MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000151 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617205149466520^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_22_K3_5.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null		0.15	44.0	6	2	1
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	1053-UNIMOD:21,1054-UNIMOD:35	0.02	42.0	6	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	237-UNIMOD:4,141-UNIMOD:21	0.18	41.0	4	2	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	337-UNIMOD:4,339-UNIMOD:4	0.21	40.0	11	8	7
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	1167-UNIMOD:21	0.01	39.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	641-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q13501|SQSTM_HUMAN	Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	24-UNIMOD:21,26-UNIMOD:4,27-UNIMOD:4,44-UNIMOD:4	0.06	38.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	202-UNIMOD:21,37-UNIMOD:21,45-UNIMOD:21,49-UNIMOD:4	0.13	38.0	8	6	5
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	235-UNIMOD:35	0.17	38.0	11	3	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	1542-UNIMOD:21,1688-UNIMOD:21,1692-UNIMOD:4,1220-UNIMOD:21	0.02	38.0	3	3	3
PRT	sp|O15013|ARHGA_HUMAN	Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	1287-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	76-UNIMOD:21	0.06	38.0	2	2	2
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	272-UNIMOD:21,455-UNIMOD:21,464-UNIMOD:35,15-UNIMOD:21,16-UNIMOD:4,19-UNIMOD:4	0.09	37.0	5	3	2
PRT	sp|Q12965|MYO1E_HUMAN	Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	935-UNIMOD:21	0.02	37.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	83-UNIMOD:21,91-UNIMOD:35	0.09	36.0	2	1	0
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	24-UNIMOD:21,126-UNIMOD:21,70-UNIMOD:4,74-UNIMOD:21,77-UNIMOD:4,130-UNIMOD:35	0.12	36.0	5	3	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	18-UNIMOD:21,16-UNIMOD:28,19-UNIMOD:21,63-UNIMOD:21,174-UNIMOD:35,176-UNIMOD:21	0.25	36.0	6	3	2
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	47-UNIMOD:21	0.18	36.0	12	3	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	1669-UNIMOD:21,1676-UNIMOD:4,1860-UNIMOD:21,1861-UNIMOD:21	0.02	36.0	3	2	1
PRT	sp|P31749|AKT1_HUMAN	RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	308-UNIMOD:21,310-UNIMOD:4,306-UNIMOD:35,305-UNIMOD:21,315-UNIMOD:21,146-UNIMOD:21,147-UNIMOD:35,246-UNIMOD:21,195-UNIMOD:21,124-UNIMOD:21,129-UNIMOD:21,137-UNIMOD:21	0.19	36.0	16	6	3
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	330-UNIMOD:21,366-UNIMOD:21,328-UNIMOD:21,333-UNIMOD:21	0.11	35.0	5	4	3
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.15	35.0	15	2	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	670-UNIMOD:21,675-UNIMOD:21	0.04	35.0	2	1	0
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	395-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q68CZ2|TENS3_HUMAN	Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	776-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	315-UNIMOD:21,314-UNIMOD:35,317-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|Q16637|SMN_HUMAN	Survival motor neuron protein OS=Homo sapiens OX=9606 GN=SMN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	25-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	654-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	111-UNIMOD:21,116-UNIMOD:21	0.05	33.0	3	2	1
PRT	sp|Q9H788|SH24A_HUMAN	SH2 domain-containing protein 4A OS=Homo sapiens OX=9606 GN=SH2D4A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	315-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	46-UNIMOD:21,39-UNIMOD:21	0.08	33.0	9	5	3
PRT	sp|Q96B23|CR025_HUMAN	Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	67-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	188-UNIMOD:21	0.03	33.0	3	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	36-UNIMOD:35,37-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|Q9H910|JUPI2_HUMAN	Jupiter microtubule associated homolog 2 OS=Homo sapiens OX=9606 GN=JPT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	45-UNIMOD:21,43-UNIMOD:35	0.09	32.0	2	1	0
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	30-UNIMOD:21,38-UNIMOD:35	0.03	32.0	5	1	0
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	426-UNIMOD:21	0.04	32.0	3	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	317-UNIMOD:21,467-UNIMOD:21	0.13	32.0	10	6	5
PRT	sp|O14974|MYPT1_HUMAN	Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	696-UNIMOD:21,445-UNIMOD:21,910-UNIMOD:21	0.04	32.0	3	3	3
PRT	sp|Q13409|DC1I2_HUMAN	Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	92-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	57-UNIMOD:21	0.12	32.0	5	1	0
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	617-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	163-UNIMOD:21,173-UNIMOD:4,162-UNIMOD:21,16-UNIMOD:21	0.13	32.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	183-UNIMOD:21,182-UNIMOD:21	0.02	32.0	5	3	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	152-UNIMOD:21,153-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	54-UNIMOD:21,192-UNIMOD:35	0.19	31.0	7	5	3
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	449-UNIMOD:21,448-UNIMOD:21,453-UNIMOD:21	0.01	31.0	3	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	1709-UNIMOD:21,429-UNIMOD:21,854-UNIMOD:21,872-UNIMOD:21	0.04	31.0	6	4	2
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	335-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	24-UNIMOD:4	0.26	31.0	1	1	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.10	31.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null		0.18	31.0	3	2	1
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	933-UNIMOD:21,936-UNIMOD:35	0.01	30.0	4	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	30.0	2	1	0
PRT	sp|Q5M775|CYTSB_HUMAN	Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	131-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	359-UNIMOD:21,207-UNIMOD:21,230-UNIMOD:21,406-UNIMOD:21	0.13	30.0	13	7	5
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	323-UNIMOD:21,302-UNIMOD:21	0.15	30.0	6	4	2
PRT	sp|Q6ZN18|AEBP2_HUMAN	Zinc finger protein AEBP2 OS=Homo sapiens OX=9606 GN=AEBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	206-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	52-UNIMOD:21,51-UNIMOD:21	0.09	30.0	3	1	0
PRT	sp|Q5JTD0|TJAP1_HUMAN	Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	545-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P53396|ACLY_HUMAN	ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	455-UNIMOD:21,656-UNIMOD:21	0.03	30.0	3	3	3
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|O15027|SC16A_HUMAN	Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	1369-UNIMOD:21,2293-UNIMOD:385,2293-UNIMOD:4,2294-UNIMOD:21	0.01	30.0	2	2	2
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	30.0	null	1541-UNIMOD:21,1537-UNIMOD:21,2692-UNIMOD:21,1043-UNIMOD:21,1539-UNIMOD:21,968-UNIMOD:21,534-UNIMOD:21,536-UNIMOD:21,848-UNIMOD:21	0.04	30.0	8	7	6
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	94-UNIMOD:21	0.11	30.0	9	5	2
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	317-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	751-UNIMOD:21,753-UNIMOD:4,588-UNIMOD:21,752-UNIMOD:21,754-UNIMOD:21,316-UNIMOD:385,316-UNIMOD:4,317-UNIMOD:21	0.03	30.0	8	5	2
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	42-UNIMOD:4,45-UNIMOD:21,42-UNIMOD:385,43-UNIMOD:21	0.05	30.0	2	1	0
PRT	sp|P47736|RPGP1_HUMAN	Rap1 GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RAP1GAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	499-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	76-UNIMOD:21	0.08	29.0	5	4	3
PRT	sp|Q9UJS0|CMC2_HUMAN	Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens OX=9606 GN=SLC25A13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	364-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1286-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	60-UNIMOD:21	0.29	29.0	5	3	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	678-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	40-UNIMOD:21,45-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	521-UNIMOD:21,827-UNIMOD:21,925-UNIMOD:21	0.03	29.0	5	3	2
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	7330-UNIMOD:21,7344-UNIMOD:4,4521-UNIMOD:21	0.01	29.0	2	2	2
PRT	sp|Q13510|ASAH1_HUMAN	Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	301-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	881-UNIMOD:21,1160-UNIMOD:21,1167-UNIMOD:21,888-UNIMOD:35,838-UNIMOD:21,644-UNIMOD:21,958-UNIMOD:21	0.04	29.0	6	5	4
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	65-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	379-UNIMOD:21,198-UNIMOD:21	0.06	29.0	2	2	2
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	700-UNIMOD:21,708-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q92541|RTF1_HUMAN	RNA polymerase-associated protein RTF1 homolog OS=Homo sapiens OX=9606 GN=RTF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	79-UNIMOD:21	0.05	29.0	2	1	0
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	28.0	null	274-UNIMOD:21,332-UNIMOD:21,333-UNIMOD:21	0.02	28.0	2	2	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	189-UNIMOD:21	0.09	28.0	7	5	4
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	163-UNIMOD:21,549-UNIMOD:35,66-UNIMOD:21	0.10	28.0	8	5	2
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,139-UNIMOD:4,39-UNIMOD:4,3-UNIMOD:21	0.35	28.0	6	5	4
PRT	sp|P31040|SDHA_HUMAN	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	626-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	171-UNIMOD:21,106-UNIMOD:21	0.07	28.0	6	5	4
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	163-UNIMOD:4	0.05	28.0	2	2	2
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	310-UNIMOD:21,308-UNIMOD:21	0.04	28.0	3	2	1
PRT	sp|P25787|PSA2_HUMAN	Proteasome subunit alpha type-2 OS=Homo sapiens OX=9606 GN=PSMA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	7-UNIMOD:21	0.06	28.0	2	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	199-UNIMOD:21,221-UNIMOD:21,203-UNIMOD:21,207-UNIMOD:21	0.11	28.0	6	5	4
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	360-UNIMOD:4,362-UNIMOD:21,366-UNIMOD:4,360-UNIMOD:385	0.09	28.0	6	3	2
PRT	sp|O00232|PSD12_HUMAN	26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	332-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	2-UNIMOD:1,16-UNIMOD:35,17-UNIMOD:4,199-UNIMOD:21	0.13	28.0	5	3	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	58-UNIMOD:21,93-UNIMOD:21,57-UNIMOD:21,92-UNIMOD:21	0.34	28.0	8	4	2
PRT	sp|Q8TEW0|PARD3_HUMAN	Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	835-UNIMOD:28,837-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	112-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null	627-UNIMOD:21	0.01	27.0	2	2	2
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	114-UNIMOD:21,111-UNIMOD:21	0.07	27.0	3	1	0
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	15-UNIMOD:21	0.10	27.0	3	1	0
PRT	sp|Q9H0H5|RGAP1_HUMAN	Rac GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RACGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	249-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P62807|H2B1C_HUMAN	Histone H2B type 1-C/E/F/G/I OS=Homo sapiens OX=9606 GN=H2BC4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	37-UNIMOD:21,33-UNIMOD:21	0.10	27.0	2	2	2
PRT	sp|Q8IVL1|NAV2_HUMAN	Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	1591-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9P260|RELCH_HUMAN	RAB11-binding protein RELCH OS=Homo sapiens OX=9606 GN=RELCH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	180-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O95155|UBE4B_HUMAN	Ubiquitin conjugation factor E4 B OS=Homo sapiens OX=9606 GN=UBE4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	105-UNIMOD:21,113-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q9BRT2|UQCC2_HUMAN	Ubiquinol-cytochrome-c reductase complex assembly factor 2 OS=Homo sapiens OX=9606 GN=UQCC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	79-UNIMOD:21	0.11	27.0	2	1	0
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	761-UNIMOD:21,456-UNIMOD:21,764-UNIMOD:21,759-UNIMOD:21,1089-UNIMOD:21	0.03	27.0	5	5	5
PRT	sp|Q92598|HS105_HUMAN	Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	63-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	533-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	145-UNIMOD:21,298-UNIMOD:21,136-UNIMOD:21	0.14	27.0	6	4	3
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	493-UNIMOD:21,432-UNIMOD:21	0.06	27.0	4	2	1
PRT	sp|Q13610|PWP1_HUMAN	Periodic tryptophan protein 1 homolog OS=Homo sapiens OX=9606 GN=PWP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	485-UNIMOD:21	0.02	26.0	4	1	0
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	332-UNIMOD:21,331-UNIMOD:21,333-UNIMOD:21,335-UNIMOD:21	0.10	26.0	4	3	2
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	45-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q9H0B6|KLC2_HUMAN	Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	608-UNIMOD:21,581-UNIMOD:21,582-UNIMOD:21,428-UNIMOD:21	0.06	26.0	4	3	2
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	2690-UNIMOD:21,2689-UNIMOD:35	0.01	26.0	2	1	0
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	339-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	182-UNIMOD:21	0.11	26.0	3	3	3
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	432-UNIMOD:21,429-UNIMOD:35	0.05	26.0	4	3	2
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	6	5	4
PRT	sp|O15068|MCF2L_HUMAN	Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	412-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	46-UNIMOD:21,64-UNIMOD:21,69-UNIMOD:4,44-UNIMOD:21	0.07	26.0	3	2	1
PRT	sp|P18615|NELFE_HUMAN	Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	131-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	68-UNIMOD:21,70-UNIMOD:4	0.09	26.0	2	2	2
PRT	sp|Q96PU5|NED4L_HUMAN	E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	449-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	202-UNIMOD:21,200-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	114-UNIMOD:21,123-UNIMOD:4,117-UNIMOD:21	0.03	26.0	4	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	27-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	58-UNIMOD:21,104-UNIMOD:21,305-UNIMOD:21	0.14	26.0	7	4	2
PRT	sp|Q9NP61|ARFG3_HUMAN	ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=ARFGAP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	367-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1132-UNIMOD:21,416-UNIMOD:21,779-UNIMOD:21	0.02	26.0	4	4	4
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	22-UNIMOD:21,23-UNIMOD:4,30-UNIMOD:35	0.18	26.0	5	2	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.09	26.0	2	2	2
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	451-UNIMOD:28,453-UNIMOD:21,1246-UNIMOD:21,799-UNIMOD:21	0.02	26.0	6	5	4
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	210-UNIMOD:21,19-UNIMOD:21	0.08	25.0	3	2	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	13-UNIMOD:21	0.06	25.0	4	2	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	223-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q14135|VGLL4_HUMAN	Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	59-UNIMOD:21,69-UNIMOD:4	0.08	25.0	1	1	1
PRT	sp|O95835|LATS1_HUMAN	Serine/threonine-protein kinase LATS1 OS=Homo sapiens OX=9606 GN=LATS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	464-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	726-UNIMOD:4,727-UNIMOD:21,721-UNIMOD:28	0.02	25.0	4	3	2
PRT	sp|Q13464|ROCK1_HUMAN	Rho-associated protein kinase 1 OS=Homo sapiens OX=9606 GN=ROCK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	479-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	193-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	5-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	95-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q96GS4|BORC6_HUMAN	BLOC-1-related complex subunit 6 OS=Homo sapiens OX=9606 GN=BORCS6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	196-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q9BY44|EIF2A_HUMAN	Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	524-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	467-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	43-UNIMOD:21,45-UNIMOD:21	0.18	25.0	4	3	2
PRT	sp|Q13439|GOGA4_HUMAN	Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	39-UNIMOD:21,40-UNIMOD:21,41-UNIMOD:21	0.01	25.0	2	2	2
PRT	sp|P09651|ROA1_HUMAN	Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	199-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	3	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q9ULJ3|ZBT21_HUMAN	Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	411-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O14497|ARI1A_HUMAN	AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1184-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	21-UNIMOD:21,20-UNIMOD:21,278-UNIMOD:21,281-UNIMOD:4,279-UNIMOD:21	0.11	25.0	4	4	4
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	474-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	2-UNIMOD:1	0.18	25.0	4	2	1
PRT	sp|Q13619|CUL4A_HUMAN	Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	2-UNIMOD:1,10-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	107-UNIMOD:28,111-UNIMOD:21,120-UNIMOD:4	0.03	25.0	4	1	0
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	563-UNIMOD:28,573-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P37837|TALDO_HUMAN	Transaldolase OS=Homo sapiens OX=9606 GN=TALDO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	13-UNIMOD:21,11-UNIMOD:35	0.04	24.0	5	2	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.14	24.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	758-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	null	293-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	591-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q96PE2|ARHGH_HUMAN	Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	420-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	652-UNIMOD:21	0.02	24.0	3	2	1
PRT	sp|Q12770|SCAP_HUMAN	Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens OX=9606 GN=SCAP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	822-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O15321|TM9S1_HUMAN	Transmembrane 9 superfamily member 1 OS=Homo sapiens OX=9606 GN=TM9SF1 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	76-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q6ZVX7|FBX50_HUMAN	F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	268-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	70-UNIMOD:21,447-UNIMOD:4,173-UNIMOD:21	0.16	24.0	6	6	6
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	70-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	249-UNIMOD:21,254-UNIMOD:21,255-UNIMOD:4,58-UNIMOD:21	0.15	24.0	6	3	1
PRT	sp|Q9GZY8-2|MFF_HUMAN	Isoform 2 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	146-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P16402|H13_HUMAN	Histone H1.3 OS=Homo sapiens OX=9606 GN=H1-3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	37-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q96T51|RUFY1_HUMAN	RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	74-UNIMOD:21,81-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|P49419|AL7A1_HUMAN	Alpha-aminoadipic semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH7A1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	84-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q14244|MAP7_HUMAN	Ensconsin OS=Homo sapiens OX=9606 GN=MAP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	200-UNIMOD:21,201-UNIMOD:21,231-UNIMOD:21,235-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	425-UNIMOD:21,424-UNIMOD:35,434-UNIMOD:35	0.03	24.0	3	1	0
PRT	sp|Q9H1B7|I2BPL_HUMAN	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	657-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q7Z2W4|ZCCHV_HUMAN	Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	387-UNIMOD:21,298-UNIMOD:21,403-UNIMOD:21	0.04	24.0	4	4	4
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	3	3	3
PRT	sp|Q86W92|LIPB1_HUMAN	Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	601-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	158-UNIMOD:21	0.05	24.0	3	2	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	75-UNIMOD:21,77-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	601-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q13017|RHG05_HUMAN	Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	1124-UNIMOD:21,1173-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	102-UNIMOD:21	0.26	24.0	2	2	2
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	80-UNIMOD:28,82-UNIMOD:21,78-UNIMOD:21,83-UNIMOD:21	0.07	24.0	7	2	1
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	93-UNIMOD:21,77-UNIMOD:21,107-UNIMOD:21	0.16	23.0	3	3	3
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	136-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	75-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|O95625|ZBT11_HUMAN	Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	511-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|P13473|LAMP2_HUMAN	Lysosome-associated membrane glycoprotein 2 OS=Homo sapiens OX=9606 GN=LAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	153-UNIMOD:4,155-UNIMOD:21,153-UNIMOD:385	0.02	23.0	2	1	0
PRT	sp|Q69YN4|VIR_HUMAN	Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1432-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	107-UNIMOD:21,290-UNIMOD:4	0.13	23.0	6	4	3
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	250-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O60749|SNX2_HUMAN	Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	117-UNIMOD:21,118-UNIMOD:35	0.02	23.0	2	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	322-UNIMOD:21	0.14	23.0	5	4	3
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9BYW2|SETD2_HUMAN	Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1068-UNIMOD:21	0.00	23.0	2	2	2
PRT	sp|P30044|PRDX5_HUMAN	Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	182-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q9BZ23|PANK2_HUMAN	Pantothenate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PANK2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	189-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	57-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	145-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	51-UNIMOD:21	0.18	23.0	5	5	5
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	138-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q6GTX8|LAIR1_HUMAN	Leukocyte-associated immunoglobulin-like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	90-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1317-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	43-UNIMOD:21,48-UNIMOD:4,52-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	417-UNIMOD:4,420-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	43-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	199-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	102-UNIMOD:21	0.14	23.0	1	1	1
PRT	sp|Q9NWV8|BABA1_HUMAN	BRISC and BRCA1-A complex member 1 OS=Homo sapiens OX=9606 GN=BABAM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	29-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	23.0	null	310-UNIMOD:21	0.01	23.0	2	2	2
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	495-UNIMOD:4,506-UNIMOD:4,507-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:21	0.14	23.0	2	2	2
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	299-UNIMOD:21,301-UNIMOD:21	0.05	23.0	8	1	0
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,2-UNIMOD:21	0.13	23.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	235-UNIMOD:21,236-UNIMOD:21,240-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	105-UNIMOD:4	0.10	22.0	3	3	3
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	316-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9BTK6|PAGR1_HUMAN	PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	245-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|Q8NEY8|PPHLN_HUMAN	Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	110-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	32-UNIMOD:21,135-UNIMOD:21	0.19	22.0	4	4	4
PRT	sp|Q5VV41|ARHGG_HUMAN	Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	107-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O43181|NDUS4_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	159-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P55036|PSMD4_HUMAN	26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	358-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	185-UNIMOD:21	0.14	22.0	2	2	2
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	401-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1799-UNIMOD:21,216-UNIMOD:21	0.01	22.0	2	2	2
PRT	sp|O75592|MYCB2_HUMAN	E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	3478-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	561-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1158-UNIMOD:21,1133-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|Q9H7D7|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	121-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q01813|PFKAP_HUMAN	ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	386-UNIMOD:21	0.02	22.0	3	2	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	22.0	2	2	2
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	722-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	20-UNIMOD:21,21-UNIMOD:35,18-UNIMOD:21	0.03	22.0	3	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	567-UNIMOD:4,22-UNIMOD:35,23-UNIMOD:21	0.03	22.0	3	2	1
PRT	sp|Q9H2G2|SLK_HUMAN	STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	341-UNIMOD:21,1188-UNIMOD:21	0.02	22.0	2	2	2
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1874-UNIMOD:21,1877-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	126-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	268-UNIMOD:35,269-UNIMOD:21,271-UNIMOD:21	0.04	22.0	3	2	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	126-UNIMOD:21,124-UNIMOD:21,125-UNIMOD:21,128-UNIMOD:21	0.03	22.0	20	1	0
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	199-UNIMOD:21,211-UNIMOD:4,200-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.20	22.0	1	1	1
PRT	sp|Q8N6T3|ARFG1_HUMAN	ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARFGAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	361-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	156-UNIMOD:21,154-UNIMOD:21,427-UNIMOD:21	0.06	22.0	4	4	4
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	50-UNIMOD:21,46-UNIMOD:21	0.04	22.0	2	1	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	42-UNIMOD:21,44-UNIMOD:4	0.06	22.0	2	1	0
PRT	sp|Q86UU0|BCL9L_HUMAN	B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	118-UNIMOD:21,262-UNIMOD:21	0.03	22.0	3	2	1
PRT	sp|Q8N350|CBARP_HUMAN	Voltage-dependent calcium channel beta subunit-associated regulatory protein OS=Homo sapiens OX=9606 GN=CBARP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	299-UNIMOD:21,344-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1	0.34	22.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	30-UNIMOD:21,58-UNIMOD:21,61-UNIMOD:4	0.26	21.0	3	3	3
PRT	sp|Q7Z460|CLAP1_HUMAN	CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	600-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P49959|MRE11_HUMAN	Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	618-UNIMOD:35,619-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P78345|RPP38_HUMAN	Ribonuclease P protein subunit p38 OS=Homo sapiens OX=9606 GN=RPP38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	253-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	287-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	161-UNIMOD:4,157-UNIMOD:21	0.21	21.0	5	4	3
PRT	sp|Q9Y2I7|FYV1_HUMAN	1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens OX=9606 GN=PIKFYVE PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	307-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|Q68CQ4|DIEXF_HUMAN	Digestive organ expansion factor homolog OS=Homo sapiens OX=9606 GN=DIEXF PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	10-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	300-UNIMOD:21,299-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	89-UNIMOD:21	0.14	21.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	875-UNIMOD:21,377-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	244-UNIMOD:21,249-UNIMOD:4,263-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	8-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	330-UNIMOD:35	0.03	21.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	412-UNIMOD:4,452-UNIMOD:21	0.07	21.0	5	4	3
PRT	sp|Q9NZN8|CNOT2_HUMAN	CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	157-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1760-UNIMOD:21,1387-UNIMOD:21,1389-UNIMOD:4	0.01	21.0	2	2	2
PRT	sp|Q05682-4|CALD1_HUMAN	Isoform 4 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	202-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	325-UNIMOD:21,328-UNIMOD:4,39-UNIMOD:21,47-UNIMOD:21	0.10	21.0	4	3	2
