436	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3352.6	32.49578	3	2758.149971	2758.145437	R	E	445	468
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	437	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3430.5	34.37538	3	3351.386171	3351.389978	R	E	62	93
PSM	SLSNKLTLDK	438	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3523.2	36.51783	2	1239.6112	1239.6107	M	L	2	12
PSM	GRLESAQATFQAHR	439	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3136.3	27.11242	3	1650.763571	1650.762768	R	D	256	270
PSM	MESALDQLK	440	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3481.2	35.54742	2	1113.479247	1113.477727	R	Q	11	20
PSM	RKQSSSEISLAVER	441	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3091.2	26.08065	3	1668.822071	1668.819614	R	A	453	467
PSM	NMSIIDAFK	442	sp|P49959|MRE11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4415.2	51.19897	2	1117.488447	1117.487898	R	S	617	626
PSM	ALLLLCGEDD	443	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4240.2	49.56755	2	1117.535047	1117.532526	K	-	311	321
PSM	ADSILAYHQQNVPR	444	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3313.3	31.54447	3	1690.785671	1690.782835	R	A	260	274
PSM	MESALDQLK	445	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3256.3	30.14795	2	1129.474047	1129.472642	R	Q	11	20
PSM	YIDQEELNK	446	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3006.5	23.94042	2	1150.551647	1150.550619	K	T	198	207
PSM	QLSSGVSEIR	447	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3206.4	28.88225	2	1154.536247	1154.533268	R	H	80	90
PSM	DDTDDEIAKYDGKWEVEEMK	448	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3791.3	42.15098	4	2415.050494	2415.042402	K	E	91	111
PSM	DQVANSAFVER	449	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3122.2	26.82193	2	1234.594647	1234.594215	K	L	500	511
PSM	ADLINNLGTIAK	450	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3726.4	40.93553	2	1241.700647	1241.697952	K	F	96	108
PSM	SADTLWDIQK	451	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3801.4	42.39143	2	1255.551447	1255.548584	K	D	320	330
PSM	SGSYSYLEER	452	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3348.2	32.38657	2	1269.493047	1269.491463	R	K	908	918
PSM	SGSYSYLEER	453	sp|O14974|MYPT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3340.5	32.18958	2	1269.493047	1269.491463	R	K	908	918
PSM	DSAQNSVIIVDK	454	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3193.5	28.55563	2	1287.669247	1287.667045	K	N	194	206
PSM	LMIEMDGTENK	455	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35	ms_run[1]:scan=1.1.3231.2	29.51485	2	1295.576047	1295.573739	K	S	93	104
PSM	SSSEDAESLAPR	456	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3083.4	25.88687	2	1327.531047	1327.529305	R	S	298	310
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	457	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2973.3	23.10283	4	2739.176094	2739.163428	R	A	17	51
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	458	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3279.5	30.73695	4	2742.072094	2742.064016	R	E	424	448
PSM	ESVPEFPLSPPK	459	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3970.2	45.53883	2	1405.655847	1405.653049	K	K	30	42
PSM	ISVREPMQTGIK	460	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	30.93213	3	1437.709871	1437.705102	R	A	183	195
PSM	DMNQVLDAYENK	461	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3813.3	42.67288	2	1438.637847	1438.639844	R	K	142	154
PSM	RLSSLRASTSK	462	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3037.4	24.71177	3	1444.593071	1444.587777	R	S	233	244
PSM	AHSSMVGVNLPQK	463	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3192.3	28.52308	3	1446.671771	1446.669050	R	A	172	185
PSM	SLYESFVSSSDR	464	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	41.75385	2	1455.593047	1455.591906	K	L	131	143
PSM	DRVHHEPQLSDK	465	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2664.2	17.49727	3	1459.721771	1459.716790	K	V	26	38
PSM	PCSEETPAISPSK	466	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2935.2	22.20865	2	1481.6101	1481.6104	M	R	2	15
PSM	SRSGSSQELDVKPSASPQER	467	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2918.5	21.85733	3	2224.013771	2224.012119	R	S	1537	1557
PSM	GALQNIIPASTGAAK	468	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3633.3	39.0465	2	1490.753247	1490.749409	R	A	201	216
PSM	KYEEIDNAPEER	469	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2911.2	21.68017	3	1491.684371	1491.684152	K	A	91	103
PSM	GAGSIREAGGAFGKR	470	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3017.3	24.19898	3	1512.721571	1512.719840	R	E	36	51
PSM	HELQANCYEEVK	471	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2986.2	23.42162	3	1518.681971	1518.677293	K	D	133	145
PSM	AHSSMVGVNLPQK	472	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3313.2	31.54113	3	1526.637371	1526.635381	R	A	172	185
PSM	VPSPLEGSEGDGDTD	473	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3377.4	33.11168	2	1553.578247	1553.577043	K	-	413	428
PSM	CTSVSSLDSFESR	474	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3563.4	37.52312	2	1553.611247	1553.606904	R	S	1387	1400
PSM	SATKVTADVINAAEK	475	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3533.3	36.76845	3	1596.779771	1596.776018	R	L	55	70
PSM	SQSRSNSPLPVPPSK	476	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3077.5	25.73795	3	1659.798071	1659.798150	R	A	297	312
PSM	SPSKPLPEVTDEYK	477	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3316.2	31.6214	3	1668.767771	1668.764785	R	N	92	106
PSM	VRQASVADYEETVK	478	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3171.3	27.98125	3	1673.768171	1673.766182	R	K	80	94
PSM	ARPATDSFDDYPPR	479	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3294.3	31.11198	3	1686.702971	1686.703916	R	R	201	215
PSM	NQTAEKEEFEHQQK	480	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2700.2	17.8658	4	1744.806494	1744.801642	K	E	584	598
PSM	HIAEEADRKYEEVAR	481	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2994.3	23.62673	4	1814.893694	1814.891125	K	K	154	169
PSM	DRSSFYVNGLTLGGQK	482	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3811.2	42.60882	3	1820.849771	1820.845829	K	C	55	71
PSM	QLVRGEPNVSYICSR	483	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3343.4	32.26303	3	1856.863571	1856.860433	K	Y	269	284
PSM	FQEQECPPSPEPTRK	484	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2930.3	22.1137	3	1908.813371	1908.807729	K	E	178	193
PSM	RFSEGVLQSPSQDQEK	485	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3267.5	30.42685	3	1913.856371	1913.852037	R	L	427	443
PSM	HRTLTAEEAEEEWER	486	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3340.6	32.19292	3	1964.830871	1964.826550	R	R	152	167
PSM	SGSSQELDVKPSASPQER	487	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3009.3	24.01047	3	1980.880571	1980.878980	R	S	1539	1557
PSM	SNSSSEAVLGQEELSAQAK	488	sp|Q9BXF6|RFIP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3493.3	35.82553	3	2013.893471	2013.889210	R	V	393	412
PSM	TASQGPQTDSVIQNSENIK	489	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3364.5	32.79512	3	2095.947371	2095.942308	R	A	1286	1305
PSM	QGTEIDGRSISLYYTGEK	490	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3708.2	40.67887	3	2095.950671	2095.946331	K	G	450	468
PSM	SLSQGSTNSNMLDVQGGAHK	491	sp|Q8TEU7|RPGF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3257.5	30.1735	3	2109.921071	2109.915048	R	K	1068	1088
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	492	sp|Q6NXS1|IPP2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	20-UNIMOD:35	ms_run[1]:scan=1.1.3543.6	37.03405	4	4283.682894	4283.662252	K	L	164	202
PSM	ARQYTSPEEIDAQLQAEK	493	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	36.59292	3	2155.985771	2155.978694	R	Q	14	32
PSM	TRSNPEGAEDRAVGAQASVGSR	494	sp|Q9NWV8|BABA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2934.5	22.19362	3	2294.043071	2294.040065	R	S	27	49
PSM	ESEDKPEIEDVGSDEEEEKK	495	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3003.4	23.86677	4	2320.014494	2320.007791	K	D	251	271
PSM	AAVPSGASTGIYEALELRDNDK	496	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4104.2	47.97587	3	2356.099271	2356.094786	R	T	33	55
PSM	QENCGAQQVPAGPGTSTPPSSPVR	497	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,17-UNIMOD:21	ms_run[1]:scan=1.1.3200.5	28.74008	3	2501.103671	2501.100617	R	T	257	281
PSM	DRSSFYVNGLTLGGQK	498	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3795.3	42.23157	3	1821.847271	1820.845829	K	C	55	71
PSM	SLSNKLTLDK	499	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3515.3	36.32472	2	1239.6112	1239.6107	M	L	2	12
PSM	SSIGTGYDLSASTFSPDGR	500	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4617.2	53.26892	3	2038.8622	2038.8512	M	V	2	21
PSM	QLSSGVSEIR	501	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3711.2	40.73421	2	1137.5085	1137.5062	R	H	80	90
PSM	RDSFDNCSLGESSK	502	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3035.5	24.66402	3	1680.645971	1680.645080	K	I	1686	1700
PSM	SDAAVDTSSEITTK	503	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3222.4	29.28795	2	1465.6794	1465.6779	M	D	2	16
PSM	VKVDGPRSPSYGR	504	sp|Q07955|SRSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2835.2	19.92402	3	1496.717471	1496.713692	R	S	192	205
PSM	LHDSSGSQVGTGFK	505	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2966.2	22.92755	3	1498.651271	1498.645338	K	S	1829	1843
PSM	DNGIRPSSLEQMAK	506	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3338.5	32.13805	3	1544.763071	1544.761691	K	L	278	292
PSM	SDGSFIGYK	507	sp|P31751|AKT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3330.2	31.9535	2	1052.425847	1052.421593	K	E	31	40
PSM	AASIFGGAKPVDTAAR	508	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	32.25637	3	1610.787971	1610.781772	R	E	357	373
PSM	KQSGYGGQTKPIFR	509	sp|P83881|RL36A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3028.4	24.4877	3	1645.800671	1645.797756	R	K	44	58
PSM	STTPPPAEPVSLPQEPPKPR	510	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3342.3	32.23373	4	2204.094494	2204.087850	K	V	225	245
PSM	SRSGSSQELDVKPSASPQER	511	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2933.3	22.16162	4	2224.022894	2224.012119	R	S	1537	1557
PSM	SLSYSPVER	512	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3221.2	29.256	2	1116.485847	1116.485256	R	R	2690	2699
PSM	ALLLLCGEDD	513	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4266.2	49.77087	2	1117.535047	1117.532526	K	-	311	321
PSM	DGKYSQVLANGLDNK	514	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3501.3	35.99446	3	1700.780471	1700.777081	K	L	92	107
PSM	QLSSGVSEIR	515	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3229.2	29.45258	2	1154.536447	1154.533268	R	H	80	90
PSM	QASVTLQPLK	516	sp|P78345|RPP38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3357.2	32.61395	2	1163.594247	1163.595140	R	I	251	261
PSM	YLSEVASGDNK	517	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2929.2	22.0897	2	1181.558047	1181.556432	R	Q	130	141
PSM	SINQPVAFVR	518	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	37.4425	2	1209.591847	1209.590724	R	R	15	25
PSM	HGSFVNKPTR	519	sp|P29353|SHC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2699.2	17.84067	3	1221.566771	1221.565572	R	G	137	147
PSM	DLFDPIIEDR	520	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4376.2	50.75022	2	1231.609447	1231.608468	K	H	87	97
