MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000151 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617205149466520^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_11_K4_2.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null	147-UNIMOD:21,162-UNIMOD:21	0.10	50.0	4	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	337-UNIMOD:4,339-UNIMOD:4,27-UNIMOD:21,357-UNIMOD:4	0.18	44.0	7	6	5
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.10	42.0	8	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	237-UNIMOD:4	0.18	42.0	5	2	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	215-UNIMOD:35	0.04	42.0	2	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null		0.06	41.0	2	2	2
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	null	102-UNIMOD:21,218-UNIMOD:35	0.26	41.0	4	2	0
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.23	40.0	2	2	2
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	641-UNIMOD:21	0.02	39.0	2	1	0
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null	145-UNIMOD:21,136-UNIMOD:21	0.10	39.0	11	3	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	426-UNIMOD:21	0.04	38.0	4	1	0
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.14	38.0	12	2	1
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	24-UNIMOD:4	0.26	38.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	235-UNIMOD:35	0.24	37.0	11	5	3
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	138-UNIMOD:35	0.09	37.0	4	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.15	36.0	17	2	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	273-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	671-UNIMOD:21,675-UNIMOD:21	0.04	35.0	3	1	0
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	34.0	3	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	64-UNIMOD:21	0.04	34.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	89-UNIMOD:21,101-UNIMOD:4,98-UNIMOD:21,99-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.12	33.0	3	3	3
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.18	33.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null		0.12	33.0	3	3	3
PRT	sp|Q92882|OSTF1_HUMAN	Osteoclast-stimulating factor 1 OS=Homo sapiens OX=9606 GN=OSTF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	213-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	153-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	310-UNIMOD:21,308-UNIMOD:21	0.04	32.0	3	2	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	101-UNIMOD:21,104-UNIMOD:21,108-UNIMOD:35	0.16	32.0	2	1	0
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.14	32.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	3	2	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.20	31.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	63-UNIMOD:21	0.10	31.0	2	1	0
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.13	31.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1	0.18	31.0	3	2	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null		0.05	30.0	6	3	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	99-UNIMOD:21,101-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	114-UNIMOD:21,123-UNIMOD:4	0.07	30.0	7	2	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	38-UNIMOD:4	0.16	30.0	3	2	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	5	4	3
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	417-UNIMOD:4,420-UNIMOD:4	0.06	29.0	2	2	2
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	663-UNIMOD:21	0.03	29.0	3	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.08	29.0	5	1	0
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	654-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	447-UNIMOD:4,70-UNIMOD:21	0.12	28.0	5	4	3
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	2	2	2
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	2	2	2
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	186-UNIMOD:4	0.04	28.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	105-UNIMOD:4	0.07	28.0	2	2	2
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.12	28.0	2	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	23-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	28.0	4	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.13	28.0	6	4	2
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	2-UNIMOD:1,17-UNIMOD:4	0.08	28.0	3	2	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	161-UNIMOD:4	0.13	27.0	3	2	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.09	27.0	3	3	3
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	490-UNIMOD:35,494-UNIMOD:35	0.04	27.0	3	2	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	112-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	104-UNIMOD:21,232-UNIMOD:4	0.10	27.0	5	3	2
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	27-UNIMOD:21,26-UNIMOD:21	0.07	27.0	2	2	2
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	57-UNIMOD:21	0.12	27.0	5	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	190-UNIMOD:21,193-UNIMOD:21,198-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	363-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,3-UNIMOD:21,139-UNIMOD:4	0.23	27.0	5	3	2
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	549-UNIMOD:35,87-UNIMOD:35	0.11	26.0	6	5	4
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	335-UNIMOD:4	0.06	26.0	3	2	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	163-UNIMOD:4	0.05	26.0	2	2	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	152-UNIMOD:4,37-UNIMOD:21	0.05	26.0	2	2	2
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	173-UNIMOD:4,181-UNIMOD:21,194-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	335-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	3	2	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1043-UNIMOD:21,1003-UNIMOD:21,2100-UNIMOD:21,2104-UNIMOD:21	0.02	26.0	4	3	2
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	227-UNIMOD:21	0.05	26.0	4	1	0
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	576-UNIMOD:4,584-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	2928-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	2	2	2
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.18	25.0	1	1	1
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	46-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	136-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|O95466|FMNL1_HUMAN	Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	1031-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.20	25.0	5	4	3
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	3	2	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62304|RUXE_HUMAN	Small nuclear ribonucleoprotein E OS=Homo sapiens OX=9606 GN=SNRPE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.14	24.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	2	1	0
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	38-UNIMOD:21	0.23	24.0	4	3	2
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	4521-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	290-UNIMOD:4	0.10	24.0	5	3	2
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|P29803|ODPAT_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	291-UNIMOD:21