PRT	sp|Q9UN36|NDRG2_HUMAN	Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	332-UNIMOD:21	0.05	21.0	2	2	2
PRT	sp|P15923-2|TFE2_HUMAN	Isoform E47 of Transcription factor E2-alpha OS=Homo sapiens OX=9606 GN=TCF3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	528-UNIMOD:21,530-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	688-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q6GYQ0|RGPA1_HUMAN	Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	799-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q12931|TRAP1_HUMAN	Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	494-UNIMOD:21,501-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	65-UNIMOD:21,69-UNIMOD:4	0.15	21.0	1	1	1
PRT	sp|Q8N1F7|NUP93_HUMAN	Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	47-UNIMOD:21,49-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	467-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q69YQ0|CYTSA_HUMAN	Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	385-UNIMOD:21,395-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	718-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q63ZY3|KANK2_HUMAN	KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	540-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	226-UNIMOD:21,227-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	365-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	153-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	138-UNIMOD:35	0.09	21.0	2	1	0
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	569-UNIMOD:21,584-UNIMOD:4,572-UNIMOD:21,570-UNIMOD:21	0.03	21.0	3	3	3
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1456-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q14847|LASP1_HUMAN	LIM and SH3 domain protein 1 OS=Homo sapiens OX=9606 GN=LASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	139-UNIMOD:35,146-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.14	21.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	39-UNIMOD:21,63-UNIMOD:21	0.26	20.0	2	2	2
PRT	sp|Q9H4L7|SMRCD_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	173-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q4ADV7|RIC1_HUMAN	RAB6A-GEF complex partner protein 1 OS=Homo sapiens OX=9606 GN=RIC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1017-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	518-UNIMOD:4,520-UNIMOD:21,518-UNIMOD:385,519-UNIMOD:21	0.01	20.0	3	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	335-UNIMOD:4,2-UNIMOD:1,2-UNIMOD:21,9-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	488-UNIMOD:21,487-UNIMOD:35	0.01	20.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	490-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	197-UNIMOD:21,100-UNIMOD:21	0.10	20.0	3	3	3
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	298-UNIMOD:21	0.06	20.0	3	2	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	369-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	473-UNIMOD:21,2-UNIMOD:1,19-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|Q9H4A3|WNK1_HUMAN	Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	2245-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	633-UNIMOD:21	0.06	20.0	3	3	3
PRT	sp|Q9NSK0|KLC4_HUMAN	Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	611-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q14152|EIF3A_HUMAN	Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	584-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q13480-2|GAB1_HUMAN	Isoform 2 of GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	547-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	599-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q86TB9|PATL1_HUMAN	Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	179-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q99590|SCAFB_HUMAN	Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1153-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	115-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	485-UNIMOD:21	0.06	20.0	2	2	2
PRT	sp|Q8IX03|KIBRA_HUMAN	Protein KIBRA OS=Homo sapiens OX=9606 GN=WWC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	931-UNIMOD:21,940-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	1204-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q676U5|A16L1_HUMAN	Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	287-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	273-UNIMOD:21	0.04	20.0	2	2	2
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	99-UNIMOD:21,101-UNIMOD:4	0.07	20.0	2	2	2
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:28,81-UNIMOD:21	0.07	20.0	2	2	2
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	20.0	null	2-UNIMOD:1,2-UNIMOD:21,153-UNIMOD:21,174-UNIMOD:21,175-UNIMOD:21	0.10	20.0	4	3	2
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	305-UNIMOD:21,303-UNIMOD:35,345-UNIMOD:21	0.05	19.0	9	3	2
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	96-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q96B36|AKTS1_HUMAN	Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	246-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q9UHI6|DDX20_HUMAN	Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens OX=9606 GN=DDX20 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	500-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q96BH1|RNF25_HUMAN	E3 ubiquitin-protein ligase RNF25 OS=Homo sapiens OX=9606 GN=RNF25 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	450-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q08AD1|CAMP2_HUMAN	Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	464-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q5TAX3|TUT4_HUMAN	Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1384-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	368-UNIMOD:21,375-UNIMOD:4,384-UNIMOD:21	0.05	19.0	2	2	2
PRT	sp|O60271|JIP4_HUMAN	C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	595-UNIMOD:21	0.01	19.0	2	2	2
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	292-UNIMOD:21,294-UNIMOD:21,303-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q14678|KANK1_HUMAN	KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	325-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q8IWT6|LRC8A_HUMAN	Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens OX=9606 GN=LRRC8A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	217-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPTIN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	218-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q13480|GAB1_HUMAN	GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	387-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	136-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	454-UNIMOD:21,459-UNIMOD:35	0.02	19.0	2	1	0
PRT	sp|Q14573|ITPR3_HUMAN	Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2609-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P09661|RU2A_HUMAN	U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	180-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q69YH5|CDCA2_HUMAN	Cell division cycle-associated protein 2 OS=Homo sapiens OX=9606 GN=CDCA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	977-UNIMOD:21,979-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q96A26|F162A_HUMAN	Protein FAM162A OS=Homo sapiens OX=9606 GN=FAM162A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	131-UNIMOD:21	0.08	19.0	1	1	1
PRT	sp|Q8N4C8|MINK1_HUMAN	Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	699-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P45974|UBP5_HUMAN	Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	783-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9NQW6|ANLN_HUMAN	Anillin OS=Homo sapiens OX=9606 GN=ANLN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	132-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P16615|AT2A2_HUMAN	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	493-UNIMOD:21,498-UNIMOD:4,494-UNIMOD:35	0.01	19.0	2	1	0
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	260-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q14738|2A5D_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	573-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P30622|CLIP1_HUMAN	CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	193-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	19-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	319-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9H3Z4|DNJC5_HUMAN	DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	10-UNIMOD:21	0.09	19.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	426-UNIMOD:21,428-UNIMOD:21	0.03	19.0	2	2	2
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	107-UNIMOD:21	0.07	19.0	2	2	2
PRT	sp|Q9BZD3|GCOM2_HUMAN	Putative GRINL1B complex locus protein 2 OS=Homo sapiens OX=9606 GN=GCOM2 PE=5 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	179-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|O94763|RMP_HUMAN	Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	418-UNIMOD:21,420-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=HIST1H2BB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	37-UNIMOD:21,33-UNIMOD:21	0.10	19.0	3	2	1
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	52-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.25	18.0	5	5	5
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	904-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	467-UNIMOD:21,225-UNIMOD:4	0.04	18.0	3	2	1
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	80-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	12-UNIMOD:21	0.05	18.0	3	2	1
PRT	sp|Q16875|F263_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens OX=9606 GN=PFKFB3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	461-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q93100|KPBB_HUMAN	Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	27-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	179-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	76-UNIMOD:21,198-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|Q08378|GOGA3_HUMAN	Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	983-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q16695|H31T_HUMAN	Histone H3.1t OS=Homo sapiens OX=9606 GN=HIST3H3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	46-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q13459|MYO9B_HUMAN	Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1043-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	25-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	177-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2152-UNIMOD:21,2160-UNIMOD:4,2336-UNIMOD:21	0.01	18.0	4	2	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	207-UNIMOD:21,212-UNIMOD:4	0.00	18.0	2	1	0
PRT	sp|Q9H1A4|APC1_HUMAN	Anaphase-promoting complex subunit 1 OS=Homo sapiens OX=9606 GN=ANAPC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	343-UNIMOD:21	0.01	18.0	2	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	38-UNIMOD:21	0.09	18.0	2	1	0
PRT	sp|Q9BTE3|MCMBP_HUMAN	Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	602-UNIMOD:4,604-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	96-UNIMOD:21,88-UNIMOD:35,93-UNIMOD:21	0.10	18.0	2	1	0
PRT	sp|P28074|PSB5_HUMAN	Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q9H814|PHAX_HUMAN	Phosphorylated adapter RNA export protein OS=Homo sapiens OX=9606 GN=PHAX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	149-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P43121|MUC18_HUMAN	Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	100-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	408-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.19	18.0	1	1	1
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	473-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q8NHG8|ZNRF2_HUMAN	E3 ubiquitin-protein ligase ZNRF2 OS=Homo sapiens OX=9606 GN=ZNRF2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	21-UNIMOD:21	0.11	18.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q9NQG5|RPR1B_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q9H8S9|MOB1A_HUMAN	MOB kinase activator 1A OS=Homo sapiens OX=9606 GN=MOB1A PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:21,10-UNIMOD:21	0.05	18.0	3	2	1
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	115-UNIMOD:21,13-UNIMOD:4,15-UNIMOD:21,81-UNIMOD:21,89-UNIMOD:21	0.30	17.0	5	4	3
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1336-UNIMOD:21,434-UNIMOD:21	0.01	17.0	2	2	2
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=PSME3IP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	249-UNIMOD:21,247-UNIMOD:21	0.04	17.0	2	1	0
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	94-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q96DV4|RM38_HUMAN	39S ribosomal protein L38, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL38 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	129-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	97-UNIMOD:21,101-UNIMOD:4	0.02	17.0	2	1	0
PRT	sp|Q8TDM6|DLG5_HUMAN	Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	972-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1715-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	15-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|O15021|MAST4_HUMAN	Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=MAST4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1370-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|P60983|GMFB_HUMAN	Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	27-UNIMOD:21	0.08	17.0	1	1	1
PRT	sp|Q9NYU2|UGGG1_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1489-UNIMOD:21,1493-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	36-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	102-UNIMOD:21	0.22	17.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	234-UNIMOD:4	0.03	17.0	3	2	1
PRT	sp|O60825|F262_HUMAN	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	466-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	165-UNIMOD:21	0.06	17.0	1	1	1
PRT	sp|P25054|APC_HUMAN	Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	1387-UNIMOD:4,1389-UNIMOD:21,1861-UNIMOD:21,1387-UNIMOD:385,1388-UNIMOD:21,2724-UNIMOD:21	0.02	17.0	4	3	2
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	173-UNIMOD:4,182-UNIMOD:21,194-UNIMOD:4	0.10	17.0	1	1	1
PRT	sp|P08174|DAF_HUMAN	Complement decay-accelerating factor OS=Homo sapiens OX=9606 GN=CD55 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	98-UNIMOD:4,106-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null	96-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21	0.16	17.0	4	3	2
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	533-UNIMOD:21,535-UNIMOD:4,538-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	113-UNIMOD:21,366-UNIMOD:21,373-UNIMOD:4	0.04	17.0	2	2	2
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	147-UNIMOD:21	0.10	17.0	1	1	1
PRT	sp|Q9C0A0|CNTP4_HUMAN	Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	520-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	111-UNIMOD:21,121-UNIMOD:35	0.01	17.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	277-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	373-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	16.0	null	188-UNIMOD:4,190-UNIMOD:21,188-UNIMOD:385,229-UNIMOD:4,232-UNIMOD:21	0.07	16.0	3	2	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	21-UNIMOD:21,24-UNIMOD:21	0.05	16.0	2	1	0
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.16	16.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	409-UNIMOD:4,412-UNIMOD:4	0.04	16.0	2	2	2
PRT	sp|P38606|VATA_HUMAN	V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	384-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	249-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1098-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q7LBC6|KDM3B_HUMAN	Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	766-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase 1, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	702-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P25325-2|THTM_HUMAN	Isoform 2 of 3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	15-UNIMOD:21,27-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	257-UNIMOD:21,379-UNIMOD:21	0.03	16.0	2	2	2
PRT	sp|Q8WVC0|LEO1_HUMAN	RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	505-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P43897|EFTS_HUMAN	Elongation factor Ts, mitochondrial OS=Homo sapiens OX=9606 GN=TSFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	57-UNIMOD:21,64-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	174-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|P11532|DMD_HUMAN	Dystrophin OS=Homo sapiens OX=9606 GN=DMD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	3623-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	180-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	307-UNIMOD:21	0.05	16.0	2	2	2
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q5VZK9|CARL1_HUMAN	F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1146-UNIMOD:21,1324-UNIMOD:21	0.02	16.0	2	2	2
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1915-UNIMOD:21,731-UNIMOD:21	0.01	16.0	2	2	2
PRT	sp|Q86WB0|NIPA_HUMAN	Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	354-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P19484|TFEB_HUMAN	Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	469-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	104-UNIMOD:21	0.05	16.0	2	2	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	746-UNIMOD:21,56-UNIMOD:21	0.04	16.0	3	3	3
PRT	sp|P49790|NU153_HUMAN	Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	1461-UNIMOD:21,1460-UNIMOD:21	0.01	16.0	2	2	2
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	337-UNIMOD:4,51-UNIMOD:21	0.05	16.0	2	2	2
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	331-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	277-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	53-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	4384-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	725-UNIMOD:21,723-UNIMOD:35,726-UNIMOD:21	0.01	16.0	2	1	0
PRT	sp|Q96JP5|ZFP91_HUMAN	E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	83-UNIMOD:21,177-UNIMOD:21,182-UNIMOD:4,85-UNIMOD:21	0.05	16.0	4	2	1
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:21	0.16	16.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	16.0	null	172-UNIMOD:28,176-UNIMOD:21	0.03	16.0	2	2	2
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|Q6P1X5|TAF2_HUMAN	Transcription initiation factor TFIID subunit 2 OS=Homo sapiens OX=9606 GN=TAF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1196-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q96JN8|NEUL4_HUMAN	Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	53-UNIMOD:21,57-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|P62917|RL8_HUMAN	60S ribosomal protein L8 OS=Homo sapiens OX=9606 GN=RPL8 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	130-UNIMOD:21,14-UNIMOD:21	0.11	15.0	2	2	2
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	249-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9H6H4|REEP4_HUMAN	Receptor expression-enhancing protein 4 OS=Homo sapiens OX=9606 GN=REEP4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	152-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q9Y5U2|TSSC4_HUMAN	Protein TSSC4 OS=Homo sapiens OX=9606 GN=TSSC4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	86-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q9NRY5|F1142_HUMAN	Protein FAM114A2 OS=Homo sapiens OX=9606 GN=FAM114A2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	207-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q9P2B2|FPRP_HUMAN	Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	875-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	416-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q5VTB9|RN220_HUMAN	E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	368-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1134-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	161-UNIMOD:21	0.06	15.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	177-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	988-UNIMOD:4	0.03	15.0	3	3	3
PRT	sp|P17655|CAN2_HUMAN	Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	464-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	394-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|Q9UKV8|AGO2_HUMAN	Protein argonaute-2 OS=Homo sapiens OX=9606 GN=AGO2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	387-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9P0K1|ADA22_HUMAN	Disintegrin and metalloproteinase domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ADAM22 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	834-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	88-UNIMOD:21	0.10	15.0	2	2	2
PRT	sp|Q99501|GA2L1_HUMAN	GAS2-like protein 1 OS=Homo sapiens OX=9606 GN=GAS2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	438-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	169-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1277-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	174-UNIMOD:21,714-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|P68400|CSK21_HUMAN	Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	13-UNIMOD:21	0.04	15.0	2	2	2
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.21	15.0	2	2	2
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	546-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	15.0	1	1	1
PRT	sp|O00180|KCNK1_HUMAN	Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	329-UNIMOD:4	0.06	15.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	183-UNIMOD:21,182-UNIMOD:21	0.03	15.0	2	2	2
PRT	sp|P49841|GSK3B_HUMAN	Glycogen synthase kinase-3 beta OS=Homo sapiens OX=9606 GN=GSK3B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	9-UNIMOD:21,14-UNIMOD:4,26-UNIMOD:35	0.05	15.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.18	15.0	1	1	1
PRT	sp|P21912|SDHB_HUMAN	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	243-UNIMOD:385,243-UNIMOD:4,245-UNIMOD:21,249-UNIMOD:4	0.04	15.0	1	1	1
PRT	sp|Q9NRP4|SDHF3_HUMAN	Succinate dehydrogenase assembly factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=SDHAF3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	114-UNIMOD:28,116-UNIMOD:21	0.10	15.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	2-UNIMOD:1,4-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O94992|HEXI1_HUMAN	Protein HEXIM1 OS=Homo sapiens OX=9606 GN=HEXIM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	268-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q99584|S10AD_HUMAN	Protein S100-A13 OS=Homo sapiens OX=9606 GN=S100A13 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	null	26-UNIMOD:28,32-UNIMOD:21	0.15	15.0	1	1	1
PRT	sp|Q5SSJ5|HP1B3_HUMAN	Heterochromatin protein 1-binding protein 3 OS=Homo sapiens OX=9606 GN=HP1BP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	227-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	286-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|O14744|ANM5_HUMAN	Protein arginine N-methyltransferase 5 OS=Homo sapiens OX=9606 GN=PRMT5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	634-UNIMOD:21	0.01	14.0	2	1	0
PRT	sp|P79522|PRR3_HUMAN	Proline-rich protein 3 OS=Homo sapiens OX=9606 GN=PRR3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	135-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q6YHK3|CD109_HUMAN	CD109 antigen OS=Homo sapiens OX=9606 GN=CD109 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1015-UNIMOD:21	0.00	14.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	2	2	2
PRT	sp|O14776|TCRG1_HUMAN	Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	746-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	107-UNIMOD:21,116-UNIMOD:21	0.06	14.0	2	2	2
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.09	14.0	1	1	1
PRT	sp|Q8TEB1|DCA11_HUMAN	DDB1- and CUL4-associated factor 11 OS=Homo sapiens OX=9606 GN=DCAF11 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	147-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9NYF3|FA53C_HUMAN	Protein FAM53C OS=Homo sapiens OX=9606 GN=FAM53C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	120-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1937-UNIMOD:21	0.01	14.0	2	2	2
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q14C86|GAPD1_HUMAN	GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	903-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P52732|KIF11_HUMAN	Kinesin-like protein KIF11 OS=Homo sapiens OX=9606 GN=KIF11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	931-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.01	14.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	14.0	2	1	0
PRT	sp|Q9H3H1|MOD5_HUMAN	tRNA dimethylallyltransferase OS=Homo sapiens OX=9606 GN=TRIT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	431-UNIMOD:21	0.05	14.0	2	1	0
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.04	14.0	1	1	1
PRT	sp|Q9HCN8|SDF2L_HUMAN	Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens OX=9606 GN=SDF2L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	38-UNIMOD:4,40-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q9BXS6|NUSAP_HUMAN	Nucleolar and spindle-associated protein 1 OS=Homo sapiens OX=9606 GN=NUSAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	240-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	359-UNIMOD:21,362-UNIMOD:4,364-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1938-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.09	14.0	1	1	1
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	658-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P62072|TIM10_HUMAN	Mitochondrial import inner membrane translocase subunit Tim10 OS=Homo sapiens OX=9606 GN=TIMM10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	48-UNIMOD:21,50-UNIMOD:4	0.17	14.0	1	1	1
PRT	sp|Q9UKX7|NUP50_HUMAN	Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	270-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q8N490-2|PNKD_HUMAN	Isoform 2 of Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	128-UNIMOD:21,130-UNIMOD:21	0.14	14.0	2	2	2
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	68-UNIMOD:4,75-UNIMOD:4,608-UNIMOD:21	0.03	14.0	2	2	2
PRT	sp|Q13439-5|GOGA4_HUMAN	Isoform 5 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	39-UNIMOD:21,41-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P63098|CANB1_HUMAN	Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.06	14.0	1	1	1
PRT	sp|P20340|RAB6A_HUMAN	Ras-related protein Rab-6A OS=Homo sapiens OX=9606 GN=RAB6A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,2-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	14.0	1	1	1
PRT	sp|Q9BWT1|CDCA7_HUMAN	Cell division cycle-associated protein 7 OS=Homo sapiens OX=9606 GN=CDCA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	14.0	null	196-UNIMOD:35	0.05	14.0	2	1	0
PRT	sp|Q8NHM5|KDM2B_HUMAN	Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1142-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	123-UNIMOD:21,127-UNIMOD:35	0.06	14.0	1	1	1
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	523-UNIMOD:21,528-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.07	14.0	1	1	1
PRT	sp|P52888|THOP1_HUMAN	Thimet oligopeptidase OS=Homo sapiens OX=9606 GN=THOP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	529-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q12802|AKP13_HUMAN	A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1750-UNIMOD:21	0.00	13.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.07	13.0	1	1	1
PRT	sp|Q8WXE0|CSKI2_HUMAN	Caskin-2 OS=Homo sapiens OX=9606 GN=CASKIN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	858-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P27482|CALL3_HUMAN	Calmodulin-like protein 3 OS=Homo sapiens OX=9606 GN=CALML3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	1
PRT	sp|P26447|S10A4_HUMAN	Protein S100-A4 OS=Homo sapiens OX=9606 GN=S100A4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	44-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.01	13.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.02	13.0	1	1	1
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.02	13.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	1
PRT	sp|Q8N142|PURA1_HUMAN	Adenylosuccinate synthetase isozyme 1 OS=Homo sapiens OX=9606 GN=ADSS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	452-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	112-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.01	13.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	332-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	88-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	332-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	50-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|P21731|TA2R_HUMAN	Thromboxane A2 receptor OS=Homo sapiens OX=9606 GN=TBXA2R PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	331-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|O95831|AIFM1_HUMAN	Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	268-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P54578|UBP14_HUMAN	Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	432-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q5VT52|RPRD2_HUMAN	Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	358-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.03	13.0	1	1	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	31-UNIMOD:21	0.09	13.0	1	1	1