PSM	IVRGDQPAASGDSDDDEPPPLPR	521	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3243.5	29.81183	4	2483.103294	2483.096577	K	L	45	68
PSM	DNSTMGYMMAK	522	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3336.2	32.09002	2	1247.500047	1247.498465	R	K	486	497
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	523	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3040.4	24.78883	4	2512.025294	2512.025203	R	A	19	51
PSM	DSGSISLQETR	524	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3103.5	26.3543	2	1271.542847	1271.539476	K	R	776	787
PSM	KGSSGNASEVSVACLTER	525	sp|Q69YQ0|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3366.5	32.84638	3	1930.852571	1930.845571	R	I	382	400
PSM	GYFEYIEENK	526	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3683.2	40.2118	2	1290.581047	1290.576833	R	Y	256	266
PSM	ELISNSSDALDK	527	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3167.4	27.90772	2	1290.631247	1290.630326	R	I	47	59
PSM	QQSEISAAVER	528	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3099.5	26.26882	2	1296.571447	1296.571111	R	A	451	462
PSM	INVYYNEATGGK	529	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3212.3	29.0352	2	1327.641647	1327.640831	R	Y	47	59
PSM	TAFQEALDAAGDK	530	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3599.6	38.3329	2	1335.633047	1335.630660	K	L	9	22
PSM	NFSDNQLQEGK	531	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3124.3	26.8836	2	1358.549847	1358.550375	R	N	161	172
PSM	SVSLTGAPESVQK	532	sp|Q92945|FUBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3202.6	28.79067	2	1381.649847	1381.649027	R	A	191	204
PSM	IIYGGSVTGATCK	533	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3221.6	29.26933	2	1405.634047	1405.631268	R	E	244	257
PSM	TGAELVTCGSVLK	534	sp|Q9HCN8|SDF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3494.4	35.85825	2	1413.653247	1413.657483	K	L	31	44
PSM	QASVADYEETVK	535	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3230.3	29.4837	2	1418.597447	1418.596657	R	K	82	94
PSM	EVDEQMLNVQNK	536	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3248.3	29.93332	2	1445.686047	1445.682044	K	N	325	337
PSM	RFSDGAASIQAFK	537	sp|Q9Y2K2|SIK3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3511.2	36.21048	3	1476.678971	1476.676244	R	A	624	637
PSM	SRSFTLDDESLK	538	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3389.4	33.37665	3	1476.654071	1476.649755	R	Y	41	53
PSM	ARSVDALDDLTPPSTAESGSR	539	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3528.3	36.64588	3	2224.004471	2224.000886	R	S	491	512
PSM	GVVDSEDLPLNISR	540	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3787.2	42.04567	3	1512.780071	1512.778387	R	E	387	401
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	541	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3464.3	35.11418	4	3044.158494	3044.151982	K	L	595	622
PSM	TLSFGSDLNYATR	542	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4016.3	46.52333	2	1523.667047	1523.665739	R	E	490	503
PSM	DHASIQMNVAEVDK	543	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3252.4	30.0392	3	1555.727771	1555.730056	K	V	28	42
PSM	MLAESDESGDEESVSQTDKTELQNTLR	544	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3677.4	40.05192	4	3187.288894	3187.278911	K	T	186	213
PSM	SNSMVDVCSVDRR	545	sp|Q9NVN8|GNL3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3158.2	27.67617	3	1603.651271	1603.648392	K	S	511	524
PSM	NSSLLSFDNEDENE	546	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3893.2	44.0732	2	1611.655047	1611.653640	K	-	141	155
PSM	YYTSASGDEMVSLK	547	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3597.5	38.28215	2	1629.663447	1629.663356	R	D	465	479
PSM	GASWIDTADGSANHR	548	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3353.5	32.51862	3	1636.670471	1636.663113	R	A	254	269
PSM	HRVTMNEFEYLK	549	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3512.2	36.23705	3	1645.739171	1645.732379	K	L	143	155
PSM	ERESLQQMAEVTR	550	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3262.5	30.30207	3	1655.737271	1655.733836	K	E	123	136
PSM	RNQSFCPTVNLDK	551	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3283.3	30.82925	3	1657.730471	1657.728357	K	L	65	78
PSM	HRVTMNEFEYLK	552	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3292.3	31.06037	3	1661.729771	1661.727294	K	L	143	155
PSM	NRPTSISWDGLDSGK	553	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3591.2	38.17387	3	1711.760171	1711.756680	K	L	48	63
PSM	ERAMSTTSISSPQPGK	554	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2996.4	23.681	3	1755.786071	1755.786265	K	L	265	281
PSM	RGSLCSGCQKPITGR	555	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2828.2	19.73787	3	1755.795071	1755.790974	R	C	531	546
PSM	GGSVLVTCSTSCDQPK	556	sp|P05362|ICAM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3143.3	27.2854	3	1774.730471	1774.726702	R	L	41	57
PSM	SYELPDGQVITIGNER	557	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4055.2	47.08128	3	1789.891271	1789.884643	K	F	241	257
PSM	HVPDSGATATAYLCGVK	558	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3497.4	35.92842	3	1825.812371	1825.807001	K	G	110	127
PSM	NPDDITQEEYGEFYK	559	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3672.5	39.96827	2	1846.793247	1846.789740	R	S	292	307
PSM	QYTSPEEIDAQLQAEK	560	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3728.2	40.97502	3	1928.845271	1928.840469	R	Q	16	32
PSM	KEESEESDDDMGFGLFD	561	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3940.4	45.06283	2	1964.754447	1964.746948	K	-	98	115
PSM	KPTDGASSSNCVTDISHLVR	562	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3507.3	36.12618	4	2223.004894	2222.999112	R	K	698	718
PSM	INSSGESGDESDEFLQSRK	563	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3361.3	32.71607	3	2243.866871	2243.862083	R	G	180	199
PSM	DYHFKVDNDENEHQLSLR	564	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3342.5	32.2404	4	2258.042894	2258.035223	K	T	28	46
PSM	SVSVDSGEQREAGTPSLDSEAK	565	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3148.6	27.42218	3	2328.012671	2328.011844	R	E	116	138
PSM	QQSTSSDRVSQTPESLDFLK	566	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3811.4	42.62215	3	2332.062971	2332.058401	R	V	1000	1020
PSM	FVEWLQNAEEESESEGEEN	567	sp|Q9Y6E2|BZW2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4838.2	54.99877	3	2333.894171	2333.884913	K	-	401	420
PSM	DNLTLWTSDTQGDEAEAGEGGEN	568	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4162.2	48.71926	3	2407.994771	2407.988786	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	569	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3235.4	29.6071	3	2483.100971	2483.096577	K	L	45	68
PSM	DSGSDEDFLMEDDDDSDYGSSKK	570	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3548.2	37.14545	3	2555.964071	2555.960582	K	K	129	152
PSM	RNSVERPAEPVAGAATPSLVEQQK	571	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3252.5	30.04253	4	2613.299294	2613.291195	R	M	1454	1478
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	572	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3299.5	31.24685	3	2651.008571	2651.000036	K	M	572	596
PSM	MLAESDESGDEESVSQTDKTELQNTLR	573	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3548.3	37.15545	3	3107.324171	3107.312580	K	T	186	213
PSM	RSPSKPLPEVTDEYK	574	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3159.6	27.70235	3	1824.866471	1824.865896	R	N	91	106
PSM	CESAPGCGVWQRPVIDNPNYK	575	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3996.4	46.07218	3	2509.0607	2509.0551	R	G	360	381
PSM	CESAPGCGVWQRPVIDNPNYK	576	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4005.3	46.29362	3	2509.0607	2509.0551	R	G	360	381
PSM	SGSPSDNSGAEEMEVSLAKPK	577	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,5-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	37.24343	3	2358.878471	2358.872921	R	H	122	143
PSM	NGSLDSPGKQDTEEDEEEDEK	578	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2906.5	21.55395	3	2350.942271	2349.956818	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	579	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2860.3	20.5121	4	2594.066894	2593.078724	K	G	134	157
PSM	QLSSGVSEIR	580	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3726.2	40.9222	2	1137.5085	1137.5062	R	H	80	90
PSM	TPVDESDDEIQHDEIPTGK	581	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3283.5	30.83925	3	2203.920971	2203.915819	R	C	923	942
PSM	SCINLPTVLPGSPSK	582	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4704.2	53.98373	2	1690.8045	1690.7996	M	T	2	17
PSM	AASIFGGAK	583	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3233.2	29.55407	2	900.411047	900.410634	R	P	357	366
PSM	NALLSLAK	584	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3707.2	40.6438	2	908.473247	908.473234	R	G	178	186
PSM	SPSTLLPK	585	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3353.3	32.51195	2	921.459047	921.457250	R	K	825	833
PSM	GRSFAGNLNTYK	586	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3198.3	28.67825	3	1406.638271	1406.634379	R	R	384	396
PSM	RESLSTSSDLYK	587	sp|Q8TB72|PUM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3117.2	26.69928	3	1464.653171	1464.649755	R	R	585	597
PSM	NLLSVAYK	588	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3802.2	42.40265	2	986.483047	986.483799	R	N	44	52
PSM	RGQTCVVHYTGMLEDGK	589	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3364.2	32.78512	4	2029.881294	2029.875097	K	K	19	36
PSM	RVSVCAETYNPDEEEEDTDPRVIHPK	590	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3315.3	31.60562	6	3164.386341	3164.375789	R	T	97	123
PSM	NNAYLAQSPQLYK	591	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3470.3	35.2679	3	1588.731671	1588.728674	K	Q	242	255
PSM	SFSMQDLR	592	sp|Q9H6H4|REEP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3588.2	38.12637	2	1062.421047	1062.420547	R	S	150	158
PSM	RNSTIVLRTDSEK	593	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2991.3	23.56135	3	1677.750371	1677.748831	R	R	450	463
PSM	VTLTSEEEAR	594	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2948.3	22.5263	2	1133.556047	1133.556432	K	L	306	316
PSM	LGIHEDSTNR	595	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2787.2	19.06557	3	1140.558971	1140.552350	K	R	439	449
PSM	QLSSGVSEIR	596	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3198.6	28.68825	2	1154.536247	1154.533268	R	H	80	90
PSM	SASVNKEPVSLPGIMR	597	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3676.3	40.03153	3	1763.867771	1763.864122	R	R	1491	1507
PSM	GGPGSTLSFVGK	598	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3530.2	36.68907	2	1185.543247	1185.543105	K	R	107	119
PSM	NSSISGPFGSR	599	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3313.4	31.5478	2	1187.497447	1187.497217	R	S	483	494
PSM	NSSISGPFGSR	600	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3295.3	31.13775	2	1187.497447	1187.497217	R	S	483	494
PSM	SASWGSADQLK	601	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3340.3	32.18292	2	1228.514047	1228.512533	R	E	221	232
PSM	RASSLNFLNK	602	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3378.3	33.13062	2	1228.597047	1228.596537	K	S	579	589
PSM	KITIADCGQLE	603	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3291.4	31.03823	2	1246.623447	1246.622738	K	-	155	166
PSM	RLSEDYGVLK	604	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3312.5	31.52547	2	1258.598847	1258.595869	R	T	110	120