PRT	sp|Q9NVN8|GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	513-UNIMOD:21,518-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.10	13.0	1	1	1
PRT	sp|Q8NBJ7|SUMF2_HUMAN	Inactive C-alpha-formylglycine-generating enzyme 2 OS=Homo sapiens OX=9606 GN=SUMF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	256-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q9UBF8|PI4KB_HUMAN	Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	280-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	345-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.16	13.0	1	1	1
PRT	sp|Q32P51|RA1L2_HUMAN	Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens OX=9606 GN=HNRNPA1L2 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	286-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q71RC2|LARP4_HUMAN	La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	382-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q15056|IF4H_HUMAN	Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,12-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	663-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q86UW8|HPLN4_HUMAN	Hyaluronan and proteoglycan link protein 4 OS=Homo sapiens OX=9606 GN=HAPLN4 PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null		0.03	13.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	637-UNIMOD:21	0.00	13.0	1	1	1
PRT	sp|Q8NAF0|ZN579_HUMAN	Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	455-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	122-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9Y536|PAL4A_HUMAN	Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.05	12.0	1	1	1
PRT	sp|P53814|SMTN_HUMAN	Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	301-UNIMOD:21	0.01	12.0	2	1	0
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	89-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q58FF3|ENPLL_HUMAN	Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.03	12.0	1	1	1
PRT	sp|Q96DZ1|ERLEC_HUMAN	Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	210-UNIMOD:21,215-UNIMOD:4	0.03	12.0	1	1	1
PRT	sp|Q641Q2|WAC2A_HUMAN	WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	287-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	1131-UNIMOD:4	0.01	12.0	1	1	1
PRT	sp|P82979|SARNP_HUMAN	SAP domain-containing ribonucleoprotein OS=Homo sapiens OX=9606 GN=SARNP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	163-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	637-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P12956|XRCC6_HUMAN	X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	520-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	996-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|P49590|SYHM_HUMAN	Histidine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=HARS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	67-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.05	12.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.14	12.0	1	1	1
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	711-UNIMOD:21	0.01	12.0	1	1	1
PRT	sp|Q9UEU0|VTI1B_HUMAN	Vesicle transport through interaction with t-SNAREs homolog 1B OS=Homo sapiens OX=9606 GN=VTI1B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	179-UNIMOD:21	0.06	12.0	1	1	1
PRT	sp|Q9UBP6|TRMB_HUMAN	tRNA (guanine-N(7)-)-methyltransferase OS=Homo sapiens OX=9606 GN=METTL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	27-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	152-UNIMOD:21	0.07	12.0	1	1	1
PRT	sp|Q99543|DNJC2_HUMAN	DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	47-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	46-UNIMOD:21	0.14	12.0	1	1	1
PRT	sp|O60547|GMDS_HUMAN	GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	59-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	120-UNIMOD:21	0.05	12.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	236-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	94-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null		0.09	12.0	1	1	1
PRT	sp|P42331|RHG25_HUMAN	Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	637-UNIMOD:21,638-UNIMOD:35	0.01	12.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	198-UNIMOD:21,199-UNIMOD:4	0.06	12.0	1	1	1
PRT	sp|Q9H7X3|ZN696_HUMAN	Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	70-UNIMOD:21,74-UNIMOD:4	0.05	12.0	1	1	1
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	255-UNIMOD:21	0.02	12.0	1	1	1
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	null	443-UNIMOD:21	0.04	12.0	1	1	1
PRT	sp|P62195|PRS8_HUMAN	26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	120-UNIMOD:21	0.03	12.0	1	1	1
PRT	sp|O75494|SRS10_HUMAN	Serine/arginine-rich splicing factor 10 OS=Homo sapiens OX=9606 GN=SRSF10 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	null	133-UNIMOD:21	0.04	12.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.4354.2	46.11475	3	2408.004671	2407.988786	R	-	223	246
PSM	TMQGEGPQLLLSEAVSR	2	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4980.2	52.84945	3	1894.893371	1894.885979	K	A	1053	1070
PSM	DNLTLWTSDSAGEECDAAEGAEN	3	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4420.2	47.0792	3	2453.992271	2453.976507	R	-	223	246
PSM	DATNVGDEGGFAPNILENK	4	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.4197.2	42.83915	3	1959.926771	1959.917400	K	E	203	222
PSM	DATNVGDEGGFAPNILENK	5	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.4206.2	43.04002	3	1959.926771	1959.917400	K	E	203	222
PSM	ANSGGVDLDSSGEFASIEK	6	sp|Q92766|RREB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4145.2	41.75672	3	1961.833271	1961.825547	R	M	1165	1184
PSM	TPEELDDSDFETEDFDVR	7	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4469.2	47.57962	3	2237.864171	2237.852550	R	S	634	652
PSM	RFSFCCSPEPEAEAEAAAGPGPCER	8	sp|Q13501|SQSTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21,5-UNIMOD:4,6-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=1.1.4014.2	38.67883	4	2861.135294	2861.124466	R	L	22	47
PSM	GADFLVTEVENGGSLGSK	9	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4489.2	47.83908	3	1858.845371	1858.834990	K	K	189	207
PSM	TMQGEGPQLLLSEAVSR	10	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4730.2	50.50818	3	1910.887571	1910.880894	K	A	1053	1070
PSM	DNLTLWTSDMQGDGEEQNK	11	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.4249.3	43.8265	3	2179.943771	2179.932792	R	E	226	245
PSM	RASQGLLSSIENSESDSSEAK	12	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3963.3	37.44663	3	2274.009071	2274.001280	R	E	1540	1561
PSM	SDLSSSSGSLSLSHGSSSLEHR	13	sp|O15013|ARHGA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3608.5	28.5223	4	2296.004494	2295.996863	K	S	1279	1301
PSM	DSGRGDSVSDSGSDALRSGLTVPTSPK	14	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3831.2	34.21207	4	2727.246094	2727.234862	R	G	70	97
PSM	GPADSLSTAAGAAELSAEGAGK	15	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4110.4	40.90977	3	2009.898371	2009.894295	R	S	268	290
PSM	RNTTQNTGYSSGTQNANYPVR	16	sp|Q12965|MYO1E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3367.6	22.58843	3	2408.057471	2408.050630	R	A	933	954
PSM	AITGASLADIMAK	17	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4433.2	47.20032	2	1340.646647	1340.641104	R	R	81	94
PSM	GVSLTNHHFYDESK	18	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3577.2	27.73347	3	1712.725871	1712.719566	R	P	22	36
PSM	TMQGEGPQLLLSEAVSR	19	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21	ms_run[1]:scan=1.1.5008.2	53.0549	3	1894.893371	1894.885979	K	A	1053	1070
PSM	TMQGEGPQLLLSEAVSR	20	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4707.2	50.3043	3	1910.887571	1910.880894	K	A	1053	1070
PSM	QYTSPEEIDAQLQAEK	21	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4047.2	39.47857	3	1928.850071	1928.840469	R	Q	16	32
PSM	DNLTLWTSDMQGDGEEQNK	22	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4263.2	44.16195	3	2179.941371	2179.932792	R	E	226	245
PSM	DNLTLWTSENQGDEGDAGEGEN	23	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4275.5	44.45528	3	2349.956471	2349.946922	R	-	225	247
PSM	RNSEGSELSCTEGSLTSSLDSR	24	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3941.3	36.97387	3	2451.030071	2451.022092	R	R	1667	1689
PSM	TFCGTPEYLAPEVLEDNDYGR	25	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.5159.2	54.19743	3	2525.061671	2525.045787	K	A	308	329
PSM	TASGSSVTSLDGTR	26	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3443.2	24.43955	2	1417.611047	1417.608618	R	S	328	342
PSM	DNLTLWTSDQQDDDGGEGNN	27	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4285.2	44.66507	3	2192.881571	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	28	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4338.2	45.74543	3	2192.882471	2192.873028	R	-	228	248
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	29	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4176.5	42.41343	3	3014.204171	3014.188484	K	-	661	690
PSM	GADFLVTEVENGGSLGSK	30	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4475.2	47.63713	3	1858.845371	1858.834990	K	K	189	207
PSM	SNSSSEAVLGQEELSAQAK	31	sp|Q9BXF6|RFIP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3835.3	34.31532	3	2013.894971	2013.889210	R	V	393	412
PSM	KLSLGQYDNDAGGQLPFSK	32	sp|Q68CZ2|TENS3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4227.3	43.39987	3	2116.991171	2116.983051	R	C	774	793
PSM	AMTLSPQEEVAAGQMASSSR	33	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4063.2	39.87925	3	2129.919371	2129.912270	R	S	313	333
PSM	RGTGQSDDSDIWDDTALIK	34	sp|Q16637|SMN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4306.3	45.1268	3	2171.946971	2171.937223	R	A	23	42
PSM	DNLTLWTSDMQGDGEEQNK	35	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4238.2	43.60405	3	2179.943771	2179.932792	R	E	226	245
PSM	DSALQDTDDSDDDPVLIPGAR	36	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4328.2	45.64079	3	2293.970171	2293.958746	R	Y	648	669
PSM	RQAVTNPNNTFYATK	37	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3469.4	25.08277	3	1803.834971	1803.830513	K	R	107	122
PSM	TLSSSAQEDIIR	38	sp|Q9H788|SH24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3795.4	33.2841	2	1398.642447	1398.639190	R	W	313	325
PSM	RLQSIGTENTEENRR	39	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3284.3	20.68937	3	1881.875171	1881.869418	K	F	43	58
PSM	DNLTLWTSDQQDDDGGEGNN	40	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.4284.2	44.64105	3	2192.881571	2192.873028	R	-	228	248
PSM	RDSSESQLASTESDKPTTGR	41	sp|Q96B23|CR025_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3227.2	19.5495	4	2230.978094	2230.970314	R	V	64	84
PSM	RDSFDDRGPSLNPVLDYDHGSR	42	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3925.3	36.56548	4	2597.138094	2597.129609	R	S	186	208
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	43	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:21	ms_run[1]:scan=1.1.4168.2	42.21108	3	3014.204171	3014.188484	K	-	661	690
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	44	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	5-UNIMOD:35,7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.4691.2	50.0716	4	3144.325694	3144.309349	K	A	302	329
PSM	TMSEVGGSVEDLIAK	45	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.4205.2	43.01593	2	1631.707247	1630.716120	R	G	35	50
PSM	MASNIFGPTEEPQNIPK	46	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4290.2	44.79902	3	1951.883471	1951.875080	R	R	43	60
PSM	TLTIVDTGIGMTK	47	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4412.2	46.98348	2	1428.701047	1428.693534	R	A	28	41
PSM	VPSPLEGSEGDGDTD	48	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3726.3	31.52333	2	1553.582247	1553.577043	K	-	413	428
PSM	SLTNDWEDHLAVK	49	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4099.4	40.64168	2	1606.707047	1606.702853	K	H	315	328
PSM	RSTQGVTLTDLQEAEK	50	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3768.4	32.58812	3	1854.879671	1854.872438	R	T	694	710
PSM	SVSTPSEAGSQDSGDGAVGSR	51	sp|Q13409|DC1I2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3306.4	21.15845	3	2029.827971	2029.822587	K	T	92	113
PSM	DNLTLWTSDQQDDDGGEGNN	52	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4275.2	44.44528	3	2192.881571	2192.873028	R	-	228	248
PSM	TPEELDDSDFETEDFDVR	53	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4449.2	47.37691	3	2237.864171	2237.852550	R	S	634	652
PSM	DLGSTEDGDGTDDFLTDKEDEK	54	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3843.2	34.52218	3	2401.004171	2400.992869	K	A	180	202
PSM	DNLTLWTSDTQGDEAEAGEGGEN	55	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4364.3	46.3302	3	2408.004671	2407.988786	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	56	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3631.3	29.10395	3	2483.108471	2483.096577	K	L	45	68
PSM	ERIQQFDDGGSDEEDIWEEK	57	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4086.3	40.3561	3	2504.013071	2504.001674	K	H	607	627
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	58	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4067.2	39.97095	4	3001.327694	3001.312460	K	E	160	186
PSM	INSSGESGDESDEFLQSR	59	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3780.5	32.89637	3	2035.809071	2035.800789	R	K	180	198
PSM	QYTSPEEIDAQLQAEK	60	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.4629.2	49.09426	3	1911.8228	1911.8134	R	Q	16	32
PSM	RRNSCNVGGGGGGFK	61	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3074.2	17.38685	3	1601.689571	1601.688223	K	H	149	164
PSM	HQGVMVGMGQKDSYVGDEAQSK	62	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3549.4	27.04908	4	2430.040494	2430.034511	R	R	42	64
PSM	SQTTTERDSDTDVEEEELPVENR	63	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3694.2	30.7109	4	2758.158094	2758.145437	R	E	445	468
PSM	SLTNDWEDHLAVK	64	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4092.3	40.50938	3	1606.709171	1606.702853	K	H	315	328
PSM	TMSEVGGSVEDLIAK	65	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4785.2	51.12978	2	1614.730047	1614.721205	R	G	35	50
PSM	SSGSEGSSPNWLQALK	66	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4614.2	48.8477	3	1726.764071	1726.756345	K	L	1708	1724
PSM	DVAEAKPELSLLGDGDH	67	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4037.2	39.21777	3	1764.857171	1764.853008	R	-	232	249
PSM	AASPPASASDLIEQQQK	68	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3804.2	33.51607	3	1819.838771	1819.835324	R	R	333	350
PSM	DNLTLWTSDQQDDDGGEGNN	69	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4305.2	45.08858	3	2192.882471	2192.873028	R	-	228	248
PSM	NADMSEEMQQDSVECATQALEK	70	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4185.2	42.64018	3	2513.047271	2513.035619	K	Y	10	32
PSM	DNLTLWTADNAGEEGGEAPQEPQS	71	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4397.2	46.8192	3	2528.108171	2528.093920	R	-	225	249
PSM	RDSFDDRGPSLNPVLDYDHGSR	72	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3916.2	36.34998	4	2597.138094	2597.129609	R	S	186	208
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	73	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:21,5-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=1.1.4679.2	49.86363	4	3144.325694	3144.309349	K	A	302	329
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	74	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3672.3	30.16148	3	3722.213171	3722.195067	K	A	158	190
PSM	SQGMALSLGDK	75	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3778.2	32.8469	2	1185.513447	1185.510090	K	I	933	944
PSM	GILAADESTGSIAK	76	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3715.4	31.2559	2	1411.665447	1411.659591	K	R	29	43
PSM	TLTIVDTGIGMTK	77	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4490.2	47.86435	2	1428.701447	1428.693534	R	A	28	41
PSM	PCSEETPAISPSK	78	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3338.3	21.8969	2	1481.6151	1481.6104	M	R	2	15
PSM	SVSSPTSSNTPTPTK	79	sp|Q5M775|CYTSB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3222.2	19.4265	3	1569.696671	1569.692348	K	H	131	146
PSM	AASIFGGAKPVDTAAR	80	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3725.2	31.49495	3	1610.785871	1610.781772	R	E	357	373
PSM	LIAPVAEEEATVPNNK	81	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3753.2	32.22475	3	1693.892771	1693.888666	K	I	8	24
PSM	RGSLEMSSDGEPLSR	82	sp|Q6ZN18|AEBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3548.6	27.02995	3	1699.727471	1699.723665	R	M	204	219
PSM	NRPTSISWDGLDSGK	83	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3915.3	36.32908	3	1711.762871	1711.756680	K	L	48	63
PSM	SSGSEGSSPNWLQALK	84	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4594.2	48.64423	3	1726.764071	1726.756345	K	L	1708	1724
PSM	KDSLTQAQEQGNLLN	85	sp|Q5JTD0|TJAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3732.3	31.67347	3	1737.800171	1737.793459	R	-	543	558
PSM	TASFSESRADEVAPAK	86	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3435.3	24.2704	3	1744.768271	1744.766910	R	K	453	469
PSM	DASDDLDDLNFFNQK	87	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.5038.2	53.27763	3	1755.767771	1755.758774	K	K	65	80
PSM	RSSLSSHSHQSQIYR	88	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3118.3	17.98178	4	1851.842094	1851.837724	R	S	1367	1382
PSM	TMQGEGPQLLLSEAVSR	89	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4950.2	52.64587	3	1894.893371	1894.885979	K	A	1053	1070
PSM	TMQGEGPQLLLSEAVSR	90	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.4693.2	50.1027	3	1910.887571	1910.880894	K	A	1053	1070
PSM	SGSSQELDVKPSASPQER	91	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3388.2	23.10722	3	1980.885371	1980.878980	R	S	1539	1557
PSM	SPSKPLPEVTDEYKNDVK	92	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3679.6	30.33635	3	2125.006271	2124.998032	R	N	92	110
PSM	DNLTLWTSDMQGDGEEQNK	93	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4249.2	43.8165	4	2179.942494	2179.932792	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	94	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3974.2	37.72795	3	2195.937971	2195.927707	R	E	226	245
PSM	NTNDANSCQIIIPQNQVNR	95	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3699.4	30.84953	3	2198.058971	2198.049828	K	K	310	329
PSM	SRSGSSQELDVKPSASPQER	96	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3298.3	20.97738	4	2224.020894	2224.012119	R	S	1537	1557
PSM	RTSSTCSNESLSVGGTSVTPR	97	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3539.6	26.79742	3	2262.003371	2261.994755	K	R	748	769
PSM	SRINSSGESGDESDEFLQSR	98	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3644.5	29.44162	3	2278.942271	2278.933928	R	K	178	198
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	99	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3694.3	30.7209	3	2418.921971	2418.911873	R	R	42	68
PSM	RSSAIGIENIQEVQEK	100	sp|P47736|RPGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3796.3	33.29995	3	1879.908071	1879.904072	R	R	497	513
PSM	AFSDPFVEAEK	101	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4217.2	43.16555	2	1318.551447	1318.548250	R	S	74	85
PSM	STGSFVGELMYK	102	sp|Q9UJS0|CMC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4480.2	47.70643	2	1397.598647	1397.593820	R	N	361	373
PSM	TASQGPQTDSVIQNSENIK	103	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3716.5	31.27822	3	2095.954871	2095.942308	R	A	1286	1305
PSM	FASENDLPEWK	104	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4174.2	42.3627	2	1414.584847	1414.580613	R	E	58	69
PSM	FASENDLPEWK	105	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4162.2	42.15205	2	1414.584847	1414.580613	R	E	58	69
PSM	RNSLGGDVLFVGK	106	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3982.2	37.90512	3	1440.712571	1440.712630	R	H	676	689
PSM	TGSYGALAEITASK	107	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4107.3	40.83305	2	1447.668647	1447.659591	K	E	443	457
PSM	SSSSSSGGGLLPYPR	108	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3952.4	37.20162	2	1530.675447	1530.671553	R	R	40	55
PSM	DVTPPPETEVVLIK	109	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4346.2	45.93677	3	1615.817771	1615.811007	K	N	519	533
PSM	RGSDASDFDLLETQSACSDTSESSAAGGQGNSR	110	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=1.1.4013.2	38.65447	4	3442.396894	3442.385244	R	R	7328	7361
PSM	DRKESLDVYELDAK	111	sp|Q13510|ASAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3744.2	31.97898	3	1759.809671	1759.802961	R	Q	297	311
PSM	RFSEGVLQSPSQDQEK	112	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3617.5	28.75213	3	1913.855471	1913.852037	R	L	427	443
PSM	SESLDPDSSMDTTLILK	113	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4615.3	48.87267	3	1930.861271	1930.848256	R	D	879	896
PSM	AASAATAAPTATPAAQESGTIPK	114	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3609.5	28.54825	3	2162.031971	2162.025644	R	K	63	86
PSM	RTGSNISGASSDISLDEQYK	115	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3719.5	31.35538	3	2206.985471	2206.974337	K	H	376	396
PSM	KPTDGASSSNCVTDISHLVR	116	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3847.2	34.61572	4	2223.002094	2222.999112	R	K	698	718
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	117	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3933.3	36.7763	4	3724.493294	3724.469745	R	N	77	111
PSM	RQSVSPPYKEPSAYQSSTR	118	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3410.2	23.6643	4	2247.038894	2247.032126	R	S	272	291
PSM	VEIIANDQGNR	119	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3366.2	22.56305	2	1227.620847	1227.620764	R	I	50	61
PSM	DAGTIAGLNVLR	120	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4510.2	48.02991	2	1278.638447	1278.633317	K	I	160	172
PSM	EALQDVEDENQ	121	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3480.5	25.36212	2	1288.546647	1288.541905	K	-	245	256
PSM	DGEDQTQDTELVETRPAGDGTFQK	122	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3695.5	30.7466	4	2636.189694	2636.183798	R	W	244	268
PSM	YALYDATYETK	123	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3730.2	31.62315	2	1336.624447	1336.618698	R	E	82	93
PSM	SLDSDESEDEEDDYQQK	124	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3364.5	22.51277	3	2110.743971	2110.737580	K	R	57	74
PSM	KHTLSYVDVGTGK	125	sp|P31040|SDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3454.2	24.70513	3	1483.709771	1483.707210	R	V	624	637
PSM	GVVDSDDLPLNVSR	126	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3993.2	38.19618	2	1484.750047	1484.747087	K	E	435	449
PSM	NRVIGSGCNLDSAR	127	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3314.2	21.30877	3	1517.739971	1517.736873	K	F	156	170
PSM	PFSAPKPQTSPSPK	128	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3376.5	22.81673	3	1547.742071	1547.738510	K	R	299	313
PSM	NGRVEIIANDQGNR	129	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3322.3	21.51565	3	1554.789971	1554.786266	K	I	47	61
PSM	GYSFSLTTFSPSGK	130	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4762.2	50.80552	2	1557.682047	1557.675241	R	L	5	19
PSM	AASIFGGAKPVDTAAR	131	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3717.2	31.29392	3	1610.785871	1610.781772	R	E	357	373
PSM	AASIFGGAKPVDTAAR	132	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3722.2	31.42442	2	1610.786247	1610.781772	R	E	357	373
PSM	DSGRGDSVSDSGSDALR	133	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3259.2	20.13868	3	1759.707071	1759.701015	R	S	70	87
PSM	LGSLSARSDSEATISR	134	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3589.3	28.02683	3	1808.771471	1808.770689	R	S	1158	1174
PSM	HSGSDRSSFSHYSGLK	135	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3343.2	22.00468	3	1830.774071	1830.768641	R	H	196	212
PSM	DKGDEEEEGEEKLEEK	136	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3264.2	20.22622	4	1891.823694	1891.817077	K	Q	536	552
PSM	TSSTCSNESLSVGGTSVTPR	137	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3685.5	30.48932	3	2105.902271	2105.893644	R	R	749	769
PSM	KGSLESPATDVFGSTEEGEK	138	sp|O00232|PSD12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3886.6	35.58998	3	2146.939871	2146.930741	R	R	330	350
PSM	DNLTLWTSDTQGDEAEAGEGGEN	139	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4377.2	46.54223	3	2408.004671	2407.988786	R	-	223	246
PSM	TFCGTPEYLAPEVLEDNDYGR	140	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.4937.2	52.42228	3	2525.061371	2525.045787	K	A	308	329
PSM	TFCGTPEYLAPEVLEDNDYGR	141	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.5175.2	54.39848	3	2525.061671	2525.045787	K	A	308	329
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	142	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21,9-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.5220.2	54.72802	4	3208.304094	3208.280765	K	A	302	329
PSM	DDDIAALVVDNGSGMCK	143	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4689.2	50.02118	3	1836.7961	1836.7865	M	A	2	19
PSM	DRSSFYVNGLTLGGQK	144	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4222.2	43.27395	3	1821.838871	1820.845829	K	C	55	71
PSM	QFSDASQLDFVK	145	sp|Q8TEW0|PARD3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.5699.2	58.56852	2	1446.6192	1446.6062	K	T	835	847
PSM	RNSLTGEEGQLAR	146	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3416.4	23.8025	3	1509.699071	1509.693685	R	V	110	123
PSM	RPSESDKEDELDK	147	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3061.2	17.23645	3	1626.681971	1626.677426	R	V	625	638
PSM	GGPGSTLSFVGK	148	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3878.2	35.37632	2	1185.542647	1185.543105	K	R	107	119
PSM	SINQPVAFVR	149	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3936.2	36.83692	2	1209.595447	1209.590724	R	R	15	25
PSM	TGTLQPWNSDSTLNSR	150	sp|Q9H0H5|RGAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3968.3	37.56835	3	1855.813571	1855.810172	K	Q	249	265
PSM	AFSDPFVEAEK	151	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4226.2	43.37465	2	1318.551447	1318.548250	R	S	74	85
PSM	DNNQFASASLDR	152	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3551.5	27.104	2	1336.603447	1336.600757	K	T	154	166
PSM	KESYSVYVYK	153	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3618.4	28.7703	2	1344.603447	1344.600285	R	V	35	45
PSM	SRSHTSEGAHLDITPNSGAAGNSAGPK	154	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3374.3	22.76612	4	2698.218494	2698.209650	R	S	362	389
PSM	THSLSNADGQYDPYTDSR	155	sp|Q8IVL1|NAV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3545.5	26.9519	3	2105.839271	2105.832758	R	F	1589	1607
PSM	TPELNLDQFHDK	156	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3806.3	33.56122	3	1455.701171	1455.699408	K	T	171	183
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	157	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3793.3	33.22253	4	3044.164094	3044.151982	K	L	595	622
PSM	AGSISTLDSLDFAR	158	sp|Q9P260|RELCH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4627.2	49.044	2	1531.698047	1531.691954	R	Y	178	192
PSM	SQSMDIDGVSCEK	159	sp|O95155|UBE4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3579.3	27.79113	2	1534.571247	1534.568076	R	S	103	116
PSM	DTSFSGLSLEEYK	160	sp|Q9BRT2|UQCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4365.3	46.35528	2	1554.656847	1554.649086	R	L	77	90
PSM	GYSFSLTTFSPSGK	161	sp|P25787|PSA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4780.2	51.02738	2	1557.682047	1557.675241	R	L	5	19
PSM	HRVTMNEFEYLK	162	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3640.3	29.33235	3	1661.733671	1661.727294	K	L	143	155
PSM	ERSDSGGSSSEPFDR	163	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3270.3	20.35727	3	1691.646671	1691.642438	R	H	757	772
PSM	NQQITHANNTVSNFK	164	sp|Q92598|HS105_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3354.2	22.2614	3	1794.807671	1794.805027	K	R	54	69
PSM	DAGDKDKEQELSEEDK	165	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3087.2	17.53897	3	1834.816871	1834.806846	R	Q	35	51
PSM	QLLTLSSELSQARDENK	166	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4255.3	43.97798	3	2010.969371	2010.962315	R	R	530	547
PSM	DNLTLWTSDQQDDDGGEGNN	167	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4314.2	45.31253	3	2192.882471	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	168	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4346.3	45.94677	3	2192.882471	2192.873028	R	-	228	248
PSM	NGSLDSPGKQDTEEDEEEDEK	169	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3196.4	19.02633	3	2429.931971	2429.923149	K	D	134	155
PSM	DNLTLWTSDSAGEECDAAEGAEN	170	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4400.2	46.87214	3	2453.992271	2453.976507	R	-	223	246
PSM	ARSVDALDDLTPPSTAESGSR	171	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3897.5	35.87083	3	2224.010771	2224.000886	R	S	491	512
PSM	ARPATDSFDDYPPR	172	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3560.3	27.32917	3	1686.707771	1686.703916	R	R	201	215
PSM	GGPGSTLSFVGK	173	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3869.2	35.15582	2	1185.542647	1185.543105	K	R	107	119
PSM	NSSISGPFGSR	174	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3647.2	29.50863	2	1187.499447	1187.497217	R	S	483	494
PSM	THSTSSSLGSGESPFSR	175	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	27.70963	3	1802.751671	1802.747237	R	S	329	346
PSM	DSPSVWAAVPGK	176	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3896.3	35.8483	2	1212.617247	1212.613888	K	T	27	39