PSM	TLSSSSMDLSR	605	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3297.3	31.18872	2	1262.523447	1262.521383	R	R	606	617
PSM	NSLESYAFNMK	606	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3684.3	40.22772	2	1302.593447	1302.591438	K	A	540	551
PSM	RKASQLVGIEK	607	sp|Q9NPD8|UBE2T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2941.2	22.35047	3	1307.700371	1307.696251	K	K	181	192
PSM	NSTLNSAAVTVSS	608	sp|Q9UHY1|NRBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3296.3	31.16648	2	1329.582647	1329.581341	R	-	523	536
PSM	GDNITLLQSVSN	609	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3980.3	45.6977	2	1339.605247	1339.602076	K	-	81	93
PSM	RAESMLQQADK	610	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3031.5	24.56163	2	1355.591247	1355.590466	K	L	336	347
PSM	TLEEDEEELFK	611	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3911.3	44.48355	2	1380.630847	1380.629657	K	M	40	51
PSM	DVIELTDDSFDK	612	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3843.5	43.22045	2	1395.644047	1395.640556	K	N	161	173
PSM	RAGELTEDEVER	613	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2916.2	21.79325	3	1402.675871	1402.668836	K	V	55	67
PSM	IISSIEQKEENK	614	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2900.2	21.40215	3	1416.745271	1416.746024	R	G	62	74
PSM	RDSLTGSSDLYK	615	sp|Q14671|PUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3118.3	26.73153	2	1420.624847	1420.623540	R	R	707	719
PSM	RSSFSMEEGDVL	616	sp|P19484|TFEB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3842.3	43.19857	2	1435.571047	1435.569062	R	-	465	477
PSM	SNSAWQIYLQR	617	sp|Q8N4C8|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4074.2	47.43965	3	1444.651571	1444.650030	R	R	699	710
PSM	TLTIVDTGIGMTK	618	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3796.3	42.25703	2	1444.691047	1444.688449	R	A	28	41
PSM	SRSLVDYENANK	619	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3031.3	24.55497	3	1474.652471	1474.645338	R	A	314	326
PSM	LTFDSSFSPNTGK	620	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3671.5	39.94255	2	1479.631847	1479.628291	K	K	97	110
PSM	PFSAPKPQTSPSPK	621	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2987.3	23.45065	3	1547.742371	1547.738510	K	R	299	313
PSM	SLTNDWEDHLAVK	622	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3795.2	42.22823	3	1606.704371	1606.702853	K	H	315	328
PSM	SRSPESQVIGENTK	623	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3000.4	23.78973	3	1610.731271	1610.730130	R	Q	305	319
PSM	HRVTMNEFEYLK	624	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3492.3	35.79665	3	1645.739171	1645.732379	K	L	143	155
PSM	HRVTMNEFEYLK	625	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3284.4	30.85853	3	1661.729771	1661.727294	K	L	143	155
PSM	NQLTSNPENTVFDAK	626	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3416.2	34.02382	3	1676.802671	1676.800579	K	R	82	97
PSM	SSGSLGHRPSQEMDK	627	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2756.2	18.5593	3	1694.712971	1694.708349	R	M	463	478
PSM	RMTGSEFDFEEMK	628	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3585.4	38.04973	3	1701.645671	1701.641575	K	R	423	436
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	629	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2828.3	19.74787	4	3423.330894	3423.317893	R	A	81	114
PSM	GGSISVQVNSIKFDSE	630	sp|Q14978|NOLC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3948.2	45.1898	3	1745.791271	1745.787311	R	-	684	700
PSM	DLEIERPILGQNDNK	631	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3529.2	36.66737	3	1752.904571	1752.900627	R	S	234	249
PSM	DASDDLDDLNFFNQK	632	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4840.2	55.03895	3	1755.763871	1755.758774	K	K	65	80
PSM	SSFASSSASDASKPSSPR	633	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.2856.4	20.40453	3	1834.777271	1834.773452	R	G	122	140
PSM	VRRPSESDKEDELDK	634	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2761.2	18.60877	4	1881.85089419132	1881.8469506418103	R	V	623	638
PSM	IISSIEQKEENKGGEDK	635	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2857.3	20.43037	4	1902.956494	1902.953451	R	L	62	79
PSM	SQSLPNSLDYTQTSDPGR	636	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3492.5	35.80332	3	2044.877171	2044.873894	R	H	44	62
PSM	QNEPFVATQSSACVDGPANH	637	sp|O00180|KCNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3292.4	31.0637	3	2127.940271	2127.927981	K	-	317	337
PSM	YHTSQSGDEMTSLSEYVSR	638	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3564.4	37.54868	3	2175.942671	2175.937877	R	M	457	476
PSM	TTSSANNPNLMYQDECDR	639	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3290.3	31.01237	3	2194.835771	2194.829663	R	R	569	587
PSM	DQVTAQEIFQDNHEDGPTAK	640	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3457.3	34.93707	3	2242.020671	2242.013819	K	K	546	566
PSM	DNLTLWTSDSAGEECDAAEGAEN	641	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4185.2	49.01358	3	2453.985371	2453.976507	R	-	223	246
PSM	NTFTAWSDEESDYEIDDRDVNK	642	sp|Q6PKG0|LARP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3869.3	43.7691	3	2728.091171	2728.081381	K	I	621	643
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	643	sp|O43865|SAHH2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3431.6	34.40057	3	3351.386171	3351.389978	R	E	62	93
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	644	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3329.4	31.92798	3	3722.210171	3722.195067	K	A	158	190
PSM	EGRDDRLHSAEQDADDEAADDTDDTSSVTSSASSTTSSQSGSGTSR	645	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3155.6	27.60017	5	4770.912618	4770.899413	K	K	467	513
PSM	GADFLVTEVENGGSLGSK	646	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4062.2	47.24918	3	1859.823971	1858.834990	K	K	189	207
PSM	NGSLDSPGKQDTEEDEEEDEKDK	647	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2843.3	20.12443	4	2674.033294	2673.045055	K	G	134	157
PSM	QYTSPEEIDAQLQAEK	648	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=1.1.4352.2	50.49963	3	1911.8231	1911.8134	R	Q	16	32
PSM	LNEVSSDANRENAAAESGSESSSQEATPEKESLAESAAAYTK	649	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3448.5	34.74677	5	4394.928118	4394.914716	K	A	337	379
PSM	QNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLK	650	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3669.6	39.89107	4	4115.658894	4115.648300	K	K	161	199
PSM	ADFDTYDDRAYSSFGGGRGSR	651	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,20-UNIMOD:21	ms_run[1]:scan=1.1.3820.3	42.8302	3	2420.9762	2420.9652	M	G	2	23
PSM	DSSTSPGDYVLSVSENSR	652	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3953.3	45.2719	3	1978.821971	1978.815711	R	V	39	57
PSM	SLLSGLLK	653	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4475.2	52.10655	2	909.493447	909.493635	K	K	378	386
PSM	SRSDIDVNAAAGAK	654	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2912.2	21.69542	3	1453.659071	1453.656237	R	A	368	382
PSM	RLASSVLR	655	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3156.3	27.61527	2	980.519247	980.516830	K	C	9	17
PSM	AHSIQIMK	656	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3041.4	24.81428	2	1006.468247	1006.467103	R	V	121	129
PSM	SCNCLLLK	657	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3205.2	28.85412	2	1006.496647	1006.493973	K	V	336	344
PSM	DHQYQFLEDAVR	658	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3649.2	39.4244	3	1519.708271	1519.705556	K	N	239	251
PSM	SGVGNIFIK	659	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3757.3	41.54555	2	1013.494447	1013.494698	K	N	96	105
PSM	DVNAAIATIK	660	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3372.3	33.00348	2	1014.571247	1014.570960	K	T	327	337
PSM	KASISYFK	661	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3172.3	28.00752	2	1022.483047	1022.483799	R	N	77	85
PSM	RGQTCVVHYTGMLEDGK	662	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=1.1.3212.2	29.02853	4	2045.877294	2045.870012	K	K	19	36
PSM	NVFSSSGTSFSGRK	663	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3209.2	28.95185	3	1539.674471	1539.671887	K	I	1453	1467
PSM	TTHFVEGGDAGNREDQINR	664	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2943.3	22.3946	4	2114.978494	2114.972957	K	L	224	243
PSM	HGSLGFLPR	665	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3484.5	35.63468	2	1062.502847	1062.501180	R	K	11	20
PSM	VLSIGDGIAR	666	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3631.2	38.98212	2	1079.538647	1079.537626	R	V	74	84
PSM	LGSVDSFER	667	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	32.7094	2	1088.455847	1088.453955	R	S	586	595
PSM	CSSILLHGK	668	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3025.4	24.41062	2	1093.500847	1093.499132	R	E	518	527
PSM	ERVPSVAEAPQLRPAGTAAAK	669	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3256.2	30.13795	4	2198.124094	2198.120882	R	T	536	557
PSM	SFSQMISEK	670	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3480.3	35.5284	2	1135.463047	1135.462077	K	Q	1043	1052
PSM	RLQSIGTENTEENR	671	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2998.4	23.73192	3	1725.770771	1725.768307	K	R	43	57
PSM	LRKGSDALRPPVPQGEDEVPK	672	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3204.2	28.8263	4	2367.2036941913207	2367.1947742935395	R	A	306	327
PSM	NSSISGPFGSR	673	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3303.2	31.33978	2	1187.497447	1187.497217	R	S	483	494
PSM	GYSFTTTAER	674	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3278.4	30.7046	2	1211.487247	1211.485984	R	E	197	207
PSM	NFEDVAFDEK	675	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3529.3	36.67737	2	1212.533647	1212.529883	K	K	376	386
PSM	RQTFITLEK	676	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3285.3	30.88078	2	1214.607447	1214.606039	R	F	1218	1227
PSM	SLSVSSDFLGK	677	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3874.3	43.84973	2	1218.555047	1218.553335	K	D	1713	1724
PSM	IVRGDQPAASGDSDDDEPPPLPR	678	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3251.5	30.0167	4	2483.103294	2483.096577	K	L	45	68
PSM	VLTIDPTEFK	679	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4110.2	48.04173	2	1241.596847	1241.594472	R	F	589	599
PSM	VLTIDPTEFK	680	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4127.2	48.24294	2	1241.596847	1241.594472	R	F	589	599
PSM	SAPAMQSSGSFNYARPK	681	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3194.6	28.58472	3	1877.820071	1877.813149	R	Q	719	736
PSM	LKDDEVAQLKK	682	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2874.2	20.8536	3	1285.726571	1285.724166	K	S	309	320
PSM	SRENSVCSDTSESSAAEFDDRR	683	sp|O94763|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3064.4	25.40873	4	2584.020894	2584.013318	R	G	414	436
PSM	KRSEGFSMDR	684	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2888.3	21.16415	3	1291.537871	1291.538036	R	K	452	462
PSM	SSPNPFVGSPPK	685	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3395.4	33.52934	2	1292.584247	1292.580219	K	G	393	405
PSM	SSPNPFVGSPPK	686	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3386.2	33.32473	2	1292.584247	1292.580219	K	G	393	405
PSM	NGSLDSPGKQDTEEDEEEDEKDK	687	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2806.3	19.32627	4	2593.082094	2593.078724	K	G	134	157
PSM	SFCISTLANTK	688	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.3851.3	43.4201	2	1320.581847	1320.578504	K	A	977	988
PSM	NSNPALNDNLEK	689	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3009.4	24.0138	2	1327.636447	1327.636808	K	G	120	132
PSM	ASSVISTAEGTTR	690	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3164.3	27.83055	2	1358.605047	1358.607890	R	R	1805	1818
PSM	RSSTLSQLPGDK	691	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3000.3	23.78307	3	1367.648171	1367.644610	K	S	592	604
PSM	RLSSLRASTSK	692	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2955.3	22.66318	3	1364.626271	1364.621446	R	S	233	244
PSM	SRTHSTSSSLGSGESPFSR	693	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3089.2	26.0312	3	2045.881571	2045.880377	R	S	327	346
PSM	SDSGGSSSEPFDR	694	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3018.5	24.22757	2	1406.498447	1406.498733	R	H	759	772
PSM	EQFLDGDGWTSR	695	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3668.3	39.85872	2	1409.622447	1409.621158	K	W	25	37
PSM	GILAADESTGSIAK	696	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3337.4	32.1085	2	1411.662647	1411.659591	K	R	29	43
PSM	NTGIICTIGPASR	697	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3507.5	36.13285	2	1438.667047	1438.663965	R	S	44	57
PSM	STGGAPTFNVTVTK	698	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3485.4	35.65687	2	1458.679247	1458.675576	K	T	92	106
PSM	SGSMDPSGAHPSVR	699	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.2674.2	17.5854	3	1479.582071	1479.581358	R	Q	18	32
PSM	GALQNIIPASTGAAK	700	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3625.2	38.84182	2	1490.753247	1490.749409	R	A	201	216
PSM	RLTVSSLQESGLK	701	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3408.4	33.84372	3	1496.762771	1496.759974	R	V	2334	2347
PSM	ASSTGSFTAPDPGLK	702	sp|Q8IWZ8|SUGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3373.5	33.02903	2	1514.667647	1514.665405	K	R	321	336
PSM	SSSSSSGGGLLPYPR	703	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3597.4	38.27548	2	1530.674247	1530.671553	R	R	40	55
PSM	VPSPLEGSEGDGDTD	704	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3368.4	32.89422	2	1553.578247	1553.577043	K	-	413	428
PSM	RNSVTPLASPEPTK	705	sp|Q16875|F263_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3020.4	24.27565	3	1575.767771	1575.765788	R	K	459	473
PSM	SMSVYCTPNKPSR	706	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3035.4	24.66068	3	1605.672371	1605.668065	K	T	493	506
PSM	LTFDSSFSPNTGKK	707	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3440.3	34.604	2	1607.724847	1607.723254	K	N	97	111
PSM	ARVYTDVNTHRPR	708	sp|P68400|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2868.2	20.71298	3	1663.796471	1663.794402	R	E	9	22
PSM	SRKESYSVYVYK	709	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3244.3	29.83078	3	1667.700971	1667.699756	R	V	33	45
PSM	SFVCFGDDGEPQLK	710	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.4011.2	46.43772	2	1677.679447	1677.674590	R	E	1029	1043
PSM	LIAPVAEEEATVPNNK	711	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3371.3	32.96797	3	1693.890971	1693.888666	K	I	8	24
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	712	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3598.3	38.30758	4	3448.574894	3448.567155	K	V	871	903
PSM	RVSISEGDDKIEYR	713	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3191.3	28.50065	3	1745.799971	1745.798544	K	A	122	136
PSM	RESCGSSVLTDFEGK	714	sp|O15231|ZN185_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=1.1.3573.2	37.77122	3	1750.729271	1750.723331	R	D	463	478
PSM	VDATEESDLAQQYGVR	715	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3556.3	37.34128	3	1779.832871	1779.827522	K	G	82	98
PSM	SYELPDGQVITIGNER	716	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4041.2	46.87663	3	1789.891271	1789.884643	K	F	241	257
PSM	DRSSFYVNGLTLGGQK	717	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3802.5	42.41265	2	1820.850447	1820.845829	K	C	55	71
PSM	QVPDSAATATAYLCGVK	718	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3831.2	42.9852	3	1830.825971	1830.822317	R	A	107	124
PSM	EVLDEDTDEEKETLK	719	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3192.6	28.53308	3	1871.799071	1871.792516	K	N	990	1005
PSM	TASFSESRADEVAPAKK	720	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2960.4	22.78293	4	1872.869694	1872.861873	R	A	453	470
PSM	YNDWSDDDDDSNESK	721	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3052.6	25.10148	2	1883.599647	1883.600692	R	S	57	72
PSM	SLSTSGESLYHVLGLDK	722	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.5060.2	56.75775	3	1884.890171	1884.887025	R	N	8	25
PSM	TLRGSFSSTAAQDAQGQR	723	sp|Q86V85|GP180_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3109.4	26.50075	3	1959.883571	1959.879983	K	I	24	42
PSM	DYEEVGADSADGEDEGEEY	724	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3495.5	35.88382	2	2077.743447	2077.739614	K	-	431	450
PSM	NGVIQHTGAAAEEFNDDTD	725	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3328.3	31.89222	3	2082.822971	2082.816773	R	-	646	665
PSM	SGSTSSLSYSTWTSSHSDK	726	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3393.5	33.48207	3	2083.842071	2083.837174	R	T	197	216
PSM	SRTHSTSSSLGSGESPFSR	727	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3207.3	28.9037	3	2125.854071	2125.846708	R	S	327	346
PSM	SVSSFPVPQDNVDTHPGSGK	728	sp|Q676U5|A16L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3397.5	33.58401	3	2133.940271	2133.936829	R	E	287	307
PSM	ESEDKPEIEDVGSDEEEEK	729	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3092.2	26.10843	3	2191.918271	2191.912828	K	K	251	270
PSM	DNLTLWTSDQQDDDGGEGNN	730	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4139.2	48.42265	3	2192.877371	2192.873028	R	-	228	248
PSM	DYEEVGVDSVEGEGEEEGEEY	731	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3915.2	44.5539	3	2347.905071	2347.897571	K	-	431	452
PSM	LRKGSDALRPPVPQGEDEVPK	732	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3196.3	28.62993	4	2367.2036941913207	2367.1947742935395	R	A	306	327
PSM	DGVVEITGKHEERQDEHGYISR	733	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3076.5	25.71215	4	2553.222894	2553.220792	K	C	115	137
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	734	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3796.5	42.2637	5	3932.724118	3932.709658	K	T	6	40
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	735	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21,11-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3555.3	37.3165	4	3562.500894	3562.491898	K	V	60	92
PSM	DGNGYISAAELR	736	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3512.3	36.24705	2	1265.589847	1264.604780	K	H	96	108
PSM	ADEAPRKGSFSALVGR	737	sp|Q13619|CUL4A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3475.3	35.39615	3	1781.8504	1781.8456	M	T	2	18
PSM	RKNSTGSGHSAQELPTIR	738	sp|O94763|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2962.2	22.83082	4	2017.974494	2017.969466	K	T	369	387
PSM	RASAILR	739	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2884.2	21.08342	2	865.454047	865.453502	R	S	113	120
PSM	SPSTLLPK	740	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3345.2	32.30762	2	921.458447	921.457250	R	K	825	833
PSM	AFLAELEQNSPK	741	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3810.2	42.58683	3	1425.658571	1425.654112	K	I	4512	4524
PSM	RLSELLR	742	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3476.2	35.41842	2	965.509047	965.505931	R	Y	450	457
PSM	DAHNALLDIQSSGR	743	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3369.2	32.91345	3	1495.740971	1495.737919	K	A	628	642
PSM	MPSLPSYK	744	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3533.2	36.76512	2	1001.431847	1001.429321	R	V	303	311
PSM	RGQTCVVHYTGMLEDGK	745	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=1.1.3201.2	28.75285	4	2045.877294	2045.870012	K	K	19	36
PSM	NGRVEIIANDQGNR	746	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2939.2	22.31913	3	1554.790871	1554.786266	K	I	47	61
PSM	LQSIGTENTEENR	747	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2986.3	23.42495	3	1569.668771	1569.667196	R	R	44	57
PSM	SISLSQSAENVPASK	748	sp|Q4ADV7|RIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3275.2	30.6347	3	1596.739871	1596.739633	R	F	1015	1030
PSM	GHTDTEGRPPSPPPTSTPEK	749	sp|Q00613|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2780.2	18.98522	4	2166.967294	2166.958293	R	C	353	373
PSM	KGSFSALVGR	750	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3309.3	31.44467	2	1100.539647	1100.537960	R	T	8	18
PSM	SRGYSESVGAAPNASDGLAHSGK	751	sp|O15169|AXIN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3078.2	25.75358	4	2297.009294	2297.007368	R	V	575	598
PSM	TGYSFVNCK	752	sp|P43897|EFTS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3326.3	31.85105	2	1154.449247	1154.446762	K	K	57	66
PSM	RMQSLSLNK	753	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3107.4	26.44967	2	1155.547447	1155.547144	K	-	173	182
PSM	RLSSSSATLLNSPDR	754	sp|Q14244|MAP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3470.5	35.2779	3	1762.767671	1762.765210	K	A	198	213
PSM	QLEDGRTLSDYNIQK	755	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3263.3	30.3277	3	1778.882771	1778.879892	K	E	49	64
PSM	DNSTMGYMAAK	756	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3091.3	26.08398	2	1187.498047	1187.495094	R	K	621	632
PSM	SYTMDDAWK	757	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3566.2	37.59235	2	1195.428247	1195.425692	R	Y	930	939
PSM	RHLTGEFEK	758	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2859.2	20.47375	3	1195.541171	1195.538688	K	K	29	38
PSM	DSYVGDEAQSK	759	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2811.2	19.4195	2	1197.511847	1197.514961	K	R	53	64
PSM	SGEGEVSGLMR	760	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3364.3	32.78845	2	1200.487447	1200.484604	R	K	473	484
PSM	VEIIANDQGNR	761	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2983.4	23.3511	2	1227.620647	1227.620764	R	I	50	61
PSM	SFTLDDESLK	762	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3669.3	39.88107	2	1233.517847	1233.516615	R	Y	43	53
PSM	SNVSDAVAQSTR	763	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2951.6	22.56245	2	1233.594047	1233.594943	K	I	232	244
PSM	KGTFTDDLHK	764	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2961.3	22.80517	3	1240.552871	1240.548919	R	L	2243	2253
PSM	LDIDSPPITAR	765	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3587.3	38.10075	2	1276.609247	1276.606433	R	N	33	44
PSM	KETNNAAIIMK	766	sp|P60983|GMFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3033.2	24.60322	3	1311.628571	1311.625789	R	I	25	36
PSM	AFSDPFVEAEK	767	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3940.3	45.05617	2	1318.550047	1318.548250	R	S	74	85
PSM	KITIADCGQLE	768	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3453.3	34.87118	2	1326.590047	1326.589069	K	-	155	166
PSM	KITIADCGQLE	769	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3443.2	34.65497	2	1326.590047	1326.589069	K	-	155	166
PSM	LVRLSSDSFAR	770	sp|Q9HB09|B2L12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3372.2	32.99348	3	1329.647471	1329.644216	K	L	238	249
PSM	ERLESLNIQR	771	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3317.2	31.64403	3	1336.652171	1336.650030	K	E	580	590
PSM	NNASTDYDLSDK	772	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2976.3	23.1714	2	1341.568447	1341.568454	K	S	301	313
PSM	KESYSIYVYK	773	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3390.3	33.4088	3	1358.617871	1358.615935	R	V	35	45