PSM	SFTLDDESLK	177	sp|Q86WR7|PRSR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3998.3	38.32463	2	1233.518047	1233.516615	R	Y	43	53
PSM	IVRGDQPAASGDSDDDEPPPLPR	178	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3633.4	29.15542	4	2483.107294	2483.096577	K	L	45	68
PSM	TLSSSSMDLSR	179	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3653.3	29.67308	2	1262.525447	1262.521383	R	R	606	617
PSM	EALQDVEDENQ	180	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3489.5	25.5709	2	1288.546647	1288.541905	K	-	245	256
PSM	AMSLVSSDSEGEQNELR	181	sp|Q14643|ITPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3876.2	35.32753	3	1930.808171	1930.797952	R	N	2688	2705
PSM	NGSLDSPGKQDTEEDEEEDEKDK	182	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3140.3	18.20422	4	2673.053294	2673.045055	K	G	134	157
PSM	RAESMLQQADK	183	sp|P13797|PLST_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3390.2	23.16785	2	1355.591447	1355.590466	K	L	336	347
PSM	GDRSEDFGVNEDLADSDAR	184	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3703.4	30.94573	3	2066.887271	2066.877720	K	A	186	205
PSM	DMRQTVAVGVIK	185	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3703.2	30.93907	3	1395.695171	1395.694537	R	A	428	440
PSM	EGLELPEDEEEK	186	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3699.3	30.84287	2	1415.633647	1415.630385	K	K	412	424
PSM	ALSLDGEQLIGNK	187	sp|O15068|MCF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4252.2	43.89208	2	1436.695847	1436.691226	R	H	410	423
PSM	SRSLSASPALGSTK	188	sp|O95544|NADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3375.3	22.78148	3	1440.699671	1440.697374	K	E	44	58
PSM	SLYESFVSSSDR	189	sp|P18615|NELFE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4059.3	39.77043	2	1455.597847	1455.591906	K	L	131	143
PSM	SRSFTLDDESLK	190	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3731.2	31.64475	3	1476.654671	1476.649755	R	Y	41	53
PSM	GVVDSEDLPLNISR	191	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4126.5	41.27218	2	1512.783447	1512.778387	R	E	387	401
PSM	RNQSFCPTVNLDK	192	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3648.2	29.53707	3	1657.734971	1657.728357	K	L	65	78
PSM	RGSLEMSSDGEPLSR	193	sp|Q6ZN18|AEBP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3556.5	27.23292	3	1699.727471	1699.723665	R	M	204	219
PSM	SLSSPTVTLSAPLEGAK	194	sp|Q96PU5|NED4L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4267.2	44.25288	3	1736.865071	1736.859748	R	D	446	463
PSM	RNSNSPPSPSSMNQR	195	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3205.2	19.11932	3	1737.729371	1737.725396	R	R	453	468
PSM	TLSNAEDYLDDEDSD	196	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4373.2	46.46192	2	1780.629447	1780.620031	R	-	200	215
PSM	SYELPDGQVITIGNER	197	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4310.2	45.22655	3	1789.891871	1789.884643	K	F	241	257
PSM	HVPDSGATATAYLCGVK	198	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3837.5	34.36386	3	1825.812371	1825.807001	K	G	110	127
PSM	GEAAAERPGEAAVASSPSK	199	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3189.2	18.87212	3	1863.845471	1863.836387	K	A	12	31
PSM	IRYESLTDPSKLDSGK	200	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3810.2	33.65768	4	1887.904894	1887.897924	K	E	54	70
PSM	SSSFSSWDDSSDSYWK	201	sp|Q9NP61|ARFG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4372.2	46.4368	3	1949.710571	1949.699284	R	K	365	381
PSM	VASETHSEGSEYEELPK	202	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3552.4	27.12615	3	1970.821871	1970.814648	R	R	1130	1147
PSM	RGQTCVVHYTGMLEDGK	203	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3738.4	31.83113	3	2029.882871	2029.875097	K	K	19	36
PSM	DNLTLWTSDQQDDDGGEGNN	204	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4295.2	44.8724	3	2192.881571	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	205	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3983.2	37.9307	3	2195.937971	2195.927707	R	E	226	245
PSM	DNLTLWTSDTQGDEAEAGEGGEN	206	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4345.2	45.92163	3	2408.004671	2407.988786	R	-	223	246
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	207	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.4933.2	52.36127	3	3128.336171	3128.314434	K	A	302	329
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	208	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4482.3	47.75692	4	3756.465694	3756.438824	K	A	469	503
PSM	DDDIAALVVDNGSGMCK	209	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.5146.2	54.0498	2	1820.8042	1820.7912	M	A	2	19
PSM	QQSEISAAVER	210	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4023.2	38.89105	2	1279.5475	1279.5440	R	A	451	462
PSM	ARSVDALDDLTPPSTAESGSR	211	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3894.2	35.7835	4	2224.009294	2224.000886	R	S	491	512
PSM	VRRPSESDKEDELDK	212	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3103.2	17.72712	4	1881.85329419132	1881.8469506418103	R	V	623	638
PSM	GALQNIIPASTGAAK	213	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3999.2	38.34037	3	1490.752871	1490.749409	R	A	201	216
PSM	HGSLGFLPR	214	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3827.2	34.09862	2	1062.502047	1062.501180	R	K	11	20
PSM	RGQTCVVHYTGMLEDGKK	215	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3625.2	28.94317	4	2157.973694	2157.970060	K	F	19	37
PSM	SASWGSADQLK	216	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3665.2	29.97212	2	1228.516647	1228.512533	R	E	221	232
PSM	VIGSGCNLDSAR	217	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3355.4	22.2865	2	1247.595847	1247.592835	R	F	158	170
PSM	SGSYSYLEER	218	sp|O14974|MYPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3660.2	29.84325	2	1269.495447	1269.491463	R	K	908	918
PSM	RKFSMEPGDEDLDCDNDHVSK	219	sp|Q14135|VGLL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3532.2	26.61068	4	2573.028094	2573.019983	K	M	56	77
PSM	SNSFNNPLGNR	220	sp|O95835|LATS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3707.4	31.04698	2	1298.543447	1298.540479	R	A	462	473
PSM	CSVSLSNVEAR	221	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3667.3	30.02693	2	1300.553647	1300.548267	R	R	726	737
PSM	NLESTVSQIEK	222	sp|Q13464|ROCK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4082.2	40.244	2	1326.612447	1326.606827	R	E	476	487
PSM	TAFQEALDAAGDK	223	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3895.4	35.81607	2	1335.632447	1335.630660	K	L	9	22
PSM	SVSLTGAPESVQK	224	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3589.5	28.0335	2	1381.650447	1381.649027	R	A	191	204
PSM	SSSFSSWDDSSDSYWKK	225	sp|Q9NP61|ARFG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4040.3	39.29856	3	2077.803371	2077.794247	R	E	365	382
PSM	PCSEETPAISPSK	226	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3329.2	21.69845	2	1481.6151	1481.6104	M	R	2	15
PSM	VRYSLDPENPTK	227	sp|P18621|RL17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3600.2	28.30398	3	1497.6901	1497.6859	M	S	2	14
PSM	VPSPLEGSEGDGDTD	228	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3734.6	31.73485	2	1553.582247	1553.577043	K	-	413	428
PSM	SLTNDWEDHLAVK	229	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4103.3	40.72045	3	1606.709171	1606.702853	K	H	315	328
PSM	HRVTMNEFEYLK	230	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3832.2	34.22455	3	1645.736471	1645.732379	K	L	143	155
PSM	RDSFDNCSLGESSK	231	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3381.3	22.93483	3	1680.645671	1680.645080	K	I	1686	1700
PSM	TKSTGGAPTFNVTVTK	232	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3653.2	29.66308	3	1687.824371	1687.818217	R	T	90	106
PSM	MSPNETLFLESTNK	233	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4129.2	41.35047	3	1689.735671	1689.732104	K	I	85	99
PSM	RNSNSPPSPSSMNQR	234	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.2866.2	15.87597	3	1753.719371	1753.720311	R	R	453	468
PSM	RATISSPLELEGTVSR	235	sp|Q96GS4|BORC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4000.3	38.36632	3	1794.891371	1794.887694	R	H	194	210
PSM	NTVSQSISGDPEIDKK	236	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3394.3	23.26257	3	1796.819471	1796.819339	R	I	521	537
PSM	KIERLDTDDLDEIEK	237	sp|Q9NUU7|DD19A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	33.38723	3	1910.893571	1910.887419	K	I	461	476
PSM	NGRKTLTTVQGIADDYDK	238	sp|O60739|EIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3734.5	31.73152	3	2073.984971	2073.973214	R	K	39	57
PSM	SRTSSFTEQLDEGTPNR	239	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3751.2	32.16335	3	2083.836971	2083.824910	R	E	37	54
PSM	SGSGNFGGGRGGGFGGNDNFGR	240	sp|P09651|ROA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3666.3	30.00123	3	2109.848771	2109.840243	R	G	197	219
PSM	DNLTLWTSDQQDEEAGEGN	241	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4307.3	45.14508	3	2120.889071	2120.877051	R	-	228	247
PSM	HTGCCGDNDPIDVCEIGSK	242	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3645.4	29.46403	3	2132.865071	2132.856139	K	V	110	129
PSM	SFSASQSTDREGASPVTEVR	243	sp|Q9ULJ3|ZBT21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3573.4	27.64598	3	2189.965271	2189.959021	R	I	409	429
PSM	SNSVGIQDAFNDGSDSTFQK	244	sp|O14497|ARI1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4150.3	41.87755	3	2195.906471	2195.900837	R	R	1182	1202
PSM	SRINSSGESGDESDEFLQSR	245	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3645.2	29.45737	4	2278.946094	2278.933928	R	K	178	198
PSM	DNLTLWTSENQGDEGDAGEGEN	246	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4285.3	44.67173	3	2349.956471	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	247	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4391.2	46.75022	3	2408.004671	2407.988786	R	-	223	246
PSM	TSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	248	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3405.2	23.54825	3	2512.033271	2512.025203	R	A	19	51
PSM	NQIHVKSPPREGSQGELTPANSQSR	249	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3353.3	22.23635	4	2796.335694	2796.330434	R	M	462	487
PSM	ADQLTEEQIAEFK	250	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4378.4	46.56683	2	1562.7551	1562.7459	M	E	2	15
PSM	ADEAPRKGSFSALVGR	251	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=1.1.3817.5	33.84753	3	1781.8489	1781.8456	M	T	2	18
PSM	QVPDSAATATAYLCGVK	252	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4861.2	51.7821	3	1813.8052	1813.7952	R	A	107	124
PSM	QLDETNALLRTESDTAAR	253	sp|O75116|ROCK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=1.1.4248.2	43.79162	3	2065.9375	2065.9312	R	L	563	581
PSM	MESALDQLK	254	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3824.3	34.02095	2	1113.478447	1113.477727	R	Q	11	20
PSM	HGGPKDEERHVGDLGNVTADK	255	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3371.2	22.6898	4	2230.077294	2230.072672	K	D	72	93
PSM	NQLTSNPENTVFDAK	256	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3760.2	32.39533	3	1676.806271	1676.800579	K	R	82	97
PSM	RLSSASTGKPPLSVEDDFEK	257	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3793.2	33.2192	4	2242.052094	2242.051859	R	L	756	776
PSM	RLQSIGTENTEENR	258	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3359.3	22.3772	3	1725.768671	1725.768307	K	R	43	57
PSM	YRSRGPPRPRPAPAVGEAEDK	259	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3237.2	19.70333	4	2385.1768941913206	2385.1702908811994	R	E	291	312
PSM	VLTIDPTEFK	260	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4461.2	47.47307	2	1241.598647	1241.594472	R	F	589	599
PSM	SADTLWDIQK	261	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4088.3	40.40048	2	1255.551047	1255.548584	K	D	320	330
PSM	SPSFGAGEGLLR	262	sp|Q96PE2|ARHGH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4128.3	41.3186	2	1269.577047	1269.575468	R	S	418	430
PSM	NDSWGSFDLR	263	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4327.4	45.60888	2	1275.496047	1275.492132	R	A	650	660
PSM	RDSGVGSGLEAQESWER	264	sp|Q12770|SCAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3743.5	31.96327	3	1941.829571	1941.821799	R	L	820	837
PSM	SLSLGEVLDGDR	265	sp|O15321|TM9S1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4737.2	50.57217	2	1339.606247	1339.602076	K	M	76	88
PSM	AITGASLADIMAK	266	sp|P83731|RL24_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.3935.4	36.81917	2	1356.639647	1356.636019	R	R	81	94
PSM	VTDSSVSVQLRE	267	sp|Q6ZVX7|FBX50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3629.3	29.04917	2	1398.644447	1398.639190	R	-	264	276
PSM	TVIIEQSWGSPK	268	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3977.3	37.78658	2	1423.679047	1423.674847	R	V	61	73
PSM	SISQSSTDSYSSAASYTDSSDDEVSPR	269	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3811.4	33.69638	4	2908.149294	2908.140746	R	E	66	93
PSM	IIYGGSVTGATCK	270	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:21,11-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3665.3	29.98212	2	1485.601247	1485.597599	R	E	244	257
PSM	NDSLVTPSPQQAR	271	sp|Q9GZY8-2|MFF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3477.2	25.28688	2	1491.676247	1491.671887	R	V	144	157
PSM	KQSSSEISLAVER	272	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3595.2	28.17633	3	1512.718871	1512.718503	R	A	454	467
PSM	RKASGPPVSELITK	273	sp|P16402|H13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3569.3	27.53845	3	1561.827071	1561.822909	K	A	34	48
PSM	RATGNLSASCGSALR	274	sp|Q96T51|RUFY1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3346.3	22.07165	3	1599.727571	1599.718854	R	A	72	87
PSM	YYTSASGDEMVSLK	275	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3923.3	36.51432	3	1629.666371	1629.663356	R	D	465	479
PSM	VRQASVADYEETVK	276	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3524.4	26.43065	3	1673.772071	1673.766182	R	K	80	94
PSM	RLSSSSATLLNSPDR	277	sp|Q14244|MAP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3638.4	29.28422	3	1682.805071	1682.798879	K	A	198	213
PSM	ARPATDSFDDYPPR	278	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3552.3	27.12282	3	1686.707771	1686.703916	R	R	201	215
PSM	RMTGSEFDFEEMK	279	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4020.2	38.81782	2	1685.652647	1685.646660	K	R	423	436
PSM	RNSSSPVSPASVPGQR	280	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3370.3	22.65793	3	1704.795071	1704.794462	R	R	655	671
PSM	SSLGSLQTPEAVTTRK	281	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3681.2	30.3871	3	1753.868471	1753.861145	R	G	386	402
PSM	VRQASVADYEETVKK	282	sp|P49419|AL7A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3422.3	23.93333	4	1801.868094	1801.861145	R	A	80	95
PSM	QVPDSAATATAYLCGVK	283	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4143.2	41.6924	3	1830.828671	1830.822317	R	A	107	124
PSM	DWILPSDYDHAEAEAR	284	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4121.2	41.1506	3	1886.847971	1886.843506	K	H	256	272
PSM	RGQTCVVHYTGMLEDGK	285	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3712.4	31.17935	3	2029.881371	2029.875097	K	K	19	36
PSM	SQSTTFNPDDMSEPEFK	286	sp|Q86W92|LIPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4137.3	41.54675	3	2038.795271	2038.786719	R	R	599	616
PSM	SDSSSKKDVIELTDDSFDK	287	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3891.3	35.70932	4	2194.961694	2194.951870	R	N	154	173
PSM	ALRTDYNASVSVPDSSGPER	288	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3663.6	29.93048	3	2199.987971	2199.979756	K	I	67	87
PSM	TDGSISGDRQPVTVADYISR	289	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4002.3	38.42153	3	2216.021171	2216.011056	R	A	598	618
PSM	ARSVDALDDLTPPSTAESGSR	290	sp|Q86X29|LSR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3889.4	35.66096	3	2224.010771	2224.000886	R	S	491	512
PSM	DNLTLWTSENQGDEGDAGEGEN	291	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4266.4	44.23755	3	2349.956471	2349.946922	R	-	225	247
PSM	IRNSFVNNTQGDEENGFSDR	292	sp|Q13017|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3664.5	29.95295	3	2377.998671	2377.992446	K	T	1121	1141
PSM	RDSFDDRGPSLNPVLDYDHGSR	293	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3908.2	36.1448	4	2597.138094	2597.129609	R	S	186	208
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	294	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4343.2	45.87135	4	3456.466894	3456.442334	R	-	207	238
PSM	QYTSPEEIDAQLQAEK	295	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=1.1.4615.2	48.86267	3	1911.8228	1911.8134	R	Q	16	32
PSM	QLSSGVSEIR	296	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4065.2	39.91678	2	1137.5095	1137.5062	R	H	80	90
PSM	SCINLPTVLPGSPSK	297	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.5218.2	54.6971	3	1690.8073	1690.7996	M	T	2	17
PSM	TIGISVDPR	298	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3789.2	33.12888	2	1036.498047	1036.495426	R	R	93	102
PSM	DKSPVREPIDNLTPEER	299	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3656.3	29.74047	4	2073.982894	2073.973214	K	D	134	151
PSM	SGTSEFLNK	300	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3479.2	25.32345	2	1061.446047	1061.443056	K	M	169	178
PSM	HGSLGFLPR	301	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3835.2	34.30532	2	1062.502047	1062.501180	R	K	11	20
PSM	RLSESSALK	302	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3267.2	20.30098	2	1069.517247	1069.516890	R	Q	73	82
PSM	SVNEGAYIR	303	sp|O95625|ZBT11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3502.3	25.90253	2	1087.471647	1087.469940	R	L	511	520
PSM	ALLLLCGEDD	304	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4585.2	48.56773	2	1117.537047	1117.532526	K	-	311	321
PSM	CNSLSTLEK	305	sp|P13473|LAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3462.2	24.90518	2	1130.471247	1130.467891	R	N	153	162
PSM	QLSSGVSEIR	306	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3573.2	27.63265	2	1154.536447	1154.533268	R	H	80	90
PSM	TMSINAAELK	307	sp|Q69YN4|VIR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3842.3	34.48647	2	1156.521047	1156.519927	R	Q	1430	1440
PSM	RGGSGSHNWGTVKDELTESPK	308	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3630.5	29.08143	4	2321.048894	2321.043754	K	Y	216	237
PSM	GITINAAHVEYSTAAR	309	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	34.14703	3	1752.824471	1752.819614	R	H	105	121
PSM	TFSWASVTSK	310	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4178.3	42.46427	2	1192.517447	1192.516556	R	N	248	258
PSM	SMSAPVIFDR	311	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4171.3	42.2868	2	1201.523247	1201.520261	K	S	117	127
PSM	NAGVEGSLIVEK	312	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3624.4	28.92368	2	1214.651247	1214.650667	K	I	482	494
PSM	QVVESAYEVIK	313	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3763.3	32.47308	2	1263.673047	1263.671068	K	L	233	244
PSM	NDSWGSFDLR	314	sp|Q7Z417|NUFP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4319.2	45.4029	2	1275.496047	1275.492132	R	A	650	660
PSM	LDIDSPPITAR	315	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3963.2	37.43663	2	1276.608847	1276.606433	R	N	33	44
PSM	ISVYYNEATGGK	316	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3554.4	27.1782	2	1300.633047	1300.629932	R	Y	47	59
PSM	NRLQSVVVVPK	317	sp|Q9BYW2|SETD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3768.3	32.58478	3	1317.719471	1317.716987	R	N	1064	1075
PSM	NNASTDYDLSDK	318	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3326.4	21.62315	2	1341.569647	1341.568454	K	S	301	313
PSM	IIYGGSVTGATCK	319	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3597.5	28.23755	2	1405.635047	1405.631268	R	E	244	257
PSM	RFSMVVQDGIVK	320	sp|P30044|PRDX5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3982.3	37.91512	3	1457.710271	1457.710187	K	A	180	192
PSM	DRLGSYSGPTSVSR	321	sp|Q9BZ23|PANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3507.3	26.02918	3	1560.695471	1560.693351	R	Q	185	199
PSM	SLHGPCPVTTFGPK	322	sp|O95544|NADK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3784.3	32.99265	3	1576.714271	1576.710916	R	A	64	78
PSM	SATKVTADVINAAEK	323	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3846.2	34.58647	3	1596.775271	1596.776018	R	L	55	70
PSM	SGRSLGTADVHFER	324	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3526.3	26.4826	3	1610.724971	1610.720234	R	K	142	156
PSM	HRVTMNEFEYLK	325	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3824.2	34.01762	3	1645.736471	1645.732379	K	L	143	155
PSM	RMTGSEFDFEEMK	326	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3894.3	35.78683	3	1701.643271	1701.641575	K	R	423	436
PSM	NLDIERPTYTNLNR	327	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3731.3	31.64808	3	1717.879271	1717.874747	R	L	216	230
PSM	LYGPSSVSFADDFVR	328	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4921.2	52.21187	3	1738.770071	1738.760368	R	S	134	149
PSM	FRIDSVSEGNAGPYR	329	sp|Q6GTX8|LAIR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3798.2	33.34813	3	1746.774371	1746.772664	R	C	86	101
PSM	TLTTVQGIADDYDKK	330	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3905.3	36.07043	3	1746.812471	1746.807712	K	K	43	58
PSM	TSSGTSLSAMHSSGSSGK	331	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3223.3	19.45148	3	1747.712771	1747.708409	R	G	1315	1333
PSM	RLSSSSATLLNSPDR	332	sp|Q14244|MAP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3823.4	34.00518	3	1762.770371	1762.765210	K	A	198	213
PSM	GGSVLVTCSTSCDQPK	333	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,8-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3513.4	26.18768	3	1774.732271	1774.726702	R	L	41	57
PSM	TLSNAEDYLDDEDSD	334	sp|Q92882|OSTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4360.2	46.25083	2	1780.629447	1780.620031	R	-	200	215
PSM	DCEECIQLEPTFIK	335	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.4326.2	45.5902	3	1780.811471	1780.801173	K	G	416	430
PSM	RLQSIGTENTEENRR	336	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3173.2	18.66258	4	1801.909294	1801.903087	K	F	43	58
PSM	HVPDSGATATAYLCGVK	337	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3845.3	34.56715	3	1825.812371	1825.807001	K	G	110	127
PSM	QYTSPEEIDAQLQAEK	338	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4038.2	39.24563	3	1928.850071	1928.840469	R	Q	16	32
PSM	SESLDPDSSMDTTLILK	339	sp|Q5SW79|CE170_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=1.1.4180.4	42.50865	3	1946.848571	1946.843171	R	D	879	896
PSM	DSSTSPGDYVLSVSENSR	340	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4237.2	43.57888	3	1978.819571	1978.815711	R	V	39	57
PSM	SGSTSSLSYSTWTSSHSDK	341	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3725.3	31.50162	3	2083.848671	2083.837174	R	T	197	216
PSM	DNLTLWTSDQQDEEAGEGN	342	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4299.3	44.9499	3	2120.889071	2120.877051	R	-	228	247
PSM	SPSKPLPEVTDEYKNDVK	343	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3671.2	30.1262	3	2125.006271	2124.998032	R	N	92	110
PSM	FDSNNVVLIEDNGNPVGTR	344	sp|Q6P1L8|RM14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4233.2	43.49633	3	2138.971571	2138.963378	R	I	100	119
PSM	TRSNPEGAEDRAVGAQASVGSR	345	sp|Q9NWV8|BABA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3294.3	20.87787	3	2294.044271	2294.040065	R	S	27	49
PSM	KQTIDNSQGAYQEAFDISKK	346	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3769.4	32.61422	4	2350.088894	2350.084221	R	E	139	159
PSM	LRKGSDALRPPVPQGEDEVPK	347	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3585.2	27.92388	4	2367.2040941913206	2367.1947742935395	R	A	306	327
PSM	IVRGDQPAASGDSDDDEPPPLPR	348	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3639.4	29.31662	3	2483.108471	2483.096577	K	L	45	68
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	349	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	18.7985	4	3178.172094	3178.161241	R	K	494	522
PSM	QLSSGVSEIR	350	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4057.2	39.7159	2	1137.5095	1137.5062	R	H	80	90
PSM	SSIGTGYDLSASTFSPDGR	351	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4939.2	52.47123	3	2038.8614	2038.8516	M	V	2	21
PSM	SQSRSNSPLPVPPSK	352	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3511.3	26.14205	3	1661.801771	1659.798150	R	A	297	312
PSM	SVAGGEIRGDTGGEDTAAPGR	353	sp|Q9H773|DCTP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3595.5	28.18633	3	2093.9122	2093.9012	M	F	2	23
PSM	RLSSLRASTSK	354	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3335.2	21.81735	3	1364.624471	1364.621446	R	S	233	244
PSM	IKDPDASKPEDWDER	355	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3403.2	23.48783	4	1799.832094	1799.832607	K	A	208	223
PSM	AGFAGDDAPR	356	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3273.2	20.41345	2	975.442847	975.441009	K	A	21	31
PSM	SRSLVDYENANK	357	sp|Q9UNH7|SNX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3384.2	23.01653	3	1474.651571	1474.645338	R	A	314	326
PSM	SSGSSLFPR	358	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3754.3	32.24078	2	1016.435247	1016.432826	R	Q	242	251
PSM	LQSVVVVPK	359	sp|Q9BYW2|SETD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3771.3	32.66255	2	1047.574047	1047.572948	R	N	1066	1075
PSM	KGSFSALVGR	360	sp|Q13619|CUL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3652.3	29.6377	2	1100.542447	1100.537960	R	T	8	18
PSM	SLSYSPVER	361	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3579.2	27.78113	2	1116.488247	1116.485256	R	R	2690	2699
PSM	MESALDQLK	362	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3608.4	28.51563	2	1129.476247	1129.472642	R	Q	11	20
PSM	SFYSSHYAR	363	sp|Q8NEY8|PPHLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3396.3	23.31983	2	1196.468247	1196.465189	K	E	110	119
PSM	RHLTGEFEK	364	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3224.2	19.46297	3	1195.540871	1195.538688	K	K	29	38
PSM	SQGMALSLGDK	365	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3499.5	25.8282	2	1201.508447	1201.505005	K	I	933	944
PSM	HQSFGAAVLSR	366	sp|Q5VV41|ARHGG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3645.3	29.4607	2	1251.578647	1251.576136	R	E	105	116
PSM	SYGANFSWNK	367	sp|O43181|NDUS4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3939.2	36.91375	2	1252.494447	1252.491404	K	R	159	169
PSM	NAMGSLASQATK	368	sp|P55036|PSMD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3599.5	28.28838	2	1257.544247	1257.542453	R	D	354	366
PSM	NFSDNQLQEGK	369	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3365.3	22.53117	2	1278.585047	1278.584044	R	N	161	172
PSM	ELISNSSDALDK	370	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3534.4	26.66268	2	1290.632847	1290.630326	R	I	47	59
PSM	LGSYSGPTSVSR	371	sp|Q9BZ23|PANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3514.3	26.21207	2	1289.567047	1289.565297	R	Q	187	199
PSM	SSPNPFVGSPPK	372	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3755.2	32.26317	2	1292.582447	1292.580219	K	G	393	405
PSM	LFSQGQDVSNK	373	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3626.3	28.97225	2	1301.567447	1301.565297	R	V	1797	1808
PSM	NELESYAYSLK	374	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3943.3	37.01865	2	1315.633447	1315.629597	R	N	563	574
PSM	SYSVVASEYDK	375	sp|O75592|MYCB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3701.3	30.89428	2	1326.542647	1326.538079	R	Q	3476	3487
PSM	NSNPALNDNLEK	376	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3380.3	22.91668	2	1327.637447	1327.636808	K	G	120	132
PSM	ERVFSEDRAR	377	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3226.2	19.52528	2	1343.601847	1343.598328	R	F	242	252
PSM	RASHTLLPSHR	378	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3192.2	18.94593	3	1353.671171	1353.666683	R	L	559	570
PSM	TMSVSDFNYSR	379	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3905.4	36.07376	2	1385.537447	1385.532282	R	T	1156	1167
PSM	RLSQSDEDVIR	380	sp|Q9H7D7|WDR26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3429.3	24.1129	3	1396.638071	1396.634773	K	L	119	130
PSM	GRSFAGNLNTYK	381	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3541.3	26.8389	3	1406.637971	1406.634379	R	R	384	396
PSM	DSVFLSCSEDNR	382	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3661.2	29.86553	2	1427.603447	1427.598708	K	I	180	192
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	383	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4288.2	44.7372	4	2881.110494	2881.094982	K	T	701	725
PSM	TLTIVDTGIGMTK	384	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4108.2	40.84857	3	1444.690271	1444.688449	R	A	28	41
PSM	HVFGESDELIGQK	385	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3662.2	29.89137	3	1457.720471	1457.715058	R	V	138	151
PSM	SGSMDPSGAHPSVR	386	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3243.2	19.82397	3	1479.582071	1479.581358	R	Q	18	32
PSM	DLEEDHACIPIKK	387	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3488.4	25.54183	3	1566.774971	1566.771193	K	S	560	573
PSM	NVTELNEPLSNEER	388	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3640.5	29.34235	2	1642.784247	1642.779843	K	N	29	43
PSM	SQSRSNSPLPVPPSK	389	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3478.4	25.30505	3	1659.800471	1659.798150	R	A	297	312
PSM	SRKESYSVYVYK	390	sp|P62807|H2B1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3591.3	28.07718	3	1667.706371	1667.699756	R	V	33	45
PSM	RASSDLSIASSEEDK	391	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3431.4	24.1678	3	1673.720771	1673.714540	K	L	338	353
PSM	KASPPSGLWSPAYASH	392	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3923.4	36.52098	3	1734.781871	1734.776687	R	-	1872	1888
PSM	RVSISEGDDKIEYR	393	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3541.5	26.84557	3	1745.801471	1745.798544	K	A	122	136
PSM	ERAMSTTSISSPQPGK	394	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3204.3	19.09437	3	1771.787771	1771.781180	K	L	265	281
PSM	TSSLTQFPPSQSEER	395	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3858.3	34.88568	3	1772.763971	1772.761825	R	S	124	139
PSM	TSDFNTFLAQEGCTK	396	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.4240.2	43.65463	3	1797.733571	1797.728082	K	G	199	214
PSM	DLEAEHVEVEDTTLNR	397	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3752.3	32.18912	3	1868.876771	1868.875201	R	C	15	31
PSM	RSSDSWEVWGSASTNR	398	sp|Q8N6T3|ARFG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3941.2	36.96387	3	1903.789871	1903.785020	R	N	359	375
PSM	HRTLTAEEAEEEWER	399	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3663.5	29.92715	3	1964.831171	1964.826550	R	R	152	167
PSM	INSSGESGDESDEFLQSR	400	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3788.3	33.09288	3	2035.809071	2035.800789	R	K	180	198
PSM	SQSLPNSLDYTQTSDPGR	401	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3850.3	34.6968	3	2044.877171	2044.873894	R	H	44	62
PSM	RGQTCVVHYTGMLEDGK	402	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,5-UNIMOD:4,12-UNIMOD:35	ms_run[1]:scan=1.1.3554.5	27.18153	3	2045.873771	2045.870012	K	K	19	36
PSM	DSSTCPGDYVLSVSENSR	403	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.4196.2	42.81488	3	2051.822471	2051.814331	R	V	40	58
PSM	TIGGGDDSFNTFFSETGAGK	404	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4767.2	50.90128	3	2086.864871	2086.852096	K	H	41	61
PSM	DNLTLWTSDMQGDGEEQNK	405	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3977.2	37.77658	4	2195.932894	2195.927707	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	406	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4008.3	38.53625	3	2195.935871	2195.927707	R	E	226	245
PSM	DYHFKVDNDENEHQLSLR	407	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3695.3	30.7366	4	2258.044094	2258.035223	K	T	28	46
PSM	SVSVDSGEQREAGTPSLDSEAK	408	sp|Q86UU0|BCL9L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3515.2	26.23028	4	2328.019694	2328.011844	R	E	116	138
PSM	RRSTGVVNIPAAECLDEYEDDEAGQK	409	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4059.4	39.7771	4	3001.327694	3001.312460	K	E	160	186
PSM	ASGVAVSDGVIK	410	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3833.5	34.26052	2	1143.6135	1143.6130	M	V	2	14
PSM	HASLDGASPYFK	411	sp|Q8N350|CBARP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3693.2	30.68178	3	1371.594371	1371.586032	R	V	297	309
PSM	ADKPDMGEIASFDK	412	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3994.5	38.22187	2	1564.7139	1564.7074	M	A	2	16
PSM	AASIFGGAK	413	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3597.2	28.22755	2	900.412047	900.410634	R	P	357	366
PSM	SFVLNLGK	414	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4209.2	43.09443	2	956.474247	956.473234	K	D	30	38
PSM	NLLSVAYK	415	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4119.2	41.11958	2	986.483447	986.483799	R	N	44	52
PSM	SRSDIDVNAAASAK	416	sp|Q7Z460|CLAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3299.2	20.99225	3	1483.673471	1483.666802	R	S	598	612
PSM	SSGSSLFPR	417	sp|Q9BTK6|PAGR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3746.4	32.0372	2	1016.435247	1016.432826	R	Q	242	251
PSM	DGGAWGTEQR	418	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3282.3	20.63913	2	1075.468447	1075.468286	K	E	65	75
PSM	LGSVDSFER	419	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3704.4	30.97152	2	1088.454447	1088.453955	R	S	586	595
PSM	NMSIIDAFK	420	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.4087.3	40.3816	2	1133.485447	1133.482813	R	S	617	626
PSM	QASVTLQPLK	421	sp|P78345|RPP38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3745.4	32.01797	2	1163.596247	1163.595140	R	I	251	261
PSM	STFVLDEFK	422	sp|P26641|EF1G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.4487.2	47.80768	2	1164.512847	1164.510408	K	R	286	295
PSM	TSSLTQFPPSQSEER	423	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3922.3	36.48795	3	1772.765771	1772.761825	R	S	124	139
PSM	SQGMALSLGDK	424	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3786.3	33.04435	2	1185.513447	1185.510090	K	I	933	944
PSM	SADTLWGIQK	425	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4069.3	40.02202	2	1197.546647	1197.543105	K	E	319	329
PSM	DAGTIAGLNVLR	426	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4179.3	42.48314	2	1198.669047	1198.666986	K	I	160	172
PSM	SASWGSADQLK	427	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3673.2	30.17308	2	1228.516647	1228.512533	R	E	221	232
PSM	KITIADCGQLE	428	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3655.6	29.72467	2	1246.624447	1246.622738	K	-	155	166
PSM	SASITNLSLDR	429	sp|Q9Y2I7|FYV1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3853.4	34.77455	2	1255.583447	1255.580947	R	S	305	316
PSM	DGNGYISAAELR	430	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3795.3	33.27743	2	1264.605847	1264.604780	K	H	96	108
PSM	MVVESAYEVIK	431	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3919.2	36.43722	2	1266.656247	1266.652975	K	L	234	245
PSM	EGMNIVEAMER	432	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4068.4	40.00647	2	1277.578247	1277.574407	K	F	134	145
PSM	DSAQNSVIIVDK	433	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3583.3	27.87795	2	1287.668647	1287.667045	K	N	194	206
PSM	SQSQLLNTLTK	434	sp|Q68CQ4|DIEXF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4054.2	39.64022	2	1311.647647	1311.643547	R	K	8	19
PSM	NSLESYAFNMK	435	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3748.4	32.09563	2	1318.587447	1318.586353	K	A	540	551
PSM	SSSEDAESLAPR	436	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3447.5	24.53667	2	1327.529647	1327.529305	R	S	298	310
PSM	SSSEDAESLAPR	437	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3437.3	24.31758	2	1327.529647	1327.529305	R	S	298	310
PSM	GDNITLLQSVSN	438	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4302.3	45.02597	2	1339.605047	1339.602076	K	-	81	93
PSM	ELISNASDALDK	439	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4005.3	38.4609	2	1354.608047	1354.601742	R	I	103	115
PSM	GNPTVEVDLFTSK	440	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4090.3	40.45158	2	1405.714047	1405.708910	R	G	16	29
PSM	DMRQTVAVGVIK	441	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3546.4	26.97147	3	1411.692371	1411.689452	R	A	428	440
PSM	GILAADESTGSIAK	442	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3723.5	31.45552	2	1411.665447	1411.659591	K	R	29	43
PSM	SFQGDDSDLLLK	443	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4159.2	42.07622	2	1416.593047	1416.617392	K	T	875	887
PSM	TYSDTDSCSDIPLEDPDRPVHCSK	444	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,8-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.3702.2	30.91675	4	2873.166094	2873.152120	R	N	242	266
PSM	TSSISGPLSPAYTGQVPYNYNQLEGR	445	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4625.2	48.9934	4	2878.324494	2878.317469	R	F	6	32
PSM	EVDEQMLNVQNK	446	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3605.4	28.4386	2	1445.686847	1445.682044	K	N	325	337
PSM	DKPHVNVGTIGHVDHGK	447	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3317.2	21.3974	5	1808.935118	1808.928179	R	T	54	71
PSM	TTPSVVAFTADGER	448	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3810.4	33.66435	2	1449.715647	1449.709973	R	L	86	100
PSM	CLELFSELAEDK	449	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4665.2	49.66172	2	1452.685647	1452.680647	K	E	412	424
PSM	GASQAGMTGYGMPR	450	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3719.4	31.35205	2	1462.578647	1462.573436	R	Q	183	197
PSM	TNSMSSSGLGSPNR	451	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3320.2	21.4723	2	1473.594447	1473.591922	R	S	155	169
PSM	GALQNIIPASTGAAK	452	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3991.2	38.14502	2	1490.754447	1490.749409	R	A	201	216
PSM	RRTWDDDYVLK	453	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3652.2	29.63437	3	1545.702071	1545.697708	R	R	1758	1769
PSM	RGSIGENQIKDEK	454	sp|Q05682-4|CALD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3172.2	18.63708	3	1552.725971	1552.724651	K	I	200	213
PSM	QVQSLTCEVDALK	455	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4149.2	41.84872	3	1569.712871	1569.710975	R	G	322	335
PSM	NQVAMNPTNTVFDAK	456	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3816.2	33.81173	3	1648.794671	1648.787906	K	R	57	72
PSM	ERESLQQMAEVTR	457	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3620.2	28.81378	3	1655.739671	1655.733836	K	E	123	136
PSM	SRTASGSSVTSLDGTR	458	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3325.6	21.59795	3	1660.745471	1660.741758	R	S	326	342
PSM	SQSRSNSPLPVPPSK	459	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3519.3	26.33572	3	1659.799271	1659.798150	R	A	297	312
PSM	SRTASLTSAASVDGNR	460	sp|Q9UN36|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3393.3	23.23732	3	1671.758471	1671.757742	R	S	328	344
PSM	ARPATDSFDDYPPR	461	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3536.5	26.71635	3	1686.707771	1686.703916	R	R	201	215
PSM	DRSSFYVNGLTLGGQK	462	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3994.2	38.20853	3	1740.883571	1740.879498	K	C	55	71
PSM	ARTSSTDEVLSLEEK	463	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3679.3	30.32635	3	1743.797771	1743.792790	R	D	526	541
PSM	GGSISVQVNSIKFDSE	464	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4254.3	43.95267	3	1745.791271	1745.787311	R	-	684	700
PSM	SSSTSDILEPFTVER	465	sp|Q6GYQ0|RGPA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4687.2	49.98945	3	1746.781571	1746.771327	R	A	795	810
PSM	AGTRNIYYLCAPNR	466	sp|Q12931|TRAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3752.2	32.18578	3	1747.790771	1747.786540	R	H	492	506
PSM	TSSLTQFPPSQSEER	467	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3749.3	32.11505	3	1772.767871	1772.761825	R	S	124	139
PSM	DKPHVNVGTIGHVDHGK	468	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3327.2	21.63838	4	1808.932094	1808.928179	R	T	54	71
PSM	HVPDSGATATAYLCGVK	469	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3829.3	34.15037	3	1825.812371	1825.807001	K	G	110	127
PSM	EAAALGSRGSCSTEVEK	470	sp|O75348|VATG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3255.3	20.039	3	1830.784871	1830.781908	K	E	59	76
PSM	SRTLTRTSQETADVK	471	sp|Q8N1F7|NUP93_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3283.3	20.66433	3	1851.816671	1851.812888	R	A	45	60
PSM	SLKSLDPENSETELER	472	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3857.3	34.85643	3	1925.869271	1925.861933	R	I	464	480
PSM	KGSSGNASEVSVACLTER	473	sp|Q69YQ0|CYTSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3714.3	31.22023	3	1930.851071	1930.845571	R	I	382	400
PSM	SQSLPNSLDYTQTSDPGR	474	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3842.4	34.4898	3	2044.877171	2044.873894	R	H	44	62
PSM	RSYSSPDITQAIQEEEK	475	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3908.4	36.15147	3	2059.914671	2059.909945	K	R	715	732
PSM	INSSGESGDESDEFLQSRK	476	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3587.4	27.98012	3	2163.905471	2163.895752	R	G	180	199
PSM	DNLTLWTSDQQDDDGGEGNN	477	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4393.2	46.7793	3	2192.884271	2192.873028	R	-	228	248
PSM	ERVPSVAEAPQLRPAGTAAAK	478	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3644.2	29.43162	4	2198.129694	2198.120882	R	T	536	557
PSM	STTPPPAEPVSLPQEPPKPR	479	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3750.4	32.14748	3	2204.093171	2204.087850	K	V	225	245
PSM	TGSTSSKEDDYESDAATIVQK	480	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3730.3	31.63315	3	2310.982571	2310.974062	R	C	360	381
PSM	DNLTLWTSENQGDEGDAGEGEN	481	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4314.3	45.3192	3	2349.957971	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	482	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4466.2	47.52353	3	2349.959771	2349.946922	R	-	225	247
PSM	EVEDKESEGEEEDEDEDLSK	483	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3303.3	21.08355	3	2418.903371	2418.895931	K	Y	147	167
PSM	DSGSDEDFLMEDDDDSDYGSSK	484	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3866.3	35.08541	3	2443.867571	2443.860534	K	K	129	151
PSM	YRTTSSANNPNLMYQDECDR	485	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3580.2	27.81512	3	2513.998571	2513.994103	R	R	567	587
PSM	DNLTLWTADNAGEEGGEAPQEPQS	486	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4380.2	46.61572	3	2528.108171	2528.093920	R	-	225	249
PSM	RNSVERPAEPVAGAATPSLVEQQK	487	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3641.3	29.3614	4	2613.303294	2613.291195	R	M	1454	1478
PSM	SDSEEKEPPVSQPAASSDSETSDSDDEWTFGSNK	488	sp|Q92541|RTF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3942.2	36.99958	4	3724.493294	3724.469745	R	N	77	111
PSM	ARPATDSFDDYPPR	489	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3596.3	28.20535	3	1687.714871	1686.703916	R	R	201	215
PSM	MGPSGGEGMEPERRDSQDGSSYR	490	sp|Q14847|LASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=1.1.3216.2	19.33443	4	2580.009294	2580.000645	R	R	131	154
PSM	SDAAVDTSSEITTK	491	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3593.5	28.13502	2	1465.6818	1465.6779	M	D	2	16
PSM	SPSTLLPK	492	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3716.3	31.27155	2	921.459047	921.457250	R	K	825	833
PSM	GAGSIREAGGAFGKR	493	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3375.5	22.79148	3	1512.720371	1512.719840	R	E	36	51
PSM	KASISYFK	494	sp|Q9H4L7|SMRCD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3522.2	26.38565	2	1022.486447	1022.483799	R	N	77	85
PSM	TQSLSALPK	495	sp|Q96RK0|CIC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3587.2	27.97345	2	1023.502247	1023.500177	R	E	171	180
PSM	HGSLGFLPR	496	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3819.3	33.89573	2	1062.502047	1062.501180	R	K	11	20
PSM	SISLSQSAENVPASK	497	sp|Q4ADV7|RIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3657.2	29.76277	3	1596.744671	1596.739633	R	F	1015	1030
PSM	CSSILLHGK	498	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	23.58878	2	1093.501047	1093.499132	R	E	518	527
PSM	ALLYLCGGDD	499	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4236.2	43.55307	2	1095.490047	1095.490661	K	-	330	340
PSM	MSGFIYQGK	500	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3820.2	33.92807	2	1109.466247	1109.461683	R	I	487	496
PSM	RFSDIQIR	501	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3687.3	30.54083	2	1113.538447	1113.533209	R	R	488	496
PSM	DANNGNLQLR	502	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3361.4	22.43752	2	1113.552047	1113.552684	K	N	288	298
PSM	RNTLQLHR	503	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3212.2	19.25483	3	1116.556271	1116.555341	R	Y	195	203
PSM	YIDQEELNK	504	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3367.5	22.5851	2	1150.552647	1150.550619	K	T	198	207
PSM	FEDENFILK	505	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4006.4	38.48617	2	1153.567647	1153.565540	K	H	83	92
PSM	DQIYDIFQK	506	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4247.2	43.7766	2	1168.579047	1168.576440	K	L	194	203
PSM	HQTLEVSLSRDSPLK	507	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3659.3	29.82747	3	1788.881771	1788.877129	K	T	358	373
PSM	EAAENSLVAYK	508	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3504.4	25.95453	2	1193.596447	1193.592818	K	A	143	154
PSM	TISNPEVVMK	509	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3684.3	30.45372	2	1196.557447	1196.551227	R	R	214	224
PSM	SGEGEVSGLMR	510	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3705.2	30.9901	2	1200.487847	1200.484604	R	K	473	484
PSM	GYSFTTTAER	511	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3621.4	28.85257	2	1211.489447	1211.485984	R	E	197	207
PSM	NFEDVAFDEK	512	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3841.4	34.46402	2	1212.531247	1212.529883	K	K	376	386
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	513	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3455.4	24.7375	4	2455.085294	2455.076510	R	S	364	389
PSM	SFTLDDESLK	514	sp|Q86WR7|PRSR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3990.3	38.1095	2	1233.518047	1233.516615	R	Y	43	53
PSM	KGTFTDDLHK	515	sp|Q9H4A3|WNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3321.2	21.4873	3	1240.553771	1240.548919	R	L	2243	2253
PSM	LVTRAAFNSGK	516	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3385.2	23.03163	3	1242.615071	1242.612187	R	V	17	28
PSM	GGSGSGPTIEEVD	517	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3689.5	30.59238	2	1283.495447	1283.491857	K	-	629	642
PSM	QQSEISAAVER	518	sp|Q9Y520|PRC2C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3463.2	24.93273	2	1296.574447	1296.571111	R	A	451	462
PSM	SNSFNNPLGNR	519	sp|O95835|LATS1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3699.2	30.8362	2	1298.543447	1298.540479	R	A	462	473
PSM	DATNVGDEGGFAPNILENK	520	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4221.2	43.2488	3	1959.926771	1959.917400	K	E	203	222
PSM	GLSASTMDLSSSS	521	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4038.3	39.25563	2	1321.515047	1321.510878	R	-	607	620
PSM	KITIADCGQLE	522	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3797.4	33.32902	2	1326.590247	1326.589069	K	-	155	166
PSM	ERLESLNIQR	523	sp|Q14152|EIF3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3666.2	29.99457	2	1336.654047	1336.650030	K	E	580	590
PSM	KGDECELLGHSK	524	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3241.2	19.784	3	1371.649571	1371.645264	K	N	286	298
PSM	TDSQTIGDFATR	525	sp|Q13480-2|GAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3783.3	32.9669	2	1390.580447	1390.576590	R	R	545	557
PSM	DVIELTDDSFDK	526	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4144.3	41.72127	2	1395.644847	1395.640556	K	N	161	173
PSM	SRSLSASPALGSTK	527	sp|O95544|NADK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3367.3	22.57843	3	1440.699071	1440.697374	K	E	44	58
PSM	NNSGEEFDCAFR	528	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3698.2	30.81057	2	1444.576447	1444.567742	R	L	591	603
PSM	RSTSPIIGSPPVR	529	sp|Q86TB9|PATL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3562.2	27.37683	3	1445.742371	1445.739179	R	A	176	189
PSM	DRVHHEPQLSDK	530	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3036.2	16.959	3	1459.720271	1459.716790	K	V	26	38
PSM	SGSMDPSGAHPSVR	531	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3049.2	17.09123	3	1479.582371	1479.581358	R	Q	18	32
PSM	NQSFCPTVNLDK	532	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3838.5	34.3898	2	1501.632047	1501.627246	R	L	66	78
PSM	TLPADVQNYYSR	533	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3897.6	35.87417	2	1505.661247	1505.655175	K	R	1153	1165
PSM	LTFDTTFSPNTGK	534	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4106.3	40.80083	2	1507.666647	1507.659591	K	K	108	121
PSM	HELQANCYEEVK	535	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3347.5	22.10028	3	1518.680471	1518.677293	K	D	133	145
PSM	KQSLGELIGTLNAAK	536	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4341.2	45.80763	3	1621.848371	1621.844038	R	V	56	71
PSM	EATNPPVIQEEKPK	537	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3361.3	22.43085	3	1658.792171	1658.791668	R	K	483	497
PSM	ERAMSTTSISSPQPGK	538	sp|Q9UJU6|DBNL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3368.3	22.60378	3	1755.788171	1755.786265	K	L	265	281
PSM	TSSLTQFPPSQSEER	539	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3884.3	35.52825	3	1772.763971	1772.761825	R	S	124	139
PSM	SKTFSPGPQSQYVCR	540	sp|Q8IX03|KIBRA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3529.5	26.56292	3	1820.797571	1820.791685	R	L	927	942
PSM	DRSSFYVNGLTLGGQK	541	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4126.2	41.26218	3	1820.850671	1820.845829	K	C	55	71
PSM	VVVAENFDEIVNNENK	542	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4099.3	40.63835	3	1831.902071	1831.895208	K	D	380	396
PSM	TASFSESRADEVAPAKK	543	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3331.2	21.74843	4	1872.866094	1872.861873	R	A	453	470
PSM	IRYESLTDPSKLDSGK	544	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3815.5	33.79597	3	1887.904271	1887.897924	K	E	54	70
PSM	SFSEDAVTDSSGSGTLPR	545	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	33.39962	3	1891.7909	1891.7832	K	A	1192	1210
PSM	GADFLVTEVENGGSLGSKK	546	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4160.3	42.09493	3	1986.937571	1986.929953	K	G	189	208
PSM	SVSSFPVPQDNVDTHPGSGK	547	sp|Q676U5|A16L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3770.2	32.63338	3	2133.941171	2133.936829	R	E	287	307
PSM	DNLTLWTSDQQDDDGGEGNN	548	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4324.2	45.52605	3	2192.882471	2192.873028	R	-	228	248
PSM	TVGTPIASVPGSTNTGTVPGSEK	549	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3796.4	33.30328	3	2236.069271	2236.062423	R	D	270	293
PSM	RVSVCAETYNPDEEEEDTDPR	550	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3622.4	28.87197	3	2590.025771	2590.016672	R	V	97	118
PSM	RNSVERPAEPVAGAATPSLVEQQK	551	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3633.5	29.15875	4	2613.303294	2613.291195	R	M	1454	1478
PSM	DRSSFYVNGLTLGGQK	552	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4110.3	40.9031	3	1821.850571	1820.845829	K	C	55	71
PSM	DGNGYISAAELR	553	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3845.4	34.57382	2	1265.590847	1264.604780	K	H	96	108
PSM	QLSILVHPDK	554	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.5158.2	54.1732	2	1211.6001	1211.5946	R	N	79	89
PSM	SLSNKLTLDK	555	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3883.3	35.50235	2	1239.6108	1239.6107	M	L	2	12
PSM	SQSRSNSPLPVPPSK	556	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3487.4	25.51613	3	1661.799371	1659.798150	R	A	297	312
PSM	KASPPSGLWSPAYASH	557	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3914.2	36.30345	3	1734.782471	1734.776687	R	-	1872	1888
PSM	LSDGVAVLK	558	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3569.2	27.53512	2	900.528447	900.528033	K	V	397	406
PSM	NALLSLAK	559	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4050.2	39.54173	2	908.474847	908.473234	R	G	178	186
PSM	SPSTLLPK	560	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3724.2	31.47008	2	921.459047	921.457250	R	K	825	833
PSM	SGPKPFSAPKPQTSPSPK	561	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3403.3	23.49783	4	1996.908494	1996.906060	R	R	295	313
PSM	MPSLPSYK	562	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3887.2	35.60253	2	1001.431247	1001.429321	R	V	303	311
PSM	MPSLPSYK	563	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3879.2	35.40062	2	1001.431247	1001.429321	R	V	303	311
PSM	SGVGNIFIK	564	sp|P11940|PABP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4072.2	40.07981	2	1013.494447	1013.494698	K	N	96	105
PSM	LNTSDFQK	565	sp|Q96B36|AKTS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3310.3	21.24028	2	1031.435447	1031.432492	R	L	244	252
PSM	NNSVSGLSVK	566	sp|Q9UHI6|DDX20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3434.4	24.24508	2	1083.497047	1083.496155	R	S	498	508
PSM	RESLGLESK	567	sp|Q96BH1|RNF25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3332.2	21.77338	2	1097.514047	1097.511805	R	D	448	457
PSM	RTSSTCSNESLSVGGTSVTPR	568	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3542.4	26.86798	4	2262.004494	2261.994755	K	R	748	769
PSM	VTLTSEEEAR	569	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3314.4	21.31543	2	1133.558247	1133.556432	K	L	306	316
PSM	QLSSGVSEIR	570	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3564.5	27.4377	2	1154.536447	1154.533268	R	H	80	90
PSM	SISNEGLTLNNSHVSK	571	sp|Q08AD1|CAMP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3603.3	28.3844	3	1778.826671	1778.820008	R	H	462	478
PSM	NSSISGPFGSR	572	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3655.5	29.72133	2	1187.499447	1187.497217	R	S	483	494
PSM	NSSVAAAQLVR	573	sp|Q5TAX3|TUT4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3592.2	28.09935	2	1194.577047	1194.575802	R	N	1382	1393
PSM	TKSFFDNISCDDNR	574	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3801.3	33.43212	3	1797.710171	1797.702930	K	E	366	380
PSM	SSTLSQLPGDK	575	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3515.3	26.23362	2	1211.545847	1211.543499	R	S	593	604
PSM	RSSSVVSAEMSGCSSK	576	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21,4-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3431.5	24.17113	3	1817.679071	1817.672632	R	S	291	307
PSM	RSYSAGNASQLEQLSR	577	sp|Q14678|KANK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3677.3	30.27608	3	1845.845471	1845.837055	K	A	322	338
PSM	GADFLVTEVENGGSLGSK	578	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4478.2	47.67425	3	1858.845371	1858.834990	K	K	189	207
PSM	IVRGDQPAASGDSDDDEPPPLPR	579	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3623.5	28.90122	4	2483.107294	2483.096577	K	L	45	68
PSM	SRIEQGIVDR	580	sp|Q8IWT6|LRC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3362.2	22.45265	3	1251.600371	1251.597266	K	S	217	227
PSM	IYHLPDAESDEDEDFKEQTR	581	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3807.3	33.58697	4	2516.045694	2516.038059	K	L	210	230
PSM	DGNGYISAAELR	582	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3787.2	33.06352	2	1264.605847	1264.604780	K	H	96	108
PSM	SNTISTVDLNK	583	sp|Q13480|GAB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3592.3	28.10268	2	1270.581847	1270.580613	R	L	385	396
PSM	RRNTLQLHR	584	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3105.2	17.77595	3	1272.656471	1272.656452	R	Y	194	203
PSM	SFSSPENFQR	585	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3685.4	30.48265	2	1277.509447	1277.507782	R	Q	134	144
PSM	ELISNASDALDK	586	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3678.2	30.30117	2	1274.638447	1274.635411	R	I	103	115
PSM	LMIEMDGTENK	587	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3727.3	31.5519	2	1279.580447	1279.578824	K	S	93	104
PSM	KRSEGFSMDR	588	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3245.2	19.88373	3	1291.541471	1291.538036	R	K	452	462
PSM	AMSLVSNEGEGEQNEIR	589	sp|Q14573|ITPR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3838.3	34.38313	3	1941.820571	1941.813937	R	I	2607	2624
PSM	TFNPGAGLPTDK	590	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3818.3	33.87663	2	1296.576647	1296.575133	K	K	180	192
PSM	DAGTIAGLNVMR	591	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4251.3	43.87015	2	1296.593447	1296.589737	K	I	186	198
PSM	DVLSVAFSSDNR	592	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4133.5	41.4519	2	1308.635047	1308.630994	K	Q	107	119
PSM	SFCISTLANTK	593	sp|Q69YH5|CDCA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=1.1.4158.3	42.04085	2	1320.581847	1320.578504	K	A	977	988
PSM	INVYYNEATGGK	594	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3556.6	27.23625	2	1327.642847	1327.640831	R	Y	47	59
PSM	HETLTSLNLEK	595	sp|Q96A26|F162A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3686.6	30.51513	2	1363.640847	1363.638462	R	K	129	140
PSM	ARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGK	596	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3336.6	21.85613	4	2739.178094	2739.163428	R	A	17	51
PSM	QLSMSSADSADAK	597	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3399.4	23.39597	2	1389.548447	1389.548326	R	R	414	427
PSM	NMSVIAHVDHGK	598	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	19.94852	3	1402.609571	1402.606451	R	S	21	33
PSM	GRSFAGNLNTYK	599	sp|Q01813|PFKAP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3542.5	26.87465	2	1406.638847	1406.634379	R	R	384	396
PSM	NTGIICTIGPASR	600	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3870.3	35.18368	2	1438.667647	1438.663965	R	S	44	57
PSM	SNSAWQIYLQR	601	sp|Q8N4C8|MINK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4323.2	45.50393	3	1444.657571	1444.650030	R	R	699	710
PSM	TLTIVDTGIGMTK	602	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4151.2	41.89963	2	1444.692047	1444.688449	R	A	28	41
PSM	STGGAPTFNVTVTK	603	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3853.5	34.77788	2	1458.679447	1458.675576	K	T	92	106
PSM	SGSMDPSGAHPSVR	604	sp|Q07666|KHDR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3239.3	19.74643	3	1463.587871	1463.586443	R	Q	18	32
PSM	SAADSISESVPVGPK	605	sp|P45974|UBP5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3755.4	32.26983	2	1522.694047	1522.691620	R	V	779	794
PSM	GLNSRLEATAASSVK	606	sp|Q9NQW6|ANLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3788.2	33.08955	3	1582.776371	1582.771601	R	T	129	144
PSM	SMSVYCTPNKPSR	607	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21,6-UNIMOD:4	ms_run[1]:scan=1.1.3402.4	23.46568	3	1605.670571	1605.668065	K	T	493	506
PSM	TLTTVQGIADDYDK	608	sp|O60739|EIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4106.2	40.79417	3	1618.714871	1618.712749	K	K	43	57
PSM	GRLESAQATFQAHR	609	sp|P53365|ARFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3478.3	25.30172	3	1650.769871	1650.762768	R	D	256	270
PSM	RKSELPQDVYTIK	610	sp|Q14738|2A5D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3588.2	27.99848	3	1655.832971	1655.828388	R	A	571	584
PSM	TASESISNLSEAGSIK	611	sp|P30622|CLIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3913.3	36.27763	3	1672.760771	1672.755677	K	K	191	207
PSM	TSSLTQFPPSQSEER	612	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3700.4	30.8686	3	1772.774171	1772.761825	R	S	124	139