PSM	KESYSIYVYK	774	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3380.4	33.18213	2	1358.617047	1358.615935	R	V	35	45
PSM	RALANSLACQGK	775	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2905.6	21.52852	2	1367.635247	1367.638085	K	Y	331	343
PSM	DSSSTNLESMDTS	776	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3196.4	28.6366	2	1372.535447	1372.530019	K	-	1218	1231
PSM	RRSPSPYYSR	777	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2771.3	18.81922	3	1427.580671	1427.574830	R	Y	258	268
PSM	RTKTEISEMNR	778	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2777.2	18.90092	3	1443.656771	1443.654129	R	N	302	313
PSM	NNSGEEFDCAFR	779	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3378.4	33.13728	2	1444.568247	1444.567742	R	L	591	603
PSM	DNLTLWTSDQQDDDGGEGNN	780	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3988.2	45.87225	3	2192.877071	2192.873028	R	-	228	248
PSM	CLSLSAGQTTLSR	781	sp|Q9BTE3|MCMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3493.4	35.8322	2	1472.666047	1472.669445	R	E	602	615
PSM	TDGSISGDRQPVTVADYISR	782	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3669.4	39.8844	3	2216.017871	2216.011056	R	A	598	618
PSM	NIIHGSDSVESAEK	783	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2932.2	22.13015	3	1484.712071	1484.710701	R	E	115	129
PSM	SFVKPPSLANLDK	784	sp|Q8NEY1|NAV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3702.2	40.59397	3	1494.746771	1494.748347	K	V	791	804
PSM	KGSITEYTAAEEK	785	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3027.4	24.45545	3	1505.666771	1505.665071	R	E	112	125
PSM	DNFGFIETANHDK	786	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3496.2	35.90938	3	1506.678971	1506.673922	K	E	528	541
PSM	MKVELCSFSGYK	787	sp|P83731|RL24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3636.2	39.09442	3	1527.650771	1527.650289	-	I	1	13
PSM	DRLGSYSGPTSVSR	788	sp|Q9BZ23|PANK2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3153.4	27.54337	3	1560.696371	1560.693351	R	Q	185	199
PSM	QVQSLTCEVDALK	789	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3845.2	43.26439	3	1569.712271	1569.710975	R	G	322	335
PSM	DFTVSAMHGDMDQK	790	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3356.2	32.58908	3	1580.667671	1580.659928	R	E	296	310
PSM	KQSLGELIGTLNAAK	791	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4059.2	47.16415	3	1621.849571	1621.844038	R	V	56	71
PSM	RNSFTPLSSSNTIR	792	sp|O60825|F262_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3312.2	31.51547	3	1658.780171	1658.777749	R	R	464	478
PSM	SQSRSNSPLPVPPSK	793	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3085.4	25.9381	3	1659.798071	1659.798150	R	A	297	312
PSM	EAELSKGESVCLDR	794	sp|P62072|TIM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3151.6	27.49927	3	1671.720371	1671.717517	K	C	40	54
PSM	TKSTGGAPTFNVTVTK	795	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3279.3	30.72695	3	1687.821071	1687.818217	R	T	90	106
PSM	FNAHGDANTIVCNSK	796	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3033.3	24.60988	3	1726.718471	1726.713435	R	D	50	65
PSM	GLERNDSWGSFDLR	797	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3874.2	43.83973	3	1730.743871	1730.741364	R	A	646	660
PSM	SGSDAGEARPPTPASPR	798	sp|Q96FS4|SIPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2872.2	20.81335	3	1731.760871	1731.757742	R	A	53	70
PSM	TLTTVQGIADDYDKK	799	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3587.2	38.09075	3	1746.810671	1746.807712	K	K	43	58
PSM	ERAMSTTSISSPQPGK	800	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.2821.3	19.56847	3	1771.782671	1771.781180	K	L	265	281
PSM	LGAGGGSPEKSPSAQELK	801	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2987.5	23.45732	3	1791.840371	1791.840409	R	E	13	31
PSM	VRQASVADYEETVKK	802	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3060.5	25.30342	3	1801.862771	1801.861145	R	A	80	95
PSM	SFSEDAVTDSSGSGTLPR	803	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3452.5	34.84905	3	1891.785071	1891.783682	K	A	1192	1210
PSM	YFQINQDEEEEEDED	804	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3542.5	37.00638	2	1930.731847	1930.722842	R	-	114	129
PSM	DKSPVREPIDNLTPEER	805	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3282.6	30.81382	3	2073.979271	2073.973214	K	D	134	151
PSM	NGSLDSPGKQDTEEDEEEDEK	806	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2848.5	20.24578	3	2429.923271	2429.923149	K	D	134	155
PSM	TQSSASLAASYAAQQHPQAAASYR	807	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3365.3	32.81407	4	2544.147294	2544.139445	R	G	518	542
PSM	RDSFDDRGPSLNPVLDYDHGSR	808	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3568.4	37.64848	4	2597.140094	2597.129609	R	S	186	208
PSM	RNSVERPAEPVAGAATPSLVEQQK	809	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3244.5	29.83745	4	2613.299294	2613.291195	R	M	1454	1478
PSM	YRTTSSANNPNLMYQDECDRR	810	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3136.4	27.11908	4	2670.101294	2670.095214	R	L	567	588
PSM	RVSVCAETYNPDEEEEDTDPRVIHPK	811	sp|P13861|KAP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3313.5	31.55113	5	3164.384618	3164.375789	R	T	97	123
PSM	ERHPSWRSEETQER	812	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2831.2	19.80955	4	1905.818094	1905.811903	R	E	402	416
PSM	CSSVTGVQR	813	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3137.3	27.1372	2	1055.4129	1055.4102	R	R	316	325
PSM	QNPSRCSVSLSNVEAR	814	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3384.5	33.27015	3	1865.8090	1865.8086	R	R	721	737
PSM	DGQAMLWDLNEGK	815	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4008.3	46.35537	2	1476.672447	1475.671479	K	H	213	226
PSM	CSSILLHGK	816	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3928.2	44.76142	2	1076.4736	1076.4721	R	E	518	527
PSM	KLSFDFQ	817	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3913.2	44.53277	2	963.411247	963.410300	R	-	465	472
PSM	RSTSPIIGSPPVR	818	sp|Q86TB9|PATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3165.4	27.85	3	1445.740271	1445.739179	R	A	176	189
PSM	RQSNLQEVLER	819	sp|O75665|OFD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3333.3	32.02132	3	1450.698671	1450.692957	R	E	897	908
PSM	TFSNVFGR	820	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3887.2	43.99968	2	1006.428247	1006.427347	K	H	764	772
PSM	DKSPVREPIDNLTPEER	821	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3282.2	30.80048	4	2073.982494	2073.973214	K	D	134	151
PSM	HGSLGFLPR	822	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3476.4	35.42508	2	1062.502847	1062.501180	R	K	11	20
PSM	DLLGLCEQK	823	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3582.2	37.97247	2	1074.539047	1074.537946	K	R	523	532
PSM	SLQSVAEER	824	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3194.3	28.57472	2	1097.479247	1097.475419	R	A	97	106
PSM	RQAQQERDELADEIANSSGK	825	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3218.2	29.18047	4	2244.078894	2244.073066	K	G	1697	1717
PSM	AGTGVDNVDLEAATRK	826	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3258.2	30.18578	3	1695.788771	1695.782894	R	G	76	92
PSM	GYSFTTTAER	827	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3149.6	27.44795	2	1131.519447	1131.519653	R	E	197	207
PSM	DVNQQEFVR	828	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3097.3	26.21605	2	1133.549447	1133.546536	K	A	8	17
PSM	TSSLTQFPPSQSEER	829	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3263.2	30.3177	3	1772.768771	1772.761825	R	S	124	139
PSM	SQGMALSLGDK	830	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3425.3	34.26175	2	1185.510447	1185.510090	K	I	933	944
PSM	TISNPEVVMK	831	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3309.4	31.45133	2	1196.552447	1196.551227	R	R	214	224
PSM	TRTFSATVR	832	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3005.3	23.90815	3	1197.497771	1197.494454	R	A	48	57
PSM	LATNTSAPDLK	833	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3067.5	25.48232	2	1209.563647	1209.564234	R	N	923	934
PSM	DSPSVWAAVPGK	834	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3545.2	37.06942	2	1212.616447	1212.613888	K	T	27	39
PSM	NAGVEGSLIVEK	835	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3249.3	29.95895	2	1214.651047	1214.650667	K	I	482	494
PSM	DNWEELYNR	836	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3627.2	38.89348	2	1237.536847	1237.536366	K	Y	833	842
PSM	RLGSLVDEFK	837	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3837.3	43.12803	2	1242.603447	1242.600954	K	E	517	527
PSM	QVVESAYEVIK	838	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3408.6	33.85038	2	1263.673247	1263.671068	K	L	233	244
PSM	NDSWGSFDLR	839	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4093.2	47.72837	2	1275.495847	1275.492132	R	A	650	660
PSM	VLQSFTVDSSK	840	sp|O75369|FLNB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3418.3	34.08204	2	1289.590847	1289.590449	R	A	1439	1450
PSM	LGMLSPEGTCK	841	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:35,5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3044.3	24.89102	2	1287.524847	1287.524026	R	A	203	214
PSM	KFTYLGSQDR	842	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3173.2	28.02945	3	1293.579671	1293.575468	R	A	296	306
PSM	AQSREQLAALK	843	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3025.3	24.40395	3	1293.647471	1293.644216	R	K	61	72
PSM	KRSEGFSMDR	844	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2617.2	17.14033	3	1307.535971	1307.532951	R	K	452	462
PSM	DVLSVAFSSDNR	845	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3830.2	42.97005	2	1308.632847	1308.630994	K	Q	107	119
PSM	VASETHSEGSEYEELPK	846	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3200.4	28.73342	3	1970.817371	1970.814648	R	R	1130	1147
PSM	RASHTLLPSHR	847	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2826.2	19.68902	2	1353.666047	1353.666683	R	L	559	570
PSM	GEPNVSYICSR	848	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3205.3	28.86412	2	1360.550447	1360.548267	R	Y	273	284
PSM	RLSSLRASTSK	849	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2963.2	22.85287	3	1364.626271	1364.621446	R	S	233	244
PSM	SRSRSPTPPSSAGLGSNSAPPIPDSR	850	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3291.6	31.0449	4	2737.228894	2737.222203	R	L	813	839
PSM	IVSAQSLAEDDVE	851	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3554.2	37.28873	2	1374.652647	1374.651455	R	-	133	146
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	852	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	28.95518	4	2779.103294	2779.094999	K	M	571	596
PSM	AFGESSTESDEEEEEGCGHTHCVR	853	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3014.4	24.12897	4	2818.014494	2818.011998	R	G	69	93
PSM	KIIEDQQESLNK	854	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2890.3	21.21452	3	1443.759071	1443.756923	K	W	317	329
PSM	TLTIVDTGIGMTK	855	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3805.2	42.47968	2	1444.691047	1444.688449	R	A	28	41
PSM	DLNHVCVISETGK	856	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3210.2	28.97753	3	1470.717971	1470.713678	R	A	201	214
PSM	FARRSVSDNDIR	857	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2873.6	20.83847	3	1514.700071	1514.699105	R	K	742	754
PSM	TSSTDEVLSLEEK	858	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3552.2	37.2401	2	1516.657847	1516.654566	R	D	528	541
PSM	RKASGPPVSELITK	859	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3185.3	28.34292	3	1561.826771	1561.822909	K	A	34	48
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	860	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3341.6	32.21827	3	2418.916271	2418.911873	R	R	42	68
PSM	DRTTSFFLNSPEK	861	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3654.3	39.55517	3	1620.723671	1620.718503	K	E	1274	1287
PSM	KAEAGAGSATEFQFR	862	sp|Q9NQ39|RS10L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3314.4	31.57353	3	1648.731071	1648.724651	K	G	150	165
PSM	ASSQSAPSPDVGSGVQT	863	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3160.5	27.72433	2	1653.687847	1653.688325	R	-	126	143
PSM	ESLKEEDESDDDNM	864	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2953.6	22.61295	2	1654.613847	1654.615206	K	-	242	256
PSM	RKSELPQDVYTIK	865	sp|Q14738|2A5D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3219.3	29.2089	3	1655.831771	1655.828388	R	A	571	584
PSM	ERESLQQMAEVTR	866	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2918.4	21.85067	3	1671.737171	1671.728751	K	E	123	136
PSM	RASSDLSIASSEEDK	867	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3072.3	25.6022	3	1673.732171	1673.714540	K	L	338	353
PSM	RLSSSSATLLNSPDR	868	sp|Q14244|MAP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3272.2	30.54503	3	1682.802671	1682.798879	K	A	198	213
PSM	KGDRSPEPGQTWTR	869	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2889.3	21.19252	3	1693.757471	1693.757348	R	E	89	103
PSM	RNSSSPVSPASVPGQR	870	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2984.3	23.37353	3	1704.795071	1704.794462	R	R	655	671
PSM	NRPTSISWDGLDSGK	871	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3579.2	37.9156	3	1711.754171	1711.756680	K	L	48	63
PSM	NLDIERPTYTNLNR	872	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3373.3	33.01903	3	1717.879871	1717.874747	R	L	216	230
PSM	TGSSSSILSASSESSEK	873	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3166.6	27.8822	2	1722.716247	1722.719685	R	A	2567	2584
PSM	KDSLTQAQEQGNLLN	874	sp|Q5JTD0|TJAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3371.5	32.97463	2	1737.796247	1737.793459	R	-	543	558
PSM	AGTRNIYYLCAPNR	875	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3410.2	33.8917	3	1747.789271	1747.786540	R	H	492	506
PSM	SSLGSLQTPEAVTTRK	876	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3312.4	31.52213	3	1753.866971	1753.861145	R	G	386	402
PSM	TSDFNTFLAQEGCTK	877	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3971.2	45.55405	3	1797.730271	1797.728082	K	G	199	214
PSM	SKTFSPGPQSQYVCR	878	sp|Q8IX03|KIBRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3175.4	28.08768	3	1820.798171	1820.791685	R	L	927	942
PSM	HSGSDRSSFSHYSGLK	879	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	23.44732	4	1830.772894	1830.768641	R	H	196	212
PSM	AGSSTPGDAPPAVAEVQGR	880	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3255.5	30.12258	3	1845.825671	1845.825822	R	S	2885	2904
PSM	MKDTDSEEEIREAFR	881	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3380.3	33.1788	4	1854.844494	1854.841792	K	V	77	92
PSM	RAPSVANVGSHCDLSLK	882	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3220.5	29.24087	3	1889.885771	1889.881897	R	I	2149	2166
PSM	SQSFSEAEPQLPPAPVR	883	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3654.5	39.56517	3	1918.887971	1918.882608	R	G	619	636
PSM	KEESEESDDDMGFGLFD	884	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4449.3	51.8146	2	1948.757847	1948.752033	K	-	98	115
PSM	GRLGSVDSFERSNSLASEK	885	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3384.3	33.26348	4	2197.946894	2197.940608	R	D	584	603
PSM	SGSPSDNSGAEEMEVSLAKPK	886	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3543.5	37.03072	3	2358.878471	2358.872921	R	H	122	143
PSM	YRTTSSANNPNLMYQDECDRR	887	sp|Q92841|DDX17_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=1.1.3010.3	24.04587	4	2686.096094	2686.090129	R	L	567	588
PSM	NRSYIDRDSEYLLQENEPDGTLDQK	888	sp|Q9H2U1|DHX36_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3672.3	39.95827	4	3077.371694	3077.361519	R	L	159	184
PSM	SGSANSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPR	889	sp|Q86YD5|LRAD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3677.5	40.05858	4	3760.654094	3760.644964	R	D	297	335
PSM	VNQIGSVTESLQACK	890	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3551.2	37.21573	3	1712.782571	1712.780452	K	L	344	359
PSM	NGRVEIIANDQGNR	891	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3077.3	25.73128	3	1555.770671	1554.786266	K	I	47	61
PSM	SLVIPEK	892	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3629.3	38.93768	2	906.4485	906.4458	M	F	2	9
PSM	NGSEADIDEGLYSR	893	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3456.3	34.90759	2	1525.654447	1524.669230	K	Q	44	58
PSM	PCSEETPAISPSK	894	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2956.2	22.67835	3	1482.6422	1481.6102	M	R	2	15
PSM	RRNTLQLHR	895	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2748.2	18.4747	3	1272.659471	1272.656452	R	Y	194	203
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	896	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3644.3	39.30958	3	2401.8895	2401.8848	R	R	42	68
PSM	IADPEHDHTGFLTEYVATR	897	sp|P27361|MK03_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.3656.2	39.60633	4	2330.966494	2330.961009	R	W	190	209
PSM	AASAATAAPTATPAAQESGTIPK	898	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3207.4	28.90703	3	2162.034371	2162.025644	R	K	63	86
PSM	GLTSVINQK	899	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3448.2	34.73677	2	1039.511847	1038.511076	R	L	300	309
PSM	SVTLLIK	900	sp|P40227|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3633.2	39.0365	2	852.473847	852.472172	R	G	371	378
PSM	NLLSVAYK	901	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3434.3	34.4482	2	906.517047	906.517468	R	N	44	52
PSM	NALLSLAK	902	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3696.2	40.45067	2	908.473247	908.473234	R	G	178	186
PSM	KASGPPVSELITK	903	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3338.4	32.13472	3	1405.725371	1405.721798	R	A	34	47
PSM	IRYESLTDPSKLDSGK	904	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3467.4	35.19475	4	1887.902094	1887.897924	K	E	54	70
PSM	KLSFDFQ	905	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3903.2	44.31438	2	963.411247	963.410300	R	-	465	472
PSM	TNTFLEAP	906	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3837.2	43.11803	2	971.401247	971.400129	R	-	247	255
PSM	TNTFLEAP	907	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	42.9256	2	971.401247	971.400129	R	-	247	255
PSM	LLGKGTFGK	908	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3088.2	26.01983	2	999.515047	999.515433	K	V	155	164
PSM	GLTSVINQK	909	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3440.2	34.59733	2	1038.511847	1038.511076	R	L	300	309
PSM	SDTFINLR	910	sp|P17655|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3645.2	39.32202	2	1044.465847	1044.464126	R	E	462	470
PSM	HGSYEDAVHSGALND	911	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3076.3	25.70548	3	1570.670171	1570.664814	K	-	542	557
PSM	LQSVVVVPK	912	sp|Q9BYW2|SETD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3366.2	32.83638	2	1047.574647	1047.572948	R	N	1066	1075
PSM	NCSSFLIK	913	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3474.4	35.37408	2	1047.447047	1047.446034	R	R	12	20
PSM	GDFCIQVGR	914	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=1.1.3385.2	33.28573	2	1050.490647	1050.491664	R	N	91	100
PSM	DFTVSAMHGDMDQK	915	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3167.3	27.90105	3	1596.657071	1596.654843	R	E	296	310
PSM	RLSESSALK	916	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2888.6	21.17415	2	1069.515647	1069.516890	R	Q	73	82
PSM	EIIDLVLDR	917	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4314.2	50.15199	2	1084.613647	1084.612825	K	I	113	122
PSM	ALLYLCGGDD	918	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3940.2	45.0495	2	1095.492247	1095.490661	K	-	330	340
PSM	SQSRSNSPLPVPPSK	919	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3069.5	25.53297	3	1659.798071	1659.798150	R	A	297	312
PSM	DANNGNLQLR	920	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2991.2	23.55135	2	1113.554647	1113.552684	K	N	288	298
PSM	DQLIYNLLK	921	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4317.2	50.1889	2	1118.635047	1118.633560	K	E	6	15
PSM	DLFPYEESK	922	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3576.3	37.83852	2	1126.520247	1126.518256	K	E	62	71
PSM	VYSTSVTGSR	923	sp|Q9H299|SH3L3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2944.3	22.41985	2	1135.491247	1135.491069	R	E	6	16
PSM	DVQDSLTVSNEAQTAK	924	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3199.4	28.70772	3	1704.819971	1704.816623	K	E	211	227
PSM	GFSIPECQK	925	sp|O75390|CISY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3403.5	33.74097	2	1144.463447	1144.462412	R	L	95	104
PSM	LKDDEVAQLK	926	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2981.2	23.2931	3	1157.629871	1157.629203	K	K	309	319
PSM	NSFREQLEEEEEAK	927	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3301.3	31.2915	3	1736.789171	1736.785323	K	H	1339	1353
PSM	QREESETRSESSDFEVVPK	928	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3162.6	27.77938	4	2318.010894	2318.006365	R	R	1238	1257
PSM	ARTSSTDEVLSLEEK	929	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3327.4	31.87043	3	1743.796571	1743.792790	R	D	526	541
PSM	STFVLDEFK	930	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4218.2	49.37247	2	1164.514647	1164.510408	K	R	286	295
PSM	NNNTDLMILK	931	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3506.3	36.11058	2	1174.599247	1174.601608	R	N	345	355
PSM	GGPGSTLSFVGK	932	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3491.3	35.7808	2	1185.541647	1185.543105	K	R	107	119
PSM	ARSPSVAAMASPQLCR	933	sp|P25325-2|THTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3287.3	30.94213	3	1780.816271	1780.811375	R	A	13	29
PSM	SFAGNLNTYK	934	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3384.4	33.26682	2	1193.511047	1193.511805	R	R	386	396
PSM	EAAENSLVAYK	935	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3145.3	27.33962	2	1193.593047	1193.592818	K	A	143	154
PSM	NSSVAAAQLVR	936	sp|Q5TAX3|TUT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3204.4	28.83297	2	1194.574847	1194.575802	R	N	1382	1393
PSM	DDTDDEIAKYDGKWEVEEMK	937	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	19-UNIMOD:35	ms_run[1]:scan=1.1.3601.4	38.37685	4	2431.045294	2431.037317	K	E	91	111
PSM	SASITNLSLDR	938	sp|Q9Y2I7|FYV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3495.3	35.87382	2	1255.582047	1255.580947	R	S	305	316
PSM	DLSPQHMVVR	939	sp|P49590|SYHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3273.2	30.58402	3	1260.573371	1260.568608	R	E	65	75
PSM	DIIACGFDINK	940	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3832.2	43.01038	2	1264.613247	1264.612173	K	T	221	232
PSM	SNTISTVDLNK	941	sp|Q13480|GAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3217.4	29.16198	2	1270.582447	1270.580613	R	L	385	396
PSM	LMIEMDGTENK	942	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3371.4	32.9713	2	1279.581847	1279.578824	K	S	93	104
PSM	GGSGSGPTIEEVD	943	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3332.5	32.00525	2	1283.492447	1283.491857	K	-	629	642