PSM	LGAGGGSPEKSPSAQELK	613	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3364.2	22.49943	3	1791.841271	1791.840409	R	E	13	31
PSM	GRSSFYPDGGDQETAK	614	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3362.3	22.46265	3	1793.728571	1793.725773	R	T	317	333
PSM	NPDDITNEEYGEFYK	615	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3950.2	37.14957	2	1832.782847	1832.774089	R	S	300	315
PSM	NPDDITQEEYGEFYK	616	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3978.3	37.80227	3	1846.795271	1846.789740	R	S	292	307
PSM	SLSTSGESLYHVLGLDK	617	sp|Q9H3Z4|DNJC5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.5258.2	55.02979	3	1884.898571	1884.887025	R	N	8	25
PSM	TSSGLGGSTTDFLEEWK	618	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.5273.2	55.15778	3	1893.815471	1893.803355	R	A	8	25
PSM	KLESTESRSSFSQHAR	619	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3107.2	17.82505	4	1928.877294	1928.874169	R	T	420	436
PSM	SSTPPGESYFGVSSLQLK	620	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4680.2	49.8786	3	1962.907871	1962.897590	K	G	1041	1059
PSM	MASNIFGPTEEPQNIPK	621	sp|Q9H910|JUPI2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.4065.3	39.92345	3	1967.878271	1967.869995	R	R	43	60
PSM	DDANNDPQWSEEQLIAAK	622	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4056.2	39.68699	3	2042.928671	2042.918128	K	F	132	150
PSM	SSSFSSWDDSSDSYWKK	623	sp|Q9NP61|ARFG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4049.2	39.51402	3	2077.803371	2077.794247	R	E	365	382
PSM	DNLTLWTSDQQDEEAGEGN	624	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4317.3	45.36265	3	2120.889071	2120.877051	R	-	228	247
PSM	TTSSANNPNLMYQDECDR	625	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=1.1.3633.6	29.16208	3	2194.838471	2194.829663	R	R	569	587
PSM	VSSQAEDTSSSFDNLFIDR	626	sp|Q9BZD3|GCOM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4920.2	52.17715	3	2196.932471	2196.921238	R	L	177	196
PSM	ESEDKPEIEDVGSDEEEEKK	627	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3359.4	22.38053	4	2320.009294	2320.007791	K	D	251	271
PSM	CESAPGCGVWQRPVIDNPNYK	628	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3964.3	37.47228	3	2526.093371	2526.082130	R	G	360	381
PSM	SRENSVCSDTSESSAAEFDDRR	629	sp|O94763|RMP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3408.4	23.624	4	2584.019294	2584.013318	R	G	414	436
PSM	NGSLDSPGKQDTEEDEEEDEKDK	630	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3210.2	19.2056	4	2674.040894	2673.045055	K	G	134	157
PSM	KQSLGELIGTLNAAK	631	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4220.2	43.22312	3	1622.833271	1621.844038	R	V	56	71
PSM	ALSRQLSSGVSEIR	632	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3817.4	33.8442	3	1661.756171	1661.753917	R	H	76	90
PSM	TSSLTQFPPSQSEER	633	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3741.2	31.90185	3	1773.780971	1772.761825	R	S	124	139
PSM	KESYSIYVYK	634	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3615.2	28.68975	3	1360.598771	1358.615935	R	V	35	45
PSM	TFSATVR	635	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3440.2	24.37365	2	860.379647	860.379334	R	A	50	57
PSM	ADEGISFR	636	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3503.3	25.92558	2	893.425047	893.424296	K	G	121	129
PSM	SYSFIAR	637	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3801.2	33.42545	2	922.394447	922.394984	K	M	902	909
PSM	KLSFDFQ	638	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4175.2	42.38802	2	963.412047	963.410300	R	-	465	472
PSM	RLSELLR	639	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3813.3	33.73737	2	965.508247	965.505931	R	Y	450	457
PSM	NDTKEDVFVHQTAIKK	640	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3431.2	24.16113	4	1951.946894	1951.940458	R	N	78	94
PSM	RLASSVLR	641	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3534.2	26.65602	2	980.519847	980.516830	K	C	9	17
PSM	SCNCLLLK	642	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3571.2	27.58388	2	1006.496447	1006.493973	K	V	336	344
PSM	GFSLEELR	643	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4200.2	42.88442	2	1029.455847	1029.453227	R	V	75	83
PSM	QQEGESRLNLVQR	644	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3421.2	23.91733	3	1555.812371	1555.806667	R	N	100	113
PSM	RNSVTPLASPEPTK	645	sp|Q16875|F263_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3415.3	23.77313	3	1575.769871	1575.765788	R	K	459	473
PSM	SGSVYEPLK	646	sp|Q93100|KPBB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3596.2	28.20202	2	1058.471447	1058.468543	R	S	25	34
PSM	ANTFVAELK	647	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3892.2	35.73182	2	1071.500647	1071.500177	R	G	177	186
PSM	VLSIGDGIAR	648	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3996.3	38.2665	2	1079.537247	1079.537626	R	V	74	84
PSM	LGSDLTSAQK	649	sp|Q08378|GOGA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3501.2	25.87022	2	1098.499047	1098.495820	R	E	981	991
PSM	YRPGTVALR	650	sp|Q16695|H31T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3422.2	23.93	3	1111.557071	1111.553944	R	E	42	51
PSM	ALLLLCGEDD	651	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4605.2	48.77048	2	1117.537047	1117.532526	K	-	311	321
PSM	ARPATDSFDDYPPR	652	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3604.4	28.4132	3	1686.708971	1686.703916	R	R	201	215
PSM	SFSQMISEK	653	sp|Q13459|MYO9B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3809.6	33.64525	2	1135.464647	1135.462077	K	Q	1043	1052
PSM	VDNLTYRTSPDTLR	654	sp|Q01130|SRSF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3621.3	28.8459	3	1729.808171	1729.803630	K	R	18	32
PSM	DQIYDIFQK	655	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4255.2	43.96798	2	1168.579047	1168.576440	K	L	194	203
PSM	SADTLWDIQK	656	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3918.2	36.40237	2	1175.585847	1175.582253	K	D	320	330
PSM	TSSLTQFPPSQSEER	657	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3806.4	33.56788	3	1772.766071	1772.761825	R	S	124	139
PSM	SFAGNLNTYK	658	sp|Q01813|PFKAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3720.5	31.38103	2	1193.516247	1193.511805	R	R	386	396
PSM	VEVTEFEDIK	659	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3897.3	35.86417	2	1207.599847	1207.597235	K	S	133	143
PSM	DIDISSPEFK	660	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4007.3	38.51122	2	1229.525847	1229.521701	K	I	172	182
PSM	DQVANSAFVER	661	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3488.5	25.54517	2	1234.597847	1234.594215	K	L	500	511
PSM	RAPSVANVGSHCDLSLK	662	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3603.4	28.38773	3	1889.887271	1889.881897	R	I	2149	2166
PSM	DIIACGFDINK	663	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=1.1.4141.3	41.6482	2	1264.615647	1264.612173	K	T	221	232
PSM	LGMLSPEGTCK	664	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3752.4	32.19245	2	1271.531047	1271.529111	R	A	203	214
PSM	LGMLSPEGTCK	665	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3760.3	32.40533	2	1271.531047	1271.529111	R	A	203	214
PSM	VAPEEHPVLLTEAPLNPK	666	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3908.3	36.14813	3	1953.063971	1953.057128	R	A	96	114
PSM	GRLGSVDSFER	667	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3604.5	28.41653	2	1301.580247	1301.576530	R	S	584	595
PSM	SPSISNMAALSR	668	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3902.4	35.99617	2	1312.587647	1312.584652	R	A	341	353
PSM	ADLINNLGTIAK	669	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4132.2	41.4132	2	1321.667047	1321.664283	K	F	96	108
PSM	DRYDSDRYR	670	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3066.2	17.32102	3	1324.521971	1324.519744	R	D	226	235
PSM	GILAADESTGSIAK	671	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3628.5	29.0303	2	1331.696847	1331.693260	K	R	29	43
PSM	ESVPEFPLSPPK	672	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4299.2	44.9399	2	1405.657847	1405.653049	K	K	30	42
PSM	STNEAMEWMNNK	673	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3781.4	32.91495	2	1453.601247	1453.596599	K	L	737	749
PSM	STGGAPTFNVTVTK	674	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3862.3	34.9855	2	1458.679447	1458.675576	K	T	92	106
PSM	CLSLSAGQTTLSR	675	sp|Q9BTE3|MCMBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3856.2	34.83995	3	1472.667971	1472.669445	R	E	602	615
PSM	NGVMPSHFSRGSK	676	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3321.3	21.4973	3	1482.644771	1482.643898	R	S	85	98
PSM	RLTVSSLQESGLK	677	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3767.3	32.55873	3	1496.762771	1496.759974	R	V	2334	2347
PSM	SSSSSSGGGLLPYPR	678	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3962.2	37.41102	3	1530.673571	1530.671553	R	R	40	55
PSM	RGPGLYYVDSEGNR	679	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3553.6	27.1592	3	1581.756371	1581.753569	K	I	166	180
PSM	SRQSETYNYLLAK	680	sp|Q9H814|PHAX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3782.3	32.93787	3	1651.765571	1651.760702	R	K	146	159
PSM	HRVTMNEFEYLK	681	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=1.1.3632.2	29.12287	3	1661.733671	1661.727294	K	L	143	155
PSM	GATLALTQVTPQDER	682	sp|P43121|MUC18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3978.2	37.79893	3	1678.796171	1678.792731	R	I	98	113
PSM	AMSEVTSLHEDDWR	683	sp|Q86X29|LSR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3994.3	38.21187	3	1754.700371	1754.697116	R	S	430	444
PSM	TSSLTQFPPSQSEER	684	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3683.3	30.4314	3	1772.767271	1772.761825	R	S	124	139
PSM	SYELPDGQVITIGNER	685	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4302.2	45.01597	3	1789.891871	1789.884643	K	F	241	257
PSM	QVPDSAATATAYLCGVK	686	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4152.3	41.92507	3	1830.828671	1830.822317	R	A	107	124
PSM	DGQVINETSQHHDDLE	687	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3391.3	23.19307	3	1835.796071	1835.792199	R	-	451	467
PSM	RAPSVANVGSHCDLSLK	688	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3602.2	28.35547	4	1889.884894	1889.881897	R	I	2149	2166
PSM	RAPSVANVGSHCDLSLK	689	sp|P21333|FLNA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3595.4	28.183	3	1889.887271	1889.881897	R	I	2149	2166
PSM	RFSEGVLQSPSQDQEK	690	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3625.4	28.9565	3	1913.855471	1913.852037	R	L	427	443
PSM	YAALSVDGEDENEGEDYAE	691	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3931.3	36.71932	3	2074.824671	2074.812719	K	-	593	612
PSM	SRTHSTSSSLGSGESPFSR	692	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3554.6	27.18487	3	2125.852871	2125.846708	R	S	327	346
PSM	DLLLTSSYLSDSGSTGEHTK	693	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.4251.4	43.87682	3	2189.982371	2189.972940	K	S	397	417
PSM	DNLTLWTSDQQDDDGGEGNN	694	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4266.3	44.23088	3	2192.881571	2192.873028	R	-	228	248
PSM	KLEKEEEEGISQESSEEEQ	695	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3287.5	20.76475	3	2235.989471	2235.986661	K	-	89	108
PSM	AGEEDEGEEDSDSDYEISAK	696	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3504.6	25.9612	3	2253.804671	2253.795823	R	A	463	483
PSM	AYSGSDLPSSSSGGANGTAGGGGGAR	697	sp|Q8NHG8|ZNRF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3411.5	23.69935	3	2276.935271	2276.929512	R	A	17	43
PSM	SVSVDSGEQREAGTPSLDSEAK	698	sp|Q86UU0|BCL9L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3513.5	26.19435	3	2328.019871	2328.011844	R	E	116	138
PSM	DNLTLWTSDSAGEECDAAEGAEN	699	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4443.3	47.2829	3	2453.992271	2453.976507	R	-	223	246
PSM	CESAPGCGVWQRPVIDNPNYK	700	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3972.6	37.6767	3	2526.093371	2526.082130	R	G	360	381
PSM	NGRVEIIANDQGNR	701	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3451.2	24.6413	3	1555.774571	1554.786266	K	I	47	61
PSM	NGSLDSPGKQDTEEDEEEDEKDK	702	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3190.3	18.8967	4	2674.040894	2673.045055	K	G	134	157
PSM	AEPAKIEAFRASLSK	703	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3630.4	29.0781	3	1696.858871	1696.854937	K	L	142	157
PSM	SQSRSNSPLPVPPSK	704	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3503.6	25.93558	3	1661.797871	1659.798150	R	A	297	312
PSM	ADHSFSDGVPSDSVEAAK	705	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=1.1.3765.4	32.51595	3	1939.7894	1939.7832	M	N	2	20
PSM	SSFSESALEK	706	sp|Q9NQG5|RPR1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3924.3	36.54655	2	1205.4863	1205.4848	M	K	2	12
PSM	SFLFSSR	707	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5711.3	58.71475	2	964.4073	964.4050	M	S	2	9
PSM	SFLFSSRSSK	708	sp|Q9H8S9|MOB1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.5139.2	53.9693	2	1346.5365	1346.5304	M	T	2	12
PSM	RASAILR	709	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3274.2	20.42878	2	865.453647	865.453502	R	S	113	120
PSM	LLSVNIR	710	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4009.2	38.56787	2	893.475047	893.473569	R	V	1334	1341
PSM	RSPSKPLPEVTDEYK	711	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3525.4	26.45673	4	1824.876094	1824.865896	R	N	91	106
PSM	DISLSDYK	712	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3675.2	30.22615	2	939.456047	939.454927	K	G	28	36
PSM	NSLLSLSDT	713	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4107.2	40.82305	2	948.477247	948.476391	K	-	366	375
PSM	AFLAELEQNSPK	714	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4109.2	40.87085	3	1425.658571	1425.654112	K	I	4512	4524
PSM	KLSFDFQ	715	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4183.2	42.59062	2	963.412047	963.410300	R	-	465	472
PSM	KETPPPLVPPAAR	716	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3638.2	29.27755	3	1451.757371	1451.753766	R	E	3	16
PSM	TNTFLEAP	717	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4147.2	41.7976	2	971.401247	971.400129	R	-	247	255
PSM	QGSFTIEK	718	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3512.3	26.16123	2	988.427247	988.426678	R	P	836	844
PSM	EIAEAYLGK	719	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3603.2	28.38107	2	992.519047	992.517862	K	T	129	138
PSM	MPSLPSYK	720	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3870.2	35.18035	2	1001.431247	1001.429321	R	V	303	311
PSM	MPSLPSYK	721	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3895.2	35.8094	2	1001.431247	1001.429321	R	V	303	311
PSM	MPSLPSYK	722	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3612.2	28.61225	2	1017.424847	1017.424236	R	V	303	311
PSM	GLTSVINQK	723	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3810.3	33.66102	2	1038.510847	1038.511076	R	L	300	309
PSM	GDFCIQVGR	724	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=1.1.3734.4	31.72818	2	1050.494447	1050.491664	R	N	91	100
PSM	TASVPLDAVR	725	sp|Q96DV4|RM38_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3737.4	31.80513	2	1107.534647	1107.532540	R	A	127	137
PSM	SRSGSSQELDVKPSASPQER	726	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3311.4	21.25872	4	2224.019294	2224.012119	R	S	1537	1557
PSM	NMSIIDAFK	727	sp|P49959|MRE11_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4669.2	49.7138	2	1117.490647	1117.487898	R	S	617	626
PSM	ITIADCGQLE	728	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3849.2	34.6677	2	1118.530447	1118.527775	K	-	156	166
PSM	GFSIPECQK	729	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3748.3	32.08897	2	1144.465247	1144.462412	R	L	95	104
PSM	SIFDPNTFK	730	sp|Q8TDM6|DLG5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4148.3	41.82315	2	1147.497247	1147.495092	K	R	972	981
PSM	FNAHGDANTIVCNSK	731	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=1.1.3395.3	23.29465	3	1726.716671	1726.713435	R	D	50	65
PSM	RNSNSPPSPSSMNQR	732	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3190.2	18.8867	3	1737.729371	1737.725396	R	R	453	468
PSM	DLEIERPILGQNDNK	733	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3884.2	35.52492	3	1752.905471	1752.900627	R	S	234	249
PSM	RMQSLSLNK	734	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=1.1.3265.2	20.25108	2	1171.543847	1171.542059	K	-	173	182
PSM	TSSLTQFPPSQSEER	735	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3713.2	31.19137	3	1772.765171	1772.761825	R	S	124	139
PSM	ITLDNAYMEK	736	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3723.2	31.44552	2	1196.578847	1196.574725	K	C	142	152
PSM	SQGMALSLGDK	737	sp|P53618|COPB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=1.1.3507.4	26.03252	2	1201.507247	1201.505005	K	I	933	944
PSM	SLSVSSDFLGK	738	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4182.2	42.55555	2	1218.558847	1218.553335	K	D	1713	1724
PSM	RASSLNFLNK	739	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3719.3	31.34872	2	1228.600647	1228.596537	K	S	579	589
PSM	DLFDPIIEDR	740	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4660.2	49.58249	2	1231.610847	1231.608468	K	H	87	97
PSM	DNSTMGYMMAK	741	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3673.3	30.17975	2	1247.500447	1247.498465	R	K	486	497
PSM	IGEGTYGVVYK	742	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3600.4	28.31065	2	1264.575247	1264.574071	K	G	10	21
PSM	SAGNIPLSPLAR	743	sp|O15021|MAST4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4072.3	40.08982	2	1274.639047	1274.638402	K	T	1370	1382
PSM	KFTYLGSQDR	744	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3516.3	26.26873	2	1293.578247	1293.575468	R	A	296	306
PSM	EDQTEYLEER	745	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3454.3	24.70847	2	1310.565447	1310.562640	K	R	166	176
PSM	KETNNAAIIMK	746	sp|P60983|GMFB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3416.2	23.79583	3	1311.630971	1311.625789	R	I	25	36
PSM	LRTSTSDLSRGEIGDPQTENPSTR	747	sp|Q5T5U3|RHG21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3532.3	26.62068	4	2696.250494	2696.240281	R	E	1858	1882
PSM	TIDLCNNPMTK	748	sp|Q9NYU2|UGGG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3897.4	35.8675	2	1385.574647	1385.572039	K	E	1489	1500
PSM	NMSVIAHVDHGK	749	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3500.3	25.851	3	1386.616271	1386.611536	R	S	21	33
PSM	KASGPPVSELITK	750	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3723.4	31.45218	2	1405.726847	1405.721798	R	A	34	47
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	751	sp|O60927|PP1RB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3880.3	35.4316	4	2878.359694	2878.347329	R	-	100	127
PSM	DNPGVVTCLDEAR	752	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3738.5	31.83447	2	1444.665847	1444.661643	K	H	227	240
PSM	TLTIVDTGIGMTK	753	sp|Q58FG1|HS904_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4143.3	41.69907	2	1444.692047	1444.688449	R	A	28	41
PSM	RQQSEISAAVER	754	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	22.42418	3	1452.675371	1452.672222	R	A	450	462
PSM	NSFTPLSSSNTIR	755	sp|O60825|F262_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3860.3	34.94392	2	1502.671047	1502.676638	R	R	465	478
PSM	AGDLLEDSPKRPK	756	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3325.3	21.58795	3	1504.729871	1504.728674	R	E	158	171
PSM	TSSTDEVLSLEEK	757	sp|P15923-2|TFE2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3889.5	35.6643	2	1516.657647	1516.654566	R	D	528	541
PSM	AHSSMVGVNLPQK	758	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3691.3	30.63382	3	1526.640371	1526.635381	R	A	172	185
PSM	CTSVSSLDSFESR	759	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3891.4	35.71265	2	1553.612247	1553.606904	R	S	1387	1400
PSM	LAVDEEENADNNTK	760	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3256.4	20.06412	3	1560.694571	1560.690360	K	A	40	54
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	761	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3762.5	32.4572	4	3213.357294	3213.342046	K	F	173	200
PSM	SCEVPTRLNSASLK	762	sp|P08174|DAF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3600.3	28.30732	3	1640.764271	1640.759322	R	Q	97	111
PSM	IVRGDQPAASGDSDDDEPPPLPR	763	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3647.4	29.5153	3	2483.108471	2483.096577	K	L	45	68
PSM	ADSILAYHQQNVPR	764	sp|Q86UU0|BCL9L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3672.2	30.15148	3	1690.783271	1690.782835	R	A	260	274
PSM	DGKYSQVLANGLDNK	765	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3837.3	34.3572	3	1700.780471	1700.777081	K	L	92	107
PSM	NRPTSISWDGLDSGK	766	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3834.3	34.27952	3	1711.758971	1711.756680	K	L	48	63
PSM	RGSLCSGCQKPITGR	767	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3193.3	18.97065	3	1755.795371	1755.790974	R	C	531	546
PSM	TSSLTQFPPSQSEER	768	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3757.3	32.32138	3	1772.763671	1772.761825	R	S	124	139
PSM	TSSLTQFPPSQSEER	769	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3909.3	36.17747	3	1772.764271	1772.761825	R	S	124	139
PSM	HIAEEADRKYEEVAR	770	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3360.3	22.40237	4	1814.894894	1814.891125	K	K	154	169
PSM	QNPSRCSVSLSNVEAR	771	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3536.6	26.71968	3	1882.841771	1882.835675	R	R	721	737
PSM	DSSTCPGDYVLSVSENSR	772	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=1.1.4040.2	39.2919	3	1971.856871	1971.848000	R	V	40	58
PSM	RSSQPSPTAVPASDSPPTK	773	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3330.3	21.72345	3	1988.923571	1988.920451	R	Q	111	130
PSM	EVIVAKDEVAHTLTENR	774	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3557.3	27.25232	4	2002.977294	2002.972486	K	V	184	201
PSM	AMTLSPQEEVAAGQMASSSR	775	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35,5-UNIMOD:21	ms_run[1]:scan=1.1.3848.4	34.64507	3	2145.911171	2145.907185	R	S	313	333
PSM	DNLTLWTSDQQDDDGGEGNN	776	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4482.2	47.74692	3	2192.886671	2192.873028	R	-	228	248
PSM	NDSLSSLDFDDDDVDLSREK	777	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4269.3	44.3137	3	2363.957471	2363.964226	R	A	1859	1879
PSM	DSGSDEDFLMEDDDDSDYGSSK	778	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4060.5	39.79937	3	2427.874571	2427.865619	K	K	129	151
PSM	SQTTTERDSDTDVEEEELPVENR	779	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3701.4	30.90095	3	2758.159871	2758.145437	R	E	445	468
PSM	TYSIDGPNASRPQSARPSINEIPER	780	sp|Q96RT1|ERBIN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3740.3	31.88938	4	2834.344094	2834.334850	R	T	1131	1156
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	781	sp|P29692|EF1D_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4060.6	39.8027	3	2988.171371	2988.155727	K	E	144	170
PSM	DGATMKTFCGTPEYLAPEVLEDNDYGR	782	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:35,7-UNIMOD:21,9-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.4923.2	52.2425	4	3224.292094	3224.275680	K	A	302	329
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	783	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4128.4	41.32527	5	3932.729618	3932.709658	K	T	6	40
PSM	ERHPSWRSEETQER	784	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3174.3	18.68065	4	1905.820494	1905.811903	R	E	402	416
PSM	LISISGK	785	sp|Q9C0A0|CNTP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3708.2	31.06542	2	796.408047	796.409571	R	V	518	525
PSM	CTSVSSLDSFESR	786	sp|P25054|APC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.4666.2	49.6766	2	1536.5841	1536.5798	R	S	1387	1400
PSM	SLSNKLTLDK	787	sp|P00558|PGK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3874.2	35.27822	2	1239.6108	1239.6107	M	L	2	12
PSM	AASAAAASAAAASAASGSPGPGEGSAGGEK	788	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,18-UNIMOD:21	ms_run[1]:scan=1.1.3971.3	37.65113	3	2508.0859	2508.0760	M	R	2	32
PSM	SQSRSNSPLPVPPSK	789	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	25.7151	3	1661.797871	1659.798150	R	A	297	312
PSM	AASPPASASDLIEQQQK	790	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3796.2	33.29662	3	1820.833871	1819.835324	R	R	333	350
PSM	TSSLTQFPPSQSEER	791	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3824.4	34.02428	3	1773.769271	1772.761825	R	S	124	139
PSM	LASTNSSVLGADLPSSMK	792	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=1.1.3970.2	37.62578	3	1872.856571	1872.854011	R	E	105	123
PSM	RKTLDAEVVEK	793	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3278.2	20.52533	3	1366.689071	1366.685746	R	P	275	286
PSM	ERRPTWAEER	794	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3274.3	20.43878	3	1408.630571	1408.624877	R	R	380	390
PSM	SVTLLIK	795	sp|P40227|TCPZ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4000.2	38.36298	2	852.472047	852.472172	R	G	371	378
PSM	DSLIDSLT	796	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4446.2	47.3203	2	862.427647	862.428378	R	-	238	246
PSM	CGSVLVR	797	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3381.2	22.92817	2	869.383247	869.383039	R	L	188	195
PSM	SVPTWLK	798	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4041.2	39.32042	2	909.436247	909.436121	R	L	21	28
PSM	DIGFIKLD	799	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4549.2	48.3183	2	919.502847	919.501484	K	-	49	57
PSM	SPSTLLPK	800	sp|P27816|MAP4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3708.3	31.06875	2	921.459047	921.457250	R	K	825	833
PSM	EILDAFDK	801	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3920.2	36.4524	2	949.476447	949.475663	K	M	337	345
PSM	LASFYER	802	sp|P38606|VATA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3733.3	31.69925	2	964.406847	964.405549	R	A	382	389
PSM	SVSQDLIK	803	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3594.2	28.15058	2	968.4606	968.4575	R	K	377	385
PSM	LVSVLQNK	804	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	34.54799	2	979.508847	979.510348	R	M	247	255
PSM	VRNESSFSASLGR	805	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3504.2	25.94787	3	1488.675971	1488.672222	R	A	774	787
PSM	NTFNFGSK	806	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3611.2	28.58645	2	993.396847	993.395712	R	N	1097	1105
PSM	TFSNVFGR	807	sp|Q7LBC6|KDM3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4153.2	41.95045	2	1006.429047	1006.427347	K	H	764	772
PSM	DVNAAIATIK	808	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3736.3	31.7761	2	1014.571247	1014.570960	K	T	327	337
PSM	RQNPSRCSVSLSNVEAR	809	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=1.1.3428.2	24.08353	4	2038.944094	2038.936786	R	R	720	737
PSM	DGLTDVYNK	810	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3536.4	26.71302	2	1023.489847	1023.487290	K	I	182	191
PSM	TISETIER	811	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3529.3	26.55625	2	1027.461447	1027.458706	R	L	700	708
PSM	SPSVAAMASPQLCR	812	sp|P25325-2|THTM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3830.3	34.17636	3	1553.676371	1553.673150	R	A	15	29
PSM	AKSIVFHR	813	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3280.3	20.58215	2	1036.522447	1036.521916	K	K	133	141
PSM	DVIEEYFK	814	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4177.2	42.4388	2	1041.503247	1041.501878	K	C	122	130
PSM	NCSSFLIK	815	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3815.2	33.78596	2	1047.445647	1047.446034	R	R	12	20
PSM	SPLQSVVVR	816	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3780.2	32.88303	2	1063.542647	1063.542711	K	R	253	262
PSM	SLQSVAEER	817	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3542.3	26.86465	2	1097.476847	1097.475419	R	A	97	106
PSM	KMTLSLADR	818	sp|Q8WVC0|LEO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3652.4	29.64103	2	1113.527047	1113.525346	R	C	503	512
PSM	MESALDQLK	819	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3616.2	28.71417	2	1129.476247	1129.472642	R	Q	11	20
PSM	LGIHEDSTNR	820	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3153.2	18.37492	3	1140.552371	1140.552350	K	R	439	449
PSM	NRPTSISWDGLDSGK	821	sp|P30086|PEBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3907.4	36.12562	3	1711.759571	1711.756680	K	L	48	63
PSM	GDLGIEIPAEK	822	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3899.4	35.91882	2	1140.605047	1140.602654	R	V	295	306
PSM	TGYSFVNCK	823	sp|P43897|EFTS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3659.2	29.81747	2	1154.450847	1154.446762	K	K	57	66
PSM	SLSEAMSVEK	824	sp|Q6P1J9|CDC73_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3716.4	31.27488	2	1159.4891	1159.4827	R	I	172	182
PSM	RGGSGSHNWGTVKDELTESPK	825	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3622.2	28.8653	4	2321.048894	2321.043754	K	Y	216	237
PSM	YLSEVASGDNK	826	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3297.3	20.9459	2	1181.557047	1181.556432	R	Q	130	141
PSM	SDSSQPMLLR	827	sp|P11532|DMD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3782.5	32.94453	2	1212.525247	1212.520989	R	V	3621	3631
PSM	NQDNLQGWNK	828	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3423.3	23.96877	2	1215.563047	1215.563249	R	T	97	107
PSM	RQTFITLEK	829	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3646.4	29.48988	2	1214.608847	1214.606039	R	F	1218	1227
PSM	RSPSKPLPEVTDEYK	830	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3524.5	26.43398	3	1824.871871	1824.865896	R	N	91	106
PSM	ALSQGVESVKK	831	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3307.2	21.18353	3	1224.613871	1224.611519	R	E	178	189
PSM	SRSPESQVIGENTKQP	832	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3445.3	24.47962	3	1835.842271	1835.841472	R	-	305	321
PSM	TLPQLPNEEK	833	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3772.2	32.68503	2	1247.584047	1247.579884	R	S	644	654