PSM	RKFSMEPGDEDLDCDNDHVSK	944	sp|Q14135|VGLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3183.4	28.29463	4	2573.028894	2573.019983	K	M	56	77
PSM	TFNPGAGLPTDK	945	sp|P09661|RU2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3465.4	35.1432	2	1296.576847	1296.575133	K	K	180	192
PSM	RLSESQLSFR	946	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	32.48578	2	1301.614847	1301.612916	R	R	616	626
PSM	SASFNTDPYVR	947	sp|Q9UKV8|AGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3374.4	33.0546	2	1335.551247	1335.549647	R	E	385	396
PSM	RAMSGLEGPLTK	948	sp|Q9P2N5|RBM27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	31.99192	3	1338.6407	1338.6362	K	K	563	575
PSM	RRSPSPYYSR	949	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2765.2	18.67013	3	1347.611771	1347.608499	R	Y	258	268
PSM	SLSLQPQLTQR	950	sp|P21731|TA2R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3482.4	35.57967	2	1349.671647	1349.670431	R	S	329	340
PSM	NSLTGEEGQLAR	951	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3211.4	29.00965	2	1353.595447	1353.592574	R	V	111	123
PSM	GEPNVSYICSR	952	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3213.6	29.0681	2	1360.548247	1360.548267	R	Y	273	284
PSM	RLSSLRASTSK	953	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2945.3	22.44513	3	1364.625971	1364.621446	R	S	233	244
PSM	SSGSVASLPQSDR	954	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2987.6	23.46065	2	1369.589847	1369.587489	K	S	310	323
PSM	RRLSYNTASNK	955	sp|P49207|RL34_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2710.2	17.97403	3	1388.658071	1388.656178	R	T	9	20
PSM	DFTPVCTTELGR	956	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3530.3	36.69573	2	1394.650647	1394.650015	R	A	42	54
PSM	GNPTVEVDLFTSK	957	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3769.2	41.71965	2	1405.710647	1405.708910	R	G	16	29
PSM	GILAADESTGSIAK	958	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3398.3	33.61298	2	1411.660647	1411.659591	K	R	29	43
PSM	TASGSSVTSLDGTR	959	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3083.5	25.8902	2	1417.608647	1417.608618	R	S	328	342
PSM	GRLSVASTPISQR	960	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3150.3	27.46333	3	1450.733771	1450.729343	R	R	237	250
PSM	RFSMVVQDGIVK	961	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3639.3	39.17095	3	1457.711471	1457.710187	K	A	180	192
PSM	NQSFCPTVNLDK	962	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3482.5	35.583	2	1501.631647	1501.627246	R	L	66	78
PSM	TLPADVQNYYSR	963	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3561.4	37.47152	2	1505.658447	1505.655175	K	R	1153	1165
PSM	NRDSDKTDTDWR	964	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2772.3	18.84418	3	1507.670471	1507.665148	R	A	189	201
PSM	LGSTSGEESDLEREVSDSEAGGGPQGERK	965	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3543.3	37.02405	4	3042.315294	3042.305126	R	N	355	384
PSM	NGSEADIDEGLYSR	966	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3289.4	30.98682	2	1524.669647	1524.669230	K	Q	44	58
PSM	NVFSSSGTSFSGRK	967	sp|P49790|NU153_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3224.3	29.33508	3	1539.682271	1539.671887	K	I	1453	1467
PSM	RRTWDDDYVLK	968	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3315.2	31.59562	3	1545.700271	1545.697708	R	R	1758	1769
PSM	SSTVTEAPIAVVTSR	969	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3654.2	39.55183	3	1596.777671	1596.776018	R	T	331	346
PSM	SMSVYCTPNKPSR	970	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3043.3	24.87208	3	1605.672371	1605.668065	K	T	493	506
PSM	SMGGAAIAPPTSLVEK	971	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3757.4	41.54888	2	1607.767247	1607.763011	R	D	169	185
PSM	KHDSGAADLERVTDYAEEK	972	sp|Q9NX55|HYPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3417.4	34.05633	4	2212.966894	2212.963772	R	E	35	54
PSM	NTVSQSISGDPEIDK	973	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3162.4	27.77272	3	1668.727571	1668.724376	R	K	521	536
PSM	ATAGDTHLGGEDFDNR	974	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3062.3	25.34777	3	1674.727571	1674.723391	K	L	221	237
PSM	RMTGSEFDFEEMK	975	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3732.2	41.08308	2	1685.652247	1685.646660	K	R	423	436
PSM	RNSSSPVSPASVPGQR	976	sp|Q9H1B7|I2BPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2992.2	23.57287	3	1704.795071	1704.794462	R	R	655	671
PSM	SVTSNQSDGTQESCESPDVLDRHQTMEVSC	977	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:4,26-UNIMOD:35,29-UNIMOD:21,30-UNIMOD:4	ms_run[1]:scan=1.1.3238.2	29.6888	4	3478.370094	3478.359624	R	-	346	376
PSM	AMSEVTSLHEDDWR	978	sp|Q86X29|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3678.2	40.07107	3	1754.700071	1754.697116	R	S	430	444
PSM	TSSLTQFPPSQSEER	979	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3239.3	29.7042	3	1772.762771	1772.761825	R	S	124	139
PSM	DCEECIQLEPTFIK	980	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.4012.2	46.44876	3	1780.809071	1780.801173	K	G	416	430
PSM	HVPDSGATATAYLCGVK	981	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3507.4	36.12952	3	1825.812371	1825.807001	K	G	110	127
PSM	DRSSTTSTWELLDQR	982	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3850.3	43.3912	3	1873.822271	1873.820736	K	T	542	557
PSM	SYSSPDITQAIQEEEK	983	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3851.2	43.41343	3	1903.811471	1903.808834	R	R	716	732
PSM	ERTSSLTQFPPSQSEER	984	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3161.4	27.75337	3	2057.910671	2057.905529	R	S	122	139
PSM	TSSTCSNESLSVGGTSVTPR	985	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3301.4	31.29483	3	2105.898071	2105.893644	R	R	749	769
PSM	DLLLTSSYLSDSGSTGEHTK	986	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3755.2	41.49082	3	2110.013771	2110.006609	K	S	397	417
PSM	DNLTLWTSENQGDEGDAGEGEN	987	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4059.3	47.17415	3	2349.951371	2349.946922	R	-	225	247
PSM	ETWDTAEEDSGTDSEYDESGK	988	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3328.4	31.89555	3	2429.857571	2429.854400	K	S	1004	1025
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	989	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3472.2	35.31903	4	2727.242494	2727.234862	R	G	70	97
PSM	TETVEEPMEEEEAAKEEKEESDDEAAVEEEEEEK	990	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3537.4	36.8807	4	3954.638894	3954.621933	K	K	286	320
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	991	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3420.3	34.13038	4	3223.236894	3223.230486	K	-	122	148
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	992	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3250.5	29.99158	5	4245.559118	4245.543285	K	S	158	195
PSM	LISISGK	993	sp|Q9C0A0|CNTP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3331.2	31.96605	2	796.411647	796.409571	R	V	518	525
PSM	DRSSFYVNGLTLGGQK	994	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3685.2	40.24994	3	1741.864271	1740.879498	K	C	55	71
PSM	IEAFRASLSK	995	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	29.05477	3	1200.592571	1200.590389	K	L	147	157
PSM	GGNFGGRSSGPYGGGGQYFAK	996	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3365.5	32.82407	3	2099.892071	2099.885068	K	P	278	299
PSM	SSFSESALEK	997	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3589.2	38.15193	2	1205.4879	1205.4848	M	K	2	12
PSM	MSGFIYQGK	998	sp|Q15052|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3271.3	30.52282	2	1125.459247	1125.456598	R	I	487	496
PSM	NGRYSISRTEAADLCK	999	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3163.3	27.80478	3	1919.859971	1919.856076	K	A	39	55
PSM	RASSARANITLSGK	1000	sp|E9PRG8|CK098_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2978.2	23.22038	3	1590.731171	1590.728036	K	K	54	68
PSM	NGQDLGVAFK	1001	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3456.2	34.90425	2	1048.521447	1047.534909	K	I	424	434
PSM	RLSELLR	1002	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3468.2	35.2135	2	965.509047	965.505931	R	Y	450	457
PSM	KQLSWLINR	1003	sp|Q8NHM5|KDM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4703.2	53.9583	2	1237.634647	1236.638008	K	L	1139	1148
PSM	RTSFSTSDVSK	1004	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2909.2	21.61625	3	1293.561071	1293.560212	R	L	1352	1363
PSM	CGSVLVR	1005	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.2995.2	23.64887	2	869.382647	869.383039	R	L	188	195
PSM	QLIVGVNK	1006	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3103.2	26.34097	2	869.532647	869.533452	K	M	147	155
PSM	LVSLIGSK	1007	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3638.2	39.14188	2	895.479447	895.477985	R	T	108	116
PSM	TIAPALVSK	1008	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3114.2	26.62208	2	898.550047	898.548768	K	K	72	81
PSM	LRTASVPLDAVR	1009	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3339.2	32.15351	3	1376.721971	1376.717715	R	A	125	137
PSM	GLFIIDDK	1010	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3788.2	42.08123	2	919.503847	919.501484	R	G	129	137
PSM	SPSTLLPK	1011	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3337.2	32.10183	2	921.458447	921.457250	R	K	825	833
PSM	SPSTLLPK	1012	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3328.2	31.88888	2	921.458447	921.457250	R	K	825	833
PSM	SLSVLSPR	1013	sp|P53814|SMTN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3428.2	34.32465	2	937.463447	937.463398	R	Q	299	307
PSM	HRDTGILDSIGR	1014	sp|P02686|MBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3327.2	31.86377	3	1418.671271	1418.666742	R	F	166	178
PSM	EAFSLFDK	1015	sp|P27482|CALL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3774.2	41.83523	2	955.465447	955.465098	K	D	15	23
PSM	SRSLSASPALGSTK	1016	sp|O95544|NADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2982.4	23.32547	3	1440.698771	1440.697374	K	E	44	58
PSM	SVSQDLIK	1017	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	29.23087	2	968.457047	968.457978	R	K	377	385
PSM	EIAEAYLGK	1018	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3247.2	29.90452	2	992.519047	992.517862	K	T	129	138
PSM	DLTDYLMK	1019	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:35	ms_run[1]:scan=1.1.3657.2	39.6319	2	1013.475447	1013.473949	R	I	186	194
PSM	RGQTCVVHYTGMLEDGK	1020	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3403.2	33.72763	4	2029.879694	2029.875097	K	K	19	36
PSM	LLTFGCNK	1021	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3595.2	38.23063	2	1031.453047	1031.451119	R	C	618	626
PSM	RLSESLHVVDENKNESK	1022	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3080.2	25.80483	4	2062.975694	2062.968463	R	L	633	650
PSM	AKSIVFHR	1023	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2904.2	21.48995	3	1036.526771	1036.521916	K	K	133	141
PSM	RLMSMEMD	1024	sp|Q9P2B2|FPRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3626.2	38.86802	2	1091.387247	1091.385089	R	-	872	880
PSM	QEYDESGPSIVHRK	1025	sp|Q9BYX7|ACTBM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2917.3	21.82525	3	1643.796671	1643.790349	K	C	360	374
PSM	GLATFCLDK	1026	sp|O00264|PGRC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3791.2	42.14432	2	1103.474047	1103.472248	R	E	124	133
PSM	YRPGTVALR	1027	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3046.2	24.93543	3	1111.556471	1111.553944	R	E	42	51
PSM	RHLTGEFEK	1028	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2825.2	19.66153	3	1115.576771	1115.572357	K	K	29	38
PSM	DLEGSDIDTR	1029	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3018.2	24.21757	2	1119.506247	1119.504397	R	R	373	383
PSM	RQSVSPPYKEPSAYQSSTR	1030	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3046.4	24.9421	4	2247.034894	2247.032126	R	S	272	291
PSM	RMTGSEFDFEEMK	1031	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35,5-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3312.3	31.5188	3	1717.641071	1717.636490	K	R	423	436
PSM	GSFSLGEQSR	1032	sp|Q8TEB1|DCA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3218.3	29.18713	2	1146.472447	1146.470668	R	V	146	156
PSM	GESPVDYDGGR	1033	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2959.4	22.76407	2	1150.489447	1150.489081	K	T	246	257
PSM	FEDENFILK	1034	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3682.3	40.17615	2	1153.567847	1153.565540	K	H	83	92
PSM	TMSINAAELK	1035	sp|Q69YN4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3492.4	35.79998	2	1156.522247	1156.519927	R	Q	1430	1440
PSM	SLSEAMSVEK	1036	sp|Q6P1J9|CDC73_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3366.4	32.84305	2	1159.485647	1159.483207	R	I	172	182
PSM	SASVSSISLTK	1037	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3255.3	30.11258	2	1158.554847	1158.553335	R	G	1132	1143
PSM	SIYYITGESK	1038	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3296.2	31.15982	2	1159.577047	1159.576105	K	E	258	268
PSM	NARATLSSIR	1039	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3000.2	23.7764	3	1167.578171	1167.576136	K	H	85	95
PSM	FSSVSSPQPR	1040	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2933.4	22.16828	2	1170.512847	1170.507054	R	S	337	347
PSM	LLEELEEGQK	1041	sp|Q13404|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3357.3	32.62395	2	1186.620847	1186.608134	R	G	17	27
PSM	YRSRGPPRPRPAPAVGEAEDK	1042	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2847.2	20.22415	4	2385.1736941913205	2385.1702908811994	R	E	291	312
PSM	SSTLSQLPGDK	1043	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3146.4	27.3648	2	1211.544847	1211.543499	R	S	593	604
PSM	SIRPGLSPYR	1044	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3189.2	28.44203	3	1224.603371	1224.601623	R	A	52	62
PSM	TNQELQEINR	1045	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3008.5	23.99497	2	1243.617847	1243.615679	R	V	136	146
PSM	DNSTMGYMMAK	1046	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35	ms_run[1]:scan=1.1.3070.2	25.55137	2	1263.493047	1263.493380	R	K	486	497
PSM	ELISNASDALDK	1047	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3319.4	31.70212	2	1274.638447	1274.635411	R	I	103	115
PSM	EGMNIVEAMER	1048	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3790.2	42.1188	2	1277.575047	1277.574407	K	F	134	145
PSM	SYSSTLTDMGR	1049	sp|O94875|SRBS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3513.3	36.2662	2	1296.506447	1296.505733	R	S	841	852
PSM	CSVSLSNVEAR	1050	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3314.6	31.5802	2	1300.552247	1300.548267	R	R	726	737
PSM	VAPEEHPVLLTEAPLNPK	1051	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3528.2	36.63922	3	1953.067271	1953.057128	R	A	96	114
PSM	EDQTEYLEER	1052	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3114.5	26.63542	2	1310.563647	1310.562640	K	R	166	176
PSM	MASNIFGPTEEPQNIPK	1053	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3729.2	40.99958	3	1967.876771	1967.869995	R	R	43	60
PSM	NELESYAYSLK	1054	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3649.3	39.43107	2	1315.631247	1315.629597	R	N	563	574
PSM	AFSDPFVEAEK	1055	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3953.2	45.26523	2	1318.550047	1318.548250	R	S	74	85
PSM	SYSVVASEYDK	1056	sp|O75592|MYCB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3364.4	32.79178	2	1326.537647	1326.538079	R	Q	3476	3487
PSM	SSSEDAESLAPR	1057	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3075.5	25.68618	2	1327.531047	1327.529305	R	S	298	310
PSM	GILAADESTGSIAK	1058	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3247.6	29.91785	2	1331.695247	1331.693260	K	R	29	43
PSM	RLSSLRASTSK	1059	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2981.5	23.3031	3	1364.625671	1364.621446	R	S	233	244
PSM	QRMESALDQLK	1060	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3515.2	36.31472	3	1397.638571	1397.637416	R	Q	9	20
PSM	ESVPEFPLSPPK	1061	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3956.2	45.31603	2	1405.655847	1405.653049	K	K	30	42
PSM	ESVPEFPLSPPK	1062	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3982.2	45.74885	2	1405.655847	1405.653049	K	K	30	42
PSM	KASGPPVSELITK	1063	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	32.33965	2	1405.724847	1405.721798	R	A	34	47
PSM	TYSDTDSCSDIPLEDPDRPVHCSK	1064	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,8-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3344.2	32.28185	4	2873.156494	2873.152120	R	N	242	266
PSM	TLTIVDTGIGMTK	1065	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3744.3	41.28973	2	1444.691447	1444.688449	R	A	28	41
PSM	HEQNIDCGGGYVK	1066	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2890.4	21.21785	3	1475.648171	1475.646327	K	L	99	112
PSM	TTPSYVAFTDTER	1067	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3450.5	34.79778	2	1486.694847	1486.693989	R	L	37	50
PSM	TAENFRALSTGEK	1068	sp|Q9Y536|PAL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3099.2	26.25882	3	1502.679371	1502.676638	K	G	32	45
PSM	TLPADVQNYYSR	1069	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3569.5	37.67658	2	1505.658447	1505.655175	K	R	1153	1165
PSM	SQSMDIDGVSCEK	1070	sp|O95155|UBE4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=1.1.2975.6	23.15733	2	1550.563047	1550.562991	R	S	103	116
PSM	DIEREDIEFICK	1071	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3610.4	38.54682	3	1565.742971	1565.739559	K	T	327	339
PSM	GLNSRLEATAASSVK	1072	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3452.3	34.84238	3	1582.770971	1582.771601	R	T	129	144
PSM	LTFDSSFSPNTGKK	1073	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3431.5	34.39723	3	1607.724671	1607.723254	K	N	97	111
PSM	HRPSEADEEELAR	1074	sp|O14617|AP3D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2862.4	20.5557	3	1617.679871	1617.678429	K	R	655	668
PSM	GRTASETRSEGSEYEEIPK	1075	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3060.4	25.30008	4	2204.962094	2204.958687	R	R	1081	1100
PSM	DVVICPDASLEDAKK	1076	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3343.3	32.2597	3	1658.823671	1658.818537	R	E	49	64
PSM	LQSIGTENTEENRR	1077	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2909.4	21.62292	3	1725.766571	1725.768307	R	F	44	58
PSM	KASPPSGLWSPAYASH	1078	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3584.3	38.0141	3	1734.781571	1734.776687	R	-	1872	1888
PSM	TSSLTQFPPSQSEER	1079	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3561.3	37.46818	3	1772.763071	1772.761825	R	S	124	139
PSM	NTVSQSISGDPEIDKK	1080	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3023.4	24.35268	3	1796.822171	1796.819339	R	I	521	537
PSM	HVPDSGATATAYLCGVK	1081	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3517.2	36.36307	3	1825.812371	1825.807001	K	G	110	127
PSM	SGKYDLDFKSPDDPSR	1082	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3245.2	29.85308	4	1825.854094	1825.848257	R	Y	254	270
PSM	DAINQGMDEELERDEK	1083	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3354.3	32.53732	3	1890.831371	1890.826536	R	V	37	53
PSM	LGSVDSFERSNSLASEK	1084	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.3497.6	35.93508	3	1984.818971	1984.818033	R	D	586	603
PSM	RASSASVPAVGASAEGTRR	1085	sp|Q9BZ23|PANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.2976.2	23.16807	3	1988.884871	1988.883033	R	D	166	185
PSM	TASETRSEGSEYEEIPK	1086	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3165.6	27.85667	3	1991.836871	1991.836112	R	R	1083	1100
PSM	DDDGSSARGSFSGQAQPLR	1087	sp|Q92609|TBCD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3100.5	26.29372	3	2029.851971	2029.849076	K	T	721	740
PSM	ERTSSLTQFPPSQSEER	1088	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3434.4	34.45153	3	2057.908571	2057.905529	R	S	122	139
PSM	NGVIQHTGAAAEEFNDDTD	1089	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3337.3	32.10517	3	2082.822971	2082.816773	R	-	646	665
PSM	SFSASQSTDREGASPVTEVR	1090	sp|Q9ULJ3|ZBT21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3207.5	28.91037	3	2189.965871	2189.959021	R	I	409	429
PSM	DNLTLWTSDMQGDGEEQNK	1091	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3685.6	40.26327	3	2195.931671	2195.927707	R	E	226	245
PSM	SDSSSKKDVIELTDDSFDK	1092	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3578.2	37.87672	4	2194.956894	2194.951870	R	N	154	173
PSM	HRTLTAEEAEEEWERR	1093	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3339.3	32.16018	4	2200.903694	2200.893992	R	N	152	168
PSM	TVGTPIASVPGSTNTGTVPGSEK	1094	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3395.5	33.53267	3	2236.068371	2236.062423	R	D	270	293
PSM	DNLTLWTSENQGDEGDAGEGEN	1095	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4041.3	46.87997	3	2349.951371	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	1096	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4177.2	48.91577	3	2349.951371	2349.946922	R	-	225	247
PSM	TGSQGQCTQVRVEFMDDTSR	1097	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3550.5	37.20108	3	2380.983071	2380.977725	R	S	21	41
PSM	CESAPGCGVWQRPVIDNPNYK	1098	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3635.3	39.07852	3	2526.090371	2526.082130	R	G	360	381
PSM	NGSLDSPGKQDTEEDEEEDEK	1099	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2891.5	21.24982	3	2430.906671	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	1100	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2861.5	20.53723	4	2674.035294	2673.045055	K	G	134	157
PSM	GVSLTNHHFYDESK	1101	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3279.4	30.73028	3	1713.705371	1712.719566	R	P	22	36
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	1102	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3639.5	39.17762	3	2508.0832	2508.0760	M	R	2	32
PSM	ASGVAVSDGVIK	1103	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3453.2	34.86452	2	1143.6135	1143.6130	M	V	2	14
PSM	SPSTLLPK	1104	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3318.2	31.6728	2	921.457647	921.457250	R	K	825	833
PSM	CSSILLHGK	1105	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3936.2	44.95307	2	1076.4736	1076.4721	R	E	518	527
PSM	VLLPEYGGTK	1106	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3505.2	36.085	2	1155.559247	1155.557692	K	V	71	81
PSM	SFLFSSR	1107	sp|Q9H8S9|MOB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5455.3	59.72763	2	964.4057	964.4050	M	S	2	9
PSM	SFLFSSRSSK	1108	sp|Q9H8S9|MOB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4832.2	54.94375	2	1346.5339	1346.5304	M	T	2	12
PSM	DANNGNLQLR	1109	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.2999.4	23.75748	2	1114.536847	1113.552684	K	N	288	298
PSM	KESYSIYVYK	1110	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3269.2	30.46817	3	1360.596971	1358.615935	R	V	35	45
PSM	RLASSVLR	1111	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3282.4	30.80715	2	1060.484847	1060.483161	K	C	9	17