PSM	DHGGALGPEEFK	834	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3503.2	25.92225	3	1255.584671	1255.583316	K	A	780	792
PSM	TPDSFEESQGEEIGKVERSDSK	835	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3613.3	28.6415	4	2533.090494	2533.085738	K	S	1128	1150
PSM	SYSSPDITQAIQEEEK	836	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4142.2	41.66693	3	1903.815071	1903.808834	R	R	716	732
PSM	SMGLPTSDEQK	837	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3519.5	26.34572	2	1271.515047	1271.510484	K	K	298	309
PSM	DISTNYYASQK	838	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3455.5	24.74417	2	1288.593647	1288.593546	K	K	672	683
PSM	HTIIPAKSPEK	839	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3219.2	19.37095	3	1299.660671	1299.658803	R	C	1908	1919
PSM	TRSWDSSSPVDRPEPEAASPTTR	840	sp|Q86WB0|NIPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3539.4	26.79075	4	2608.168894	2608.155489	R	T	352	375
PSM	SPSISNMAALSR	841	sp|Q9H1A4|APC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3894.5	35.7935	2	1312.586847	1312.584652	R	A	341	353
PSM	DRKESLDVYELDAK	842	sp|Q13510|ASAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3747.2	32.05639	4	1759.807694	1759.802961	R	Q	297	311
PSM	KESYSIYVYK	843	sp|P33778|H2B1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3717.5	31.30392	2	1358.620247	1358.615935	R	V	35	45
PSM	GEPNVSYICSR	844	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3572.2	27.6082	2	1360.555447	1360.548267	R	Y	273	284
PSM	QRMESALDQLK	845	sp|P37837|TALDO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3836.3	34.3346	3	1397.638271	1397.637416	R	Q	9	20
PSM	EQFLDGDGWTSR	846	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3969.2	37.58718	2	1409.624047	1409.621158	K	W	25	37
PSM	TASLTSAASVDGNR	847	sp|Q9UN36|NDRG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3491.4	25.61892	2	1428.625047	1428.624603	R	S	330	344
PSM	RSSFSMEEGDVL	848	sp|P19484|TFEB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4126.3	41.26552	2	1435.571847	1435.569062	R	-	465	477
PSM	LTFDSSFSPNTGK	849	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3995.2	38.23743	2	1479.632047	1479.628291	K	K	97	110
PSM	TLPADVQNYYSR	850	sp|Q99590|SCAFB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3905.5	36.0771	2	1505.661247	1505.655175	K	R	1153	1165
PSM	FARRSVSDNDIR	851	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3239.4	19.7531	3	1514.700371	1514.699105	R	K	742	754
PSM	NVFSSSGTSFSGRK	852	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3566.2	27.45907	3	1539.677471	1539.671887	K	I	1453	1467
PSM	DIEREDIEFICK	853	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3934.2	36.78788	3	1565.756171	1565.739559	K	T	327	339
PSM	SSTVTEAPIAVVTSR	854	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4042.2	39.3426	3	1596.777671	1596.776018	R	T	331	346
PSM	LTFDSSFSPNTGKK	855	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3785.3	33.01517	3	1607.729771	1607.723254	K	N	97	111
PSM	KQSLGELIGTLNAAK	856	sp|P60174|TPIS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4327.3	45.60555	3	1621.848371	1621.844038	R	V	56	71
PSM	GSSLSGTDDGAQEVVK	857	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3485.4	25.46533	2	1628.695247	1628.693076	R	D	275	291
PSM	SRTSSFTEQLDEGTPNRESGDTQSFAQK	858	sp|Q13439|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3814.3	33.7666	4	3262.362894	3262.345291	R	L	37	65
PSM	ESLKEEDESDDDNM	859	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3299.3	21.00225	2	1654.620847	1654.615206	K	-	242	256
PSM	DVVICPDASLEDAKK	860	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3718.2	31.31967	3	1658.822171	1658.818537	R	E	49	64
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	861	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4152.5	41.93173	4	3393.363294	3393.345713	K	F	86	114
PSM	DGSDEPGTAACPNGSFHCTNTGYKPLYIPSNR	862	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:4,15-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3910.4	36.21002	4	3562.513694	3562.491898	K	V	60	92
PSM	HVPDSGATATAYLCGVK	863	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3853.3	34.77122	3	1825.812371	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	864	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4135.3	41.49263	3	1830.828671	1830.822317	R	A	107	124
PSM	SSSVGSSSSYPISPAVSR	865	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3735.3	31.75042	3	1833.820871	1833.814588	R	T	4384	4402
PSM	QLVRGEPNVSYICSR	866	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3697.3	30.78812	3	1856.864471	1856.860433	K	Y	269	284
PSM	SAPAMQSSGSFNYARPK	867	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3554.3	27.17487	3	1877.817671	1877.813149	R	Q	719	736
PSM	TSSTCSNESLSVGGTSVTPR	868	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4,6-UNIMOD:21	ms_run[1]:scan=1.1.3677.4	30.27942	3	2105.902271	2105.893644	R	R	749	769
PSM	HRTLTAEEAEEEWERR	869	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3654.2	29.68547	4	2120.939294	2120.927661	R	N	152	168
PSM	DNLTLWTSDQQDDDGGEGNN	870	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4365.2	46.34528	3	2192.878271	2192.873028	R	-	228	248
PSM	STTPPPAEPVSLPQEPPKPR	871	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3758.3	32.34705	3	2204.093171	2204.087850	K	V	225	245
PSM	QREESETRSESSDFEVVPK	872	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3550.3	27.0745	4	2318.018094	2318.006365	R	R	1238	1257
PSM	DYEEVGVDSVEGEGEEEGEEY	873	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4176.3	42.40343	3	2347.908971	2347.897571	K	-	431	452
PSM	RVSVCAETYNPDEEEEDTDPRVIHPK	874	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3676.2	30.24773	5	3164.390118	3164.375789	R	T	97	123
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	875	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4136.4	41.52803	5	3932.729618	3932.709658	K	T	6	40
PSM	QNPSRCSVSLSNVEAR	876	sp|P47712|PA24A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,6-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3737.6	31.8118	3	1865.8162	1865.8086	R	R	721	737
PSM	QLSSGVSEIR	877	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3618.2	28.76363	2	1155.520047	1154.533268	R	H	80	90
PSM	SLVIPEK	878	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.4015.2	38.70002	2	906.4469	906.4458	M	F	2	9
PSM	STVHEILCK	879	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3930.3	36.69072	2	1207.5381	1207.5303	M	L	2	11
PSM	SSPSARPPDVPGQQPQAAK	880	sp|Q96JP5|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3381.4	22.9415	3	1996.940471	1996.936769	R	S	82	101
PSM	CSSSSGGGSSGDEDGLELDGAPGGGK	881	sp|Q9P258|RCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3983.3	37.9407	3	2401.8943	2401.8848	R	R	42	68
PSM	CNSLSTLEK	882	sp|P13473|LAMP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.3899.3	35.91548	2	1113.4437	1113.4408	R	N	153	162
PSM	STSVPQGHTWTQR	883	sp|Q9NYJ1|COA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3558.3	27.2813	2	1605.6986	1605.6932	M	V	2	15
PSM	QRALSTWK	884	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	31.1157	2	1051.4858	1051.4847	R	Q	172	180
PSM	DANNGNLQLR	885	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3369.4	22.6325	2	1114.538447	1113.552684	K	N	288	298
PSM	RLASSVLR	886	sp|P84098|RL19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3525.5	26.46007	2	980.519847	980.516830	K	C	9	17
PSM	ALSTWK	887	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3591.2	28.07385	2	784.353047	784.352056	R	Q	174	180
PSM	NLLSVAYK	888	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3782.2	32.93453	2	906.518647	906.517468	R	N	44	52
PSM	QTVAVGVIK	889	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3503.5	25.93225	2	913.561647	913.559667	R	A	431	440
PSM	SGPKPFSAPKPQTSPSPK	890	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3348.3	22.12903	4	1916.944894	1916.939729	R	R	295	313
PSM	DVNVNFEK	891	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3517.3	26.28752	2	963.467247	963.466161	K	S	26	34
PSM	LVLVGDGGTGK	892	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3546.5	26.9748	2	1014.570447	1014.570960	K	T	13	24
PSM	QLSILVHPDKNQDDADR	893	sp|O75937|DNJC8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3765.2	32.50262	4	2042.952094	2042.942249	R	A	79	96
PSM	TFSQEVSR	894	sp|Q5VZK9|CARL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3450.2	24.60292	2	1032.430847	1032.427741	R	R	1322	1330
PSM	SIRSPSLSD	895	sp|Q6P1X5|TAF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	23.89168	2	1040.454047	1040.453955	R	-	1191	1200
PSM	LVSLSACGR	896	sp|Q96JN8|NEUL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3627.3	28.99798	2	1041.468247	1041.467832	R	T	51	60
PSM	LQSIGTENTEENR	897	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3351.5	22.18278	3	1569.672671	1569.667196	R	R	44	57
PSM	LARASGNYATVISHNPETK	898	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3544.3	26.9164	4	2108.007694	2108.005183	K	K	126	145
PSM	NNAYLAQSPQLYK	899	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3817.3	33.84087	3	1588.734071	1588.728674	K	Q	242	255
PSM	SFSMQDLR	900	sp|Q9H6H4|REEP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3901.3	35.96702	2	1062.423647	1062.420547	R	S	150	158
PSM	GMSSTFSQR	901	sp|Q9Y5U2|TSSC4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3527.5	26.5121	2	1079.411847	1079.410710	R	S	84	93
PSM	NATLSQVLR	902	sp|Q9NRY5|F1142_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3900.2	35.93807	2	1080.533447	1080.532874	R	E	205	214
PSM	RLMSMEMD	903	sp|Q9P2B2|FPRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3940.2	36.93523	2	1091.385647	1091.385089	R	-	872	880
PSM	GMGSLDAMDK	904	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3682.2	30.39918	2	1103.406447	1103.402848	R	H	413	423
PSM	MESALDQLK	905	sp|P37837|TALDO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3816.3	33.81507	2	1113.478447	1113.477727	R	Q	11	20
PSM	ATTLLEGGFR	906	sp|Q5VTB9|RN220_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3998.2	38.31463	2	1143.532847	1143.532540	R	G	366	376
PSM	SASVSSISLTK	907	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3637.2	29.25178	2	1158.554447	1158.553335	R	G	1132	1143
PSM	TSSLTQFPPSQSEER	908	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3766.3	32.53598	3	1772.763971	1772.761825	R	S	124	139
PSM	IDIIPNPQER	909	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3830.5	34.18303	2	1193.643047	1193.640437	K	T	73	83
PSM	IDIIPNPQER	910	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3822.3	33.97275	2	1193.643047	1193.640437	K	T	73	83
PSM	LATNTSAPDLK	911	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3452.3	24.65707	2	1209.564647	1209.564234	R	N	923	934
PSM	SINQPVAFVR	912	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3928.2	36.63895	2	1209.595447	1209.590724	R	R	15	25
PSM	SMSAPVIFDR	913	sp|O60749|SNX2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21,2-UNIMOD:35	ms_run[1]:scan=1.1.3880.2	35.42493	2	1217.516847	1217.515176	K	S	117	127
PSM	QHLSSVVFIK	914	sp|O43324|MCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3960.2	37.36977	3	1236.627371	1236.626775	R	N	157	167
PSM	ADLINNLGTIAK	915	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4061.2	39.81493	2	1241.700847	1241.697952	K	F	96	108
PSM	QTESTSFLEK	916	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3599.3	28.28172	2	1248.532647	1248.527514	K	K	172	182
PSM	EQVANSAFVER	917	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3450.3	24.60625	2	1248.612847	1248.609865	K	V	365	376
PSM	KLEEEQIILEDQNCK	918	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:4	ms_run[1]:scan=1.1.3689.4	30.58572	3	1887.919271	1887.924794	K	L	975	990
PSM	AMSLVSSDSEGEQNELR	919	sp|Q14643|ITPR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3609.4	28.54158	3	1946.797271	1946.792867	R	N	2688	2705
PSM	KRSEGFSMDR	920	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.2958.2	16.45687	3	1307.537171	1307.532951	R	K	452	462
PSM	RASSLNFLNK	921	sp|Q9H0B6|KLC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3958.3	37.31127	2	1308.568447	1308.562868	K	S	579	589
PSM	ERSDTFINLR	922	sp|P17655|CAN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3733.2	31.69592	3	1329.615371	1329.607830	R	E	460	470
PSM	LNQPGTPTRTAV	923	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3388.3	23.11722	2	1333.638647	1333.639131	R	-	389	401
PSM	YRTTSSANNPNLMYQDECDRR	924	sp|Q92841|DDX17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=1.1.3483.2	25.40693	4	2670.107294	2670.095214	R	L	567	588
PSM	SASFNTDPYVR	925	sp|Q9UKV8|AGO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3717.4	31.30058	2	1335.553247	1335.549647	R	E	385	396
PSM	SNSWQGNLGGNK	926	sp|Q9P0K1|ADA22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3493.5	25.67382	2	1340.555447	1340.551044	R	K	832	844
PSM	NSLTGEEGQLAR	927	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3555.6	27.21057	2	1353.595647	1353.592574	R	V	111	123
PSM	RSSTLSQLPGDK	928	sp|O60271|JIP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3373.2	22.72738	3	1367.644271	1367.644610	K	S	592	604
PSM	DSSSTNLESMDTS	929	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3540.3	26.81305	2	1372.537647	1372.530019	K	-	1218	1231
PSM	TLEEDEEELFK	930	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4132.3	41.41987	2	1380.634247	1380.629657	K	M	40	51
PSM	LYRPGSVAYVSR	931	sp|P53396|ACLY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3614.2	28.66392	3	1446.708071	1446.702065	K	S	651	663
PSM	KGSSSSVCSVASSSDISLGSTK	932	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3696.3	30.76235	3	2209.986371	2209.977373	R	T	1382	1404
PSM	TTPSYVAFTDTER	933	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3788.4	33.09622	2	1486.696047	1486.693989	R	L	37	50
PSM	NGVMPSHFSRGSK	934	sp|P39019|RS19_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=1.1.3113.2	17.91558	3	1498.640171	1498.638813	R	S	85	98
PSM	NSSEASSGDFLDLK	935	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4158.4	42.04418	2	1548.639847	1548.634499	R	G	86	100
PSM	SQSREEQAVLLVR	936	sp|Q99501|GA2L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3742.2	31.9276	3	1593.790871	1593.787586	R	R	436	449
PSM	SLTNDWEDHLAVK	937	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3906.3	36.09635	3	1606.709471	1606.702853	K	H	315	328
PSM	SMGGAAIAPPTSLVEK	938	sp|Q96I25|SPF45_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4130.2	41.36585	2	1607.770647	1607.763011	R	D	169	185
PSM	RRQQSEISAAVER	939	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3295.4	20.8961	3	1608.774371	1608.773333	R	A	449	462
PSM	DRTTSFFLNSPEK	940	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3979.2	37.82802	3	1620.723971	1620.718503	K	E	1274	1287
PSM	HRVTMNEFEYLK	941	sp|P31749|AKT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3841.2	34.45735	3	1645.736471	1645.732379	K	L	143	155
PSM	SFSLASSSNSPISQR	942	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3907.2	36.11895	3	1646.732471	1646.730130	R	R	172	187
PSM	SQSRSNSPLPVPPSK	943	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3529.4	26.55958	3	1659.799271	1659.798150	R	A	297	312
PSM	DFTVSAMHGDMDQK	944	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3809.5	33.64192	3	1660.629371	1660.626259	R	E	296	310
PSM	ARVYTDVNTHRPR	945	sp|P68400|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3236.2	19.66522	4	1663.795294	1663.794402	R	E	9	22
PSM	NTVSQSISGDPEIDK	946	sp|Q9BY44|EIF2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3528.5	26.53787	3	1668.732671	1668.724376	R	K	521	536
PSM	RQAQQERDELADEIANSSGK	947	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3554.2	27.17153	4	2244.080894	2244.073066	K	G	1697	1717
PSM	LQSIGTENTEENRR	948	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3275.2	20.46375	3	1725.770771	1725.768307	R	F	44	58
PSM	NQVAMNPTNTVFDAK	949	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3840.2	34.43158	3	1728.759371	1728.754237	K	R	57	72
PSM	TITLEVEPSDTIENVK	950	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4091.2	40.47048	3	1786.925171	1786.920025	K	A	12	28
PSM	DKPHVNVGTIGHVDHGK	951	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3318.3	21.4123	4	1808.932094	1808.928179	R	T	54	71
PSM	DRSSTTSTWELLDQR	952	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4133.4	41.44523	3	1873.826171	1873.820736	K	T	542	557
PSM	SAPAMQSSGSFNYARPK	953	sp|Q8WX93|PALLD_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3387.2	23.09198	3	1893.813371	1893.808064	R	Q	719	736
PSM	FQEQECPPSPEPTRK	954	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3305.3	21.12673	3	1908.813371	1908.807729	K	E	178	193
PSM	RRDSAPYGEYGSWYK	955	sp|Q9H0B6|KLC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3733.6	31.70925	3	1913.816171	1913.809778	K	A	425	440
PSM	QNEPFVATQSSACVDGPANH	956	sp|O00180|KCNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3664.3	29.94628	3	2127.938471	2127.927981	K	-	317	337
PSM	DNLTLWTSENQGDEGDAGEGEN	957	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4324.3	45.53271	3	2349.957971	2349.946922	R	-	225	247
PSM	ESLTEAEVATEKEGEDGDQPTTPPKPLK	958	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3751.3	32.17335	4	3075.426494	3075.417302	K	T	162	190
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	959	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3385.3	23.04163	5	3566.447618	3565.448950	K	D	124	155
PSM	CSSVTGVQR	960	sp|O60343|TBCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3493.3	25.66715	2	1055.4109	1055.4102	R	R	316	325
PSM	TTSFAESCKPVQQPSAFGSMK	961	sp|P49841|GSK3B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:4,20-UNIMOD:35	ms_run[1]:scan=1.1.3657.4	29.7761	4	2383.035694	2383.022550	R	V	7	28
PSM	DGKYSQVLANGLDNK	962	sp|P62269|RS18_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3745.3	32.0113	3	1701.765671	1700.777081	K	L	92	107
PSM	CGSVLVR	963	sp|P15880|RS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1.1.4104.2	40.74282	2	852.3552	852.3560	R	L	188	195
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	964	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3722.2	31.42442	4	3223.244894	3223.230486	K	-	122	148
PSM	CHTIMNCTR	965	sp|P21912|SDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3518.5	26.31697	2	1254.4369	1254.4340	R	T	243	252
PSM	QFSISESMKPK	966	sp|Q9NRP4|SDHF3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4083.3	40.26957	2	1343.5869	1343.5827	R	F	114	125
PSM	AESSESFTMASSPAQR	967	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=1.1.3883.2	35.49902	3	1806.7189	1806.7126	M	R	2	18
PSM	DFSETYER	968	sp|O94992|HEXI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3544.4	26.91973	2	1125.403447	1125.401586	R	Y	266	274
PSM	QEGRKDSLSVNEFK	969	sp|Q99584|S10AD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=1.1.3655.3	29.71467	3	1698.7639	1698.7609	R	E	26	40
PSM	GASGSFVVVQK	970	sp|Q5SSJ5|HP1B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3582.3	27.85355	2	1157.550447	1157.548190	K	S	223	234
PSM	KASFLR	971	sp|P46777|RL5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3316.2	21.37242	2	800.394647	800.394590	K	A	284	290
PSM	SGSPSDNSGAEEMEVSLAKPK	972	sp|P31749|AKT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,8-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3911.5	36.23597	3	2358.884771	2358.872921	R	H	122	143
PSM	SYTIGL	973	sp|O14744|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4344.2	45.89651	2	732.310247	732.309523	R	-	632	638
PSM	SYTIGL	974	sp|O14744|ANM5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4333.2	45.69285	2	732.310247	732.309523	R	-	632	638
PSM	GAGSVFR	975	sp|P62917|RL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3412.2	23.71153	2	772.325847	772.326904	K	A	11	18
PSM	SWSLIK	976	sp|P79522|PRR3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4092.2	40.49938	2	812.382847	812.383357	K	N	135	141
PSM	GDTVLLK	977	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3541.2	26.83557	2	824.408447	824.404486	R	G	54	61
PSM	QLIVGVNK	978	sp|P68104|EF1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3492.2	25.63793	2	869.533247	869.533452	K	M	147	155
PSM	TYTWLK	979	sp|Q6YHK3|CD109_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3967.3	37.54917	2	890.393247	890.393921	R	G	1013	1019
PSM	LLPRYSHSGSSSPDTK	980	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3309.3	21.20808	4	1810.830094	1810.825094	R	V	963	979
PSM	NIILEEGK	981	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3511.2	26.13205	2	914.506447	914.507297	K	E	46	54
PSM	SGYLLPDTK	982	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3635.2	29.20032	2	992.518447	992.517862	R	A	725	734
PSM	MPSLPSYK	983	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3604.2	28.40653	2	1017.424847	1017.424236	R	V	303	311
PSM	MPSLPSYK	984	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=1.1.3623.4	28.89788	2	1017.425247	1017.424236	R	V	303	311
PSM	DWDDDQND	985	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3322.2	21.50898	2	1021.324647	1021.326098	K	-	541	549
PSM	HGSYEDAVHSGALND	986	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3429.4	24.11623	3	1570.666271	1570.664814	K	-	542	557
PSM	DVDLEFLAK	987	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4342.2	45.83615	2	1048.548047	1048.544077	K	M	669	678
PSM	ATFSEFAAK	988	sp|O14776|TCRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3762.4	32.45053	2	1050.445847	1050.442328	R	H	745	754
PSM	TLSDYNIQK	989	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3436.2	24.28915	2	1080.546047	1080.545139	R	E	55	64
PSM	LGSVDSFER	990	sp|O60343|TBCD4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3712.3	31.17268	2	1088.454447	1088.453955	R	S	586	595
PSM	TGSLQLICK	991	sp|Q96JP5|ZFP91_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3783.2	32.96023	2	1098.517447	1098.514448	K	S	175	184
PSM	TTEVIRKGSITEYTAAEEK	992	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3556.3	27.22625	4	2205.064494	2205.056610	K	E	106	125
PSM	AVDSLVPIGR	993	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4097.2	40.5887	2	1105.557047	1105.553276	K	G	195	205
PSM	NLQTVNVDEN	994	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3498.4	25.79917	2	1144.538247	1144.536031	K	-	116	126
PSM	GSFSLGEQSR	995	sp|Q8TEB1|DCA11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3563.3	27.40572	2	1146.472447	1146.470668	R	V	146	156
PSM	SLSVPVDLSR	996	sp|Q9NYF3|FA53C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4118.4	41.08812	2	1151.559647	1151.558755	R	W	120	130
PSM	NSFREQLEEEEEAK	997	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3619.3	28.79193	3	1736.790671	1736.785323	K	H	1339	1353
PSM	ATAVMPDGQFK	998	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3570.2	27.55947	2	1163.566447	1163.564495	K	D	17	28
PSM	AEAGDNLGALVR	999	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3743.3	31.9566	2	1184.616647	1184.614950	R	G	316	328
PSM	NSSISGPFGSR	1000	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3663.3	29.92048	2	1187.499447	1187.497217	R	S	483	494
PSM	DITSDTSGDFR	1001	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3545.3	26.9419	2	1212.527447	1212.525861	K	N	167	178
PSM	NLQYYDISAK	1002	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3707.3	31.04365	2	1213.598847	1213.597903	K	S	143	153
PSM	RGGPISFSSSR	1003	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3509.4	26.08428	3	1229.556371	1229.555401	R	S	1930	1941
PSM	DRVTDALNATR	1004	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3546.3	26.96813	3	1230.634571	1230.631663	K	A	419	430
PSM	DNWEELYNR	1005	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3917.2	36.37438	2	1237.541647	1237.536366	K	Y	833	842
PSM	DSQGTYSSRDAELQDQEFGKR	1006	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3561.3	27.35792	4	2496.067694	2496.055441	R	D	850	871
PSM	SRSSDIVSSVR	1007	sp|Q14C86|GAPD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3376.2	22.8034	3	1271.589671	1271.587095	R	R	900	911
PSM	KGTGLLSSDYR	1008	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3533.2	26.63163	2	1275.592447	1275.586032	R	I	401	412
PSM	SYLYPSTLVR	1009	sp|P52732|KIF11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4140.3	41.62283	2	1277.608447	1277.605705	K	T	931	941
PSM	NSTFSEIFKK	1010	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3924.2	36.53655	3	1279.584971	1279.584970	K	E	344	354
PSM	GYFEYIEENK	1011	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3972.4	37.67003	2	1290.579047	1290.576833	R	Y	256	266
PSM	NSLESYAFNMK	1012	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3981.3	37.88273	2	1302.594847	1302.591438	K	A	540	551
PSM	KKTLEEEFAR	1013	sp|Q9H2G2|SLK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3382.3	22.95648	3	1329.634571	1329.632983	R	K	1186	1196
PSM	RRSPSPYYSR	1014	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3104.2	17.74143	3	1347.611771	1347.608499	R	Y	258	268
PSM	RLDSDAVNTIESQSVSPDHNKEPK	1015	sp|Q9H3H1|MOD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3808.3	33.60942	4	2745.274094	2745.260682	R	E	428	452
PSM	DKSPVREPIDNLTPEER	1016	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3652.5	29.64437	3	2073.980471	2073.973214	K	D	134	151
PSM	DYEEVGADSADGEDEGEEY	1017	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3792.3	33.20005	3	2077.747271	2077.739614	K	-	431	450
PSM	TGAELVTCGSVLK	1018	sp|Q9HCN8|SDF2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3867.3	35.10995	2	1413.657247	1413.657483	K	L	31	44
PSM	RRSPSPYYSR	1019	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3108.2	17.84933	3	1427.574371	1427.574830	R	Y	258	268
PSM	VYTDVNTHRPR	1020	sp|P68400|CSK21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3188.2	18.84723	3	1436.659571	1436.656178	R	E	11	22
PSM	GRLSVASTPISQR	1021	sp|Q9BXS6|NUSAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3533.3	26.63497	2	1450.728647	1450.729343	R	R	237	250
PSM	VASFSCMCPEGK	1022	sp|Q04721|NOTC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,6-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3743.6	31.9666	2	1451.532447	1451.528460	R	A	357	369
PSM	EKGSFSDTGLGDGK	1023	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3375.4	22.78482	3	1476.615971	1476.613369	K	M	374	388
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	1024	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3825.4	34.05018	4	3054.258094	3054.246274	K	N	1928	1956
PSM	DQGTYEDYVEGLR	1025	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4088.4	40.40715	2	1543.682447	1543.679067	K	V	82	95
PSM	NKSTESLQANVQR	1026	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3253.3	20.00143	3	1553.718971	1553.719900	R	L	104	117
PSM	VPSPLEGSEGDGDTD	1027	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3718.6	31.333	2	1553.582247	1553.577043	K	-	413	428
PSM	DTSFSGLSLEEYK	1028	sp|Q9BRT2|UQCC2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4378.3	46.56017	2	1554.656847	1554.649086	R	L	77	90
PSM	TYSLGSALRPSTSR	1029	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3836.4	34.34127	3	1574.750171	1574.745387	R	S	37	51
PSM	HRPSEADEEELAR	1030	sp|O14617|AP3D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3224.3	19.46963	3	1617.682271	1617.678429	K	R	655	668
PSM	SMSVYCTPNKPSR	1031	sp|P16615|AT2A2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,2-UNIMOD:35,6-UNIMOD:4	ms_run[1]:scan=1.1.3236.4	19.67855	3	1621.670471	1621.662980	K	T	493	506
PSM	EAELSKGESVCLDR	1032	sp|P62072|TIM10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=1.1.3508.3	26.05477	3	1671.720071	1671.717517	K	C	40	54
PSM	SRKESYSIYVYK	1033	sp|P33778|H2B1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3689.2	30.57905	3	1681.721171	1681.715406	R	V	33	45
PSM	GRSRSPQRPGWSR	1034	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	14.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3182.2	18.77385	4	1685.73609419132	1685.7301015848898	R	S	532	545
PSM	RNSSEASSGDFLDLK	1035	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3886.2	35.57665	3	1704.741071	1704.735610	R	G	85	100
PSM	SRTASGSSVTSLDGTR	1036	sp|Q92597|NDRG1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3407.3	23.59878	3	1740.715571	1740.708089	R	S	326	342
PSM	CIPALDSLTPANEDQK	1037	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4039.3	39.27367	3	1770.848771	1770.845815	R	I	447	463
PSM	TSSLTQFPPSQSEER	1038	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3892.3	35.73515	3	1772.763971	1772.761825	R	S	124	139
PSM	SGKYDLDFKSPDDPSR	1039	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3593.2	28.12502	3	1825.854371	1825.848257	R	Y	254	270
PSM	TDYNASVSVPDSSGPER	1040	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3609.3	28.53825	3	1859.763671	1859.757467	R	I	70	87
PSM	KTDPSSLGATSASFNFGK	1041	sp|Q9UKX7|NUP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3882.3	35.47738	3	1893.857171	1893.850974	K	K	258	276
PSM	FRASSQSAPSPDVGSGVQT	1042	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3601.3	28.33627	3	1956.862871	1956.857850	R	-	124	143
PSM	SRTHSTSSSLGSGESPFSR	1043	sp|Q9UGV2|NDRG3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3446.3	24.50468	3	2045.883971	2045.880377	R	S	327	346
PSM	NGRKTLTTVQGIADDYDK	1044	sp|O60739|EIF1B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3736.4	31.77943	4	2073.980094	2073.973214	R	K	39	57
PSM	DLLLTSSYLSDSGSTGEHTK	1045	sp|P08195|4F2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4076.3	40.13692	3	2110.016471	2110.006609	K	S	397	417
PSM	NQDECVIALHDCNGDVNR	1046	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3573.3	27.63932	3	2127.918371	2127.906200	K	A	64	82
PSM	SDSSSKKDVIELTDDSFDK	1047	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3899.2	35.91215	4	2194.961694	2194.951870	R	N	154	173
PSM	DNLTLWTSENQGDEGDAGEGEN	1048	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4295.3	44.87573	3	2349.956471	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	1049	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4305.3	45.09192	3	2349.957971	2349.946922	R	-	225	247
PSM	EFDRHSGSDRSSFSHYSGLK	1050	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3453.2	24.67983	5	2378.017118	2378.007702	R	H	192	212
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	1051	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3533.5	26.64497	4	3365.468094	3365.451593	K	K	799	833
PSM	CESAPGCGVWQRPVIDNPNYK	1052	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4289.2	44.7747	3	2509.0692	2509.0552	R	G	360	381
PSM	CESAPGCGVWQRPVIDNPNYK	1053	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.4301.3	44.99065	3	2509.0692	2509.0552	R	G	360	381
PSM	NGSEADIDEGLYSR	1054	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3781.5	32.91828	2	1525.656047	1524.669230	K	Q	44	58
PSM	SRTSSFTEQLDEGTPNRENASTHASK	1055	sp|Q13439-5|GOGA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3535.2	26.69418	5	3009.261118	3009.250268	R	S	37	63
PSM	TSSLTQFPPSQSEER	1056	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3832.3	34.23122	3	1773.771071	1772.761825	R	S	124	139
PSM	CSSILLHGK	1057	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.4239.2	43.62932	2	1076.4732	1076.4721	R	E	518	527
PSM	DTQLQQIVDK	1058	sp|P63098|CANB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0		ms_run[1]:scan=1.1.3709.2	31.0905	2	1186.6177	1186.6188	K	T	126	136
PSM	STGGDFGNPLRK	1059	sp|P20340|RAB6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.3776.2	32.78473	2	1369.6069	1369.6022	M	F	2	14
PSM	CNTPTYCDLGK	1060	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3756.5	32.2991	2	1449.5329	1449.5300	M	A	2	13
PSM	ILGSLDALPMEEEEEEDK	1061	sp|Q9BWT1|CDCA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3235.2	19.65325	4	2046.942894	2045.935083	R	Y	187	205
PSM	KQLSWLINR	1062	sp|Q8NHM5|KDM2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4948.2	52.5869	2	1237.634647	1236.638008	K	L	1139	1148
PSM	ARAHSIQIMK	1063	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=1.1.3139.2	18.17923	3	1249.601771	1249.600243	R	V	119	129
PSM	IPRPSVSQGCSR	1064	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3276.4	20.48203	3	1422.644171	1422.643899	R	E	519	531
PSM	RLSSLRASTSK	1065	sp|P62753|RS6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,4-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3394.2	23.2559	3	1444.593071	1444.587777	R	S	233	244
PSM	LLEELEEGQK	1066	sp|Q13404|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3709.2	31.0905	2	1186.618247	1186.608134	R	G	17	27
PSM	TGSAVPRELLEK	1067	sp|P52888|THOP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3744.3	31.98232	2	1378.684647	1378.685746	R	L	527	539
PSM	DATNVGDEGGFAPNILENK	1068	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4201.2	42.91927	3	1959.926771	1959.917400	K	E	203	222
PSM	LLTPTHSFLAR	1069	sp|Q14244|MAP7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.4234.2	43.50825	3	1414.642871	1414.641119	R	S	229	240
PSM	DNNLLGR	1070	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3386.2	23.05348	2	800.413847	800.414066	K	F	452	459
PSM	EGLELLK	1071	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3806.2	33.55455	2	800.463247	800.464370	K	T	222	229
PSM	LASSVLR	1072	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3691.2	30.63048	2	824.415247	824.415719	R	C	10	17
PSM	TFSYIK	1073	sp|Q12802|AKP13_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3771.2	32.65922	2	837.366447	837.367372	R	N	1748	1754
PSM	DYFLFR	1074	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4327.2	45.60221	2	859.424847	859.422839	K	D	87	93
PSM	SQSFALR	1075	sp|Q8WXE0|CSKI2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3549.2	27.04242	2	887.391447	887.390233	R	A	856	863
PSM	IRYESLTDPSKLDSGK	1076	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3627.2	28.99465	4	1807.936094	1807.931593	K	E	54	70
PSM	IATGSFLK	1077	sp|P22234|PUR6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3817.2	33.83753	2	915.446447	915.446685	R	R	103	111
PSM	EAFSLFDK	1078	sp|P27482|CALL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4058.2	39.73817	2	955.467047	955.465098	K	D	15	23
PSM	KLPEMDID	1079	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3749.2	32.10838	2	959.465647	959.463384	K	-	833	841
PSM	DDKHGSYEDAVHSGALND	1080	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3423.2	23.95877	4	1928.820094	1928.813663	K	-	539	557
PSM	ELPSFLGK	1081	sp|P26447|S10A4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4224.2	43.32427	2	969.458447	969.457250	R	R	41	49
PSM	DATLTALDR	1082	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3605.2	28.43193	2	974.506247	974.503275	K	G	391	400
PSM	DVDFELIK	1083	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4178.2	42.45427	2	977.509447	977.506963	R	V	203	211
PSM	SVPTWLK	1084	sp|P62277|RS13_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.4447.2	47.34608	2	989.405847	989.402452	R	L	21	28
PSM	SSPSARPPDVPGQQPQAAK	1085	sp|Q96JP5|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3377.2	22.84187	4	1996.945294	1996.936769	R	S	82	101
PSM	DVFQELEK	1086	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3985.3	37.99178	2	1006.498847	1006.497127	K	R	413	421
PSM	DLTDYLMK	1087	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:35	ms_run[1]:scan=1.1.3980.2	37.85038	2	1013.476247	1013.473949	R	I	186	194
PSM	DLSTIEPLK	1088	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3882.2	35.47405	2	1014.561847	1014.559727	K	K	102	111
PSM	GLTSVINQK	1089	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3802.2	33.45117	2	1038.510847	1038.511076	R	L	300	309
PSM	NCSSFLIK	1090	sp|P46779|RL28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=1.1.3823.3	33.99852	2	1047.445647	1047.446034	R	R	12	20
PSM	SGKYDLDFK	1091	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3539.3	26.78742	2	1071.526847	1071.523676	R	S	254	263
PSM	EIIDLVLDR	1092	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4626.2	49.00554	2	1084.614047	1084.612825	K	I	113	122
PSM	ASSQSAPSPDVGSGVQT	1093	sp|Q8N490-2|PNKD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3548.4	27.02328	3	1653.693371	1653.688325	R	-	126	143
PSM	SPSKPLPEVTDEYK	1094	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3684.2	30.45038	3	1668.767471	1668.764785	R	N	92	106
PSM	ERESLQQMAEVTR	1095	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=1.1.3295.5	20.89943	3	1671.731171	1671.728751	K	E	123	136
PSM	SADTLWGIQK	1096	sp|P00338|LDHA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3841.3	34.46068	2	1117.577647	1117.576774	K	E	319	329
PSM	GYSFTTTAER	1097	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3492.3	25.64127	2	1131.521647	1131.519653	R	E	197	207
PSM	QLSSGVSEIR	1098	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3591.4	28.08052	2	1154.536047	1154.533268	R	H	80	90
PSM	NNNTDLMILK	1099	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3851.3	34.72272	2	1174.600847	1174.601608	R	N	345	355
PSM	LDTGPQSLSGK	1100	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3345.5	22.05023	2	1181.533447	1181.532934	R	S	425	436
PSM	TSSLTQFPPSQSEER	1101	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3798.3	33.35147	3	1772.764571	1772.761825	R	S	124	139
PSM	NQYDNDVTVWSPQGR	1102	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3861.3	34.9597	3	1777.804871	1777.801976	R	I	4	19
PSM	NSSISGPFGSR	1103	sp|Q13610|PWP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3639.3	29.30995	2	1187.499447	1187.497217	R	S	483	494
PSM	SRESMIQLF	1104	sp|Q8N142|PURA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4506.2	47.98535	2	1189.523447	1189.520261	K	-	449	458
PSM	LNLNNTVLSK	1105	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3786.4	33.05102	2	1194.602447	1194.600954	R	R	426	436
PSM	DHAISLSEPR	1106	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3498.5	25.8025	2	1203.523447	1203.528517	R	M	795	805
PSM	GCTATLGNFAK	1107	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3710.3	31.11903	2	1218.510647	1218.510425	R	A	228	239
PSM	RLSEDYGVLK	1108	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3662.6	29.9047	2	1258.598447	1258.595869	R	T	110	120
PSM	DYETATLSEIK	1109	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3879.3	35.40728	2	1268.611247	1268.613613	K	A	421	432
PSM	SLGSAGPSGTLPR	1110	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3615.3	28.69308	2	1278.598447	1278.596931	R	S	332	345
PSM	RTSYEPFHPGPSPVDHDSLESK	1111	sp|O75376|NCOR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3664.2	29.94295	4	2561.136094	2561.122398	R	R	86	108
PSM	AQSREQLAALK	1112	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3396.2	23.30983	3	1293.646571	1293.644216	R	K	61	72
PSM	YSQVLANGLDNK	1113	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3587.3	27.97678	2	1320.670447	1320.667380	K	L	95	107
PSM	TLNMTTSPEEK	1114	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3414.5	23.75345	2	1329.554247	1329.552349	K	R	326	337
PSM	SQRYSGAYGASVSDEELK	1115	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3616.3	28.7175	3	2025.874571	2025.868081	K	R	46	64
PSM	SLSLQPQLTQR	1116	sp|P21731|TA2R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3854.2	34.79391	3	1349.673071	1349.670431	R	S	329	340
PSM	SKAELMEISEDK	1117	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3509.5	26.08762	3	1378.665971	1378.664997	K	T	75	87
PSM	SLSAIDRAGAEVK	1118	sp|O95831|AIFM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3695.2	30.73327	3	1395.679871	1395.675910	R	S	266	279
PSM	SSSSGHYVSWVK	1119	sp|P54578|UBP14_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3642.2	29.3804	3	1402.597571	1402.591846	R	R	430	442
PSM	ESVPEFPLSPPK	1120	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4307.2	45.13842	2	1405.657847	1405.653049	K	K	30	42
PSM	SDSGGSSSEPFDR	1121	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3364.4	22.5061	2	1406.501847	1406.498733	R	H	759	772
PSM	TLRLNQPGTPTR	1122	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3392.4	23.21173	3	1432.718771	1432.718778	K	T	386	398
PSM	DNPGVVTCLDEAR	1123	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3736.6	31.7861	2	1444.665847	1444.661643	K	H	227	240
PSM	EVDEQMLNVQNK	1124	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:35	ms_run[1]:scan=1.1.3351.4	22.17945	3	1461.681671	1461.676959	K	N	325	337
PSM	SATPEPVTDNRDVEDMELSDVEDDGSK	1125	sp|Q5VT52|RPRD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4049.3	39.51735	4	3029.246894	3029.233266	K	I	356	383
PSM	SLTNDWEDHLAVK	1126	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3923.2	36.50765	3	1526.739071	1526.736522	K	H	315	328
PSM	DNGIRPSSLEQMAK	1127	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3691.4	30.63715	3	1544.764871	1544.761691	K	L	278	292
PSM	LNSFIQVDAPDQK	1128	sp|P25054|APC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3981.2	37.87607	3	1553.716571	1553.712689	R	G	2722	2735
PSM	SQRYESLKGVDPK	1129	sp|P47914|RL29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3345.4	22.0469	3	1585.756271	1585.750138	R	F	26	39
PSM	SNSMVDVCSVDRR	1130	sp|Q9NVN8|GNL3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3516.2	26.25873	3	1603.653971	1603.648392	K	S	511	524
PSM	NSSLLSFDNEDENE	1131	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4170.2	42.25153	2	1611.661247	1611.653640	K	-	141	155
PSM	SSLGSLQTPEAVTTR	1132	sp|Q7Z2W4|ZCCHV_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3864.2	35.0333	2	1625.770447	1625.766182	R	K	386	401
PSM	GASWIDTADGSANHR	1133	sp|Q8NBJ7|SUMF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3686.3	30.50513	3	1636.670771	1636.663113	R	A	254	269
PSM	TYSLGSALRPSTSR	1134	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1.1.3940.3	36.9419	3	1654.716071	1654.711718	R	S	37	51
PSM	SQSRSNSPLPVPPSK	1135	sp|Q13247|SRSF6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3538.5	26.76795	3	1659.800771	1659.798150	R	A	297	312
PSM	SKSDATASISLSSNLK	1136	sp|Q9UBF8|PI4KB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3686.4	30.50847	3	1687.805471	1687.802961	R	R	275	291
PSM	QDENDDDDDWNPCK	1137	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3501.4	25.87688	3	1764.620771	1764.616937	K	A	333	347
PSM	TSSLTQFPPSQSEER	1138	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3901.4	35.97035	3	1772.764271	1772.761825	R	S	124	139
PSM	RTHSDASDDEAFTTSK	1139	sp|Q13017|RHG05_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3174.4	18.68732	3	1846.742471	1846.737066	R	T	1170	1186
PSM	KEESEESDDDMGFGLFD	1140	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4669.3	49.7238	2	1948.765647	1948.752033	K	-	98	115
PSM	GGNFGGRSSGPYGGGGQYFAK	1141	sp|Q32P51|RA1L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3693.5	30.69178	3	2099.893271	2099.885068	K	P	278	299
PSM	SSGGSEHSTEGSVSLGDGQLNR	1142	sp|Q71RC2|LARP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3485.3	25.462	3	2239.938971	2239.934263	R	Y	381	403
PSM	DYHFKVDNDENEHQLSLR	1143	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=1.1.3703.3	30.9424	4	2258.0436	2258.0347	K	T	28	46
PSM	NGRVEIIANDQGNR	1144	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3355.3	22.27983	3	1555.769171	1554.786266	K	I	47	61
PSM	DNLTLWTSENQGDEGDAGEGEN	1145	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4361.2	46.27514	3	2350.947971	2349.946922	R	-	225	247
PSM	SINQPVAFVR	1146	sp|Q9GZT3|SLIRP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4033.2	39.12048	2	1210.577047	1209.590724	R	R	15	25
PSM	AVADAIRTSLGPK	1147	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3623.3	28.89455	3	1377.705371	1377.701731	K	G	43	56
PSM	TSSLTQFPPSQSEER	1148	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3815.4	33.79263	3	1773.769271	1772.761825	R	S	124	139
PSM	TSSLTQFPPSQSEER	1149	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3840.3	34.43492	3	1773.778871	1772.761825	R	S	124	139
PSM	ADFDTYDDRAYSSFGGGR	1150	sp|Q15056|IF4H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=1.1.4325.2	45.55147	3	2120.8322	2120.8112	M	G	2	20
PSM	SFLFSSR	1151	sp|Q9H8S9|MOB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=1.1.5736.3	58.91973	2	964.4073	964.4050	M	S	2	9
PSM	NGVIQHTGAAAEEFNDDTD	1152	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3684.5	30.46038	3	2082.827471	2082.816773	R	-	646	665
PSM	NYGYRHNAEER	1153	sp|Q86UW8|HPLN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=1.1.3274.3	20.43878	3	1408.6302	1407.6272	R	Y	251	262
PSM	RLSESLHVVDENK	1154	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3564.3	27.43103	3	1604.756171	1604.755951	R	N	633	646
PSM	HRTETGTPWK	1155	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3209.2	19.17037	3	1291.577471	1291.571051	R	T	710	720
PSM	KPATSYVRTTINK	1156	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	21.05858	3	1557.796571	1557.791608	R	N	72	85
PSM	YLAEVAAGDDKK	1157	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3310.2	21.23028	3	1280.660771	1278.645582	R	G	128	140
PSM	NARATLSSIR	1158	sp|P46779|RL28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3369.2	22.62583	3	1167.575771	1167.576136	K	H	85	95
PSM	AYSLLR	1159	sp|Q8NAF0|ZN579_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3769.2	32.60755	2	801.378447	801.378606	R	H	453	459
PSM	DWYDVK	1160	sp|P61247|RS3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3736.2	31.77277	2	824.374247	824.370469	K	A	29	35
PSM	SVSFSLK	1161	sp|Q13416|ORC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3828.2	34.12113	2	846.388447	846.388836	K	N	120	127
PSM	TEWLDGK	1162	sp|Q9Y536|PAL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3517.2	26.28085	2	847.407047	847.407583	K	H	119	126
PSM	GLFIIDDK	1163	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.4103.2	40.71712	2	919.500447	919.501484	R	G	129	137
PSM	SFTSLYK	1164	sp|Q5SW79|CE170_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3809.2	33.63192	2	924.399447	924.399401	K	D	958	965
PSM	SLSVLSPR	1165	sp|P53814|SMTN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3795.2	33.27077	2	937.462647	937.463398	R	Q	299	307
PSM	SLSVLSPR	1166	sp|P53814|SMTN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3803.2	33.48017	2	937.462647	937.463398	R	Q	299	307
PSM	IIALDGDTK	1167	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3518.4	26.31363	2	944.519647	944.517862	R	N	335	344
PSM	SYTLVVAK	1168	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3734.2	31.72152	2	959.476247	959.472900	K	D	87	95
PSM	TNTFLEAP	1169	sp|Q9GZU8|PIP30_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.4139.2	41.5941	2	971.401247	971.400129	R	-	247	255
PSM	DLTDYLMK	1170	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.4282.2	44.61187	2	997.481047	997.479034	R	I	186	194
PSM	GLFDEYGSK	1171	sp|Q58FF3|ENPLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3809.4	33.63858	2	1014.465647	1014.465826	R	K	53	62
PSM	DGGFCEVCK	1172	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3369.3	22.62917	2	1070.425847	1070.416116	K	K	405	414
PSM	GGPISFSSSR	1173	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3663.2	29.91715	2	1073.458047	1073.454290	R	S	1931	1941
PSM	SSTVMYICHPESK	1174	sp|Q96DZ1|ERLEC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3563.2	27.40238	3	1617.663071	1617.656831	R	H	208	221
PSM	RSRPTSFADELAAR	1175	sp|Q641Q2|WAC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3657.3	29.76943	3	1655.780771	1655.778084	K	I	283	297
PSM	DGFVTVDELK	1176	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.4005.2	38.45424	2	1121.563047	1121.560455	K	D	85	95
PSM	DSLDQFDCK	1177	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3548.5	27.02662	2	1126.459847	1126.460089	K	L	1124	1133
PSM	GFSIPECQK	1178	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3756.3	32.29243	2	1144.465247	1144.462412	R	L	95	104
PSM	RMTGSEFDFEEMK	1179	sp|P50395|GDIB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:35,3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=1.1.3643.3	29.40953	3	1717.644671	1717.636490	K	R	423	436
PSM	FGLNVSSISR	1180	sp|P82979|SARNP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4060.3	39.7927	2	1158.546247	1158.543439	R	K	157	167
PSM	DRLGTVYEK	1181	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3346.4	22.07832	2	1159.527847	1159.527455	R	F	633	642
PSM	EITALAPSTMK	1182	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3670.5	30.10732	2	1160.615047	1160.611110	K	I	318	329
PSM	GGPGSTLSFVGK	1183	sp|Q9BQ61|TRIR_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3840.4	34.43825	2	1185.543647	1185.543105	K	R	107	119
PSM	QITVNDLPVGR	1184	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3837.4	34.36053	2	1210.671047	1210.666986	R	S	141	152
PSM	NESSFSASLGR	1185	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3617.4	28.74547	2	1233.507647	1233.502697	R	A	776	787
PSM	ERSDSGGSSSEPFDRHAPAMLR	1186	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3613.2	28.63817	4	2468.060894	2468.054001	R	E	757	779
PSM	RLGSLVDEFK	1187	sp|P12956|XRCC6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4128.2	41.31193	2	1242.603847	1242.600954	K	E	517	527
PSM	EVLDEDTDEEKETLK	1188	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3540.2	26.80972	3	1871.800871	1871.792516	K	N	990	1005
PSM	DLSPQHMVVR	1189	sp|P49590|SYHM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3655.2	29.71133	3	1260.571271	1260.568608	R	E	65	75
PSM	DAINQGMDEELERDEK	1190	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3679.5	30.33302	3	1890.833771	1890.826536	R	V	37	53
PSM	SLSQIHEAAVR	1191	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3542.2	26.86132	3	1289.618771	1289.612916	R	M	729	740
PSM	SSPNPFVGSPPK	1192	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3747.3	32.05972	2	1292.582447	1292.580219	K	G	393	405
PSM	DLLHPSPEEEK	1193	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3497.3	25.77018	3	1292.625971	1292.624846	K	R	6	17
PSM	AVLFCLSEDKK	1194	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3767.2	32.5554	3	1308.669971	1308.674774	K	N	35	46
PSM	RRSSSPFLSK	1195	sp|Q9NYV4|CDK12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	12.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3352.3	22.20465	3	1323.57547064349	1323.57376710095	R	R	330	340
PSM	RLDSDAVNTIESQSVSPDHNKEPK	1196	sp|Q9H3H1|MOD5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3800.3	33.40295	4	2745.274094	2745.260682	R	E	428	452
PSM	EFDGKSLVSVTK	1197	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3758.2	32.34038	3	1388.656271	1388.658863	K	E	300	312
PSM	KGSDALRPPVPQGEDEVPK	1198	sp|Q8N3D4|EH1L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3654.3	29.69213	3	2098.014071	2098.009600	R	A	308	327
PSM	GILAADESTGSIAK	1199	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3774.2	32.73615	2	1411.662247	1411.659591	K	R	29	43
PSM	RYPSSISSSPQK	1200	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3225.4	19.49462	3	1415.643671	1415.644610	R	D	601	613
PSM	RDSLTGSSDLYK	1201	sp|Q14671|PUM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3475.4	25.2309	2	1420.624047	1420.623540	R	R	707	719
PSM	YISPDQLADLYK	1202	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.4311.2	45.24148	2	1424.726247	1424.718747	R	S	270	282
PSM	SRLVNTSENLSK	1203	sp|Q9UEU0|VTI1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3325.2	21.58462	3	1426.682471	1426.681724	K	S	179	191
PSM	AHSNPMADHTLR	1204	sp|Q9UBP6|TRMB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3295.3	20.89277	3	1428.598871	1428.596948	R	Y	25	37
PSM	AMSTTSISSPQPGK	1205	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3449.4	24.58468	2	1470.648847	1470.642561	R	L	267	281
PSM	HEQNIDCGGGYVK	1206	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3255.2	20.029	3	1475.647871	1475.646327	K	L	99	112
PSM	LLTEIHGGAGGPSGR	1207	sp|Q16763|UBE2S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3706.2	31.0185	2	1500.710847	1500.708607	R	A	150	165
PSM	KGSITEYTAAEEK	1208	sp|Q12982|BNIP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3386.4	23.06015	3	1505.667671	1505.665071	R	E	112	125
PSM	SASASPLTPCSVTR	1209	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3642.4	29.38707	2	1512.666447	1512.664359	R	S	364	378
PSM	MLAESDESGDEESVSQTDKTELQNTLR	1210	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3961.3	37.3854	4	3091.334494	3091.317665	K	T	186	213
PSM	NASASFQELEDKK	1211	sp|Q99543|DNJC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3624.2	28.91702	3	1545.675671	1545.671219	R	E	45	58
PSM	RQSCYLCDLPR	1212	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,4-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.3790.2	33.14167	3	1546.648271	1546.642184	R	M	13	24
PSM	RLRLDTGPQSLSGK	1213	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3484.3	25.43662	3	1606.823471	1606.819220	K	S	422	436
PSM	SRSPESQVIGENTK	1214	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3356.4	22.30497	3	1610.732471	1610.730130	R	Q	305	319
PSM	QSKPVTTPEEIAQVATISANGDK	1215	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3902.6	36.00283	3	2463.198971	2463.189415	K	E	158	181
PSM	KQSGYGGQTKPIFR	1216	sp|P83881|RL36A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3392.6	23.2184	3	1645.803671	1645.797756	R	K	44	58
PSM	SSSFNTGRIEHLYK	1217	sp|O60547|GMDS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3720.3	31.37437	3	1717.791671	1717.782500	R	N	57	71
PSM	GLERNDSWGSFDLR	1218	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4141.2	41.64153	3	1730.745671	1730.741364	R	A	646	660
PSM	NQTAEKEEFEHQQK	1219	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3044.2	17.04298	4	1744.805694	1744.801642	K	E	584	598
PSM	HASSGSFLPSANEHLK	1220	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3607.4	28.49003	3	1760.794871	1760.788314	R	E	115	131
PSM	EGEDGDQPTTPPKPLK	1221	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3363.2	22.4877	3	1787.801771	1787.797876	K	T	174	190
PSM	LESTESRSSFSQHAR	1222	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3151.2	18.32532	4	1800.788894	1800.779206	K	T	421	436
PSM	RQAVTNPNNTFYATK	1223	sp|P38646|GRP75_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	5-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=1.1.3480.4	25.35545	3	1883.802671	1883.796844	K	R	107	122
PSM	HPSWRSEETQERER	1224	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3220.2	19.39605	4	1905.818494	1905.811903	R	S	404	418
PSM	TASETRSEGSEYEEIPK	1225	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3507.6	26.03918	3	1991.840771	1991.836112	R	R	1083	1100
PSM	SSPSARPPDVPGQQPQAAK	1226	sp|Q96JP5|ZFP91_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3373.4	22.73405	3	1996.940471	1996.936769	R	S	82	101
PSM	RGQTCVVHYTGMLEDGK	1227	sp|P62942|FKB1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3746.6	32.04387	3	2029.882871	2029.875097	K	K	19	36
PSM	RKTSDFNTFLAQEGCTK	1228	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=1.1.3767.4	32.56207	4	2081.930494	2081.924156	R	G	197	214
PSM	RFSQGPTPAAAVPEGTAAEGAPR	1229	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3692.3	30.66282	3	2317.095371	2317.085224	R	Q	234	257
PSM	DAELQDQEFGKRDSLGTYSSR	1230	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3711.2	31.14082	4	2481.089694	2481.080927	R	D	859	880
PSM	LGADESEEEGRRGSLSNAGDPEIVK	1231	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3567.3	27.49783	3	2694.224771	2694.213398	R	S	81	106
PSM	SGTPPRQGSITSPQANEQSVTPQRR	1232	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3372.3	22.71517	4	2758.322894	2758.314784	K	S	846	871
PSM	SQTTTERDSDTDVEEEELPVENR	1233	sp|Q14676|MDC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3693.6	30.69512	3	2758.159871	2758.145437	R	E	445	468
PSM	AASESTEQEEGDAPQEDFIQYIAR	1234	sp|Q8N350|CBARP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.5164.2	54.24467	3	2763.173471	2763.154880	R	A	339	363
PSM	LRTSTSDLSRGEIGDPQTENPSTR	1235	sp|Q5T5U3|RHG21_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21,4-UNIMOD:21	ms_run[1]:scan=1.1.3568.4	27.51645	4	2776.217694	2776.206612	R	E	1858	1882
PSM	RLSESSALKQPATPTAAESSEGEGEEGDDGGETESR	1236	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3550.4	27.08117	4	3743.609694	3743.591925	R	E	73	109
PSM	DANNGNLQLR	1237	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0		ms_run[1]:scan=1.1.3687.3	30.54083	2	1113.5382	1113.5522	K	N	288	298
PSM	ASGVAVSDGVIK	1238	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4036.2	39.1933	2	1223.5820	1223.5794	M	V	2	14
PSM	DNLTLWTSDQQDDDGGEGNN	1239	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.4355.2	46.13892	3	2193.874871	2192.873028	R	-	228	248
PSM	GVSLTNHHFYDESK	1240	sp|P14314|GLU2B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3628.3	29.02363	3	1713.708371	1712.719566	R	P	22	36
PSM	HSGSDRSSFSHYSGLKHEDK	1241	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3257.2	20.08897	4	2340.001294	2339.992052	R	R	196	216
PSM	SSFSHYSGLK	1242	sp|Q8NC51|PAIRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3490.5	25.59955	2	1191.498447	1191.496155	R	H	202	212
PSM	CSSMSSLSR	1243	sp|O15027|SC16A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.3750.2	32.13415	2	1076.3680	1076.3663	R	E	2293	2302
PSM	NVFSSSGTSFSGR	1244	sp|P49790|NU153_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3759.3	32.373	2	1411.583047	1411.576924	K	K	1453	1466
PSM	TFNPGAGLPTDK	1245	sp|P09661|RU2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3826.3	34.07602	2	1296.576647	1296.575133	K	K	180	192
PSM	TSSLTQFPPSQSEER	1246	sp|Q9H6Z4|RANB3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3733.4	31.70258	3	1773.780971	1772.761825	R	S	124	139
PSM	CSSILLHGK	1247	sp|P05023|AT1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=1.1.4227.2	43.38987	2	1076.4732	1076.4721	R	E	518	527
PSM	MSGFIYQGK	1248	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3617.2	28.7388	2	1125.459247	1125.456598	R	I	487	496
PSM	DYQDNKADVILK	1249	sp|P47813|IF1AX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0		ms_run[1]:scan=1.1.3537.6	26.74558	3	1420.725971	1420.719809	R	Y	83	95
PSM	EFVKSMK	1250	sp|P42331|RHG25_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.4183.2	42.59062	2	963.4115	963.4131	K	E	633	640
PSM	ILGSLDALPMEEEEEEDK	1251	sp|Q9BWT1|CDCA7_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3228.2	19.57383	4	2063.9432	2061.9292	R	Y	187	205
PSM	TCTTVAFTQVNSEDK	1252	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	1-UNIMOD:21,2-UNIMOD:4	ms_run[1]:scan=1.1.3741.3	31.90518	3	1779.7492	1779.7382	K	G	198	213
PSM	ALGSLGLCENQEARER	1253	sp|Q9H7X3|ZN696_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=1.1.3206.2	19.14395	4	1881.876894	1881.840426	R	P	67	83
PSM	STPSHGSVSSLNSTGSLSPK	1254	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3445.4	24.48295	3	2008.912571	2008.910280	R	H	238	258
PSM	KEEEATEWQHKAFAAQEDLEK	1255	sp|P35241|RADI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	12.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2911.2	16.16952	5	2597.1142	2596.1482	K	T	438	459
PSM	VALRNDSYTLHK	1256	sp|P62195|PRS8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3383.3	22.9848	3	1495.720571	1495.718444	R	I	114	126
PSM	SRSFDYNYRR	1257	sp|O75494|SRS10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3346.2	22.06498	3	1442.610071	1442.609227	R	S	131	141
PSM	RLSELLR	1258	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	12.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3805.3	33.5321	2	965.508247	965.505931	R	Y	450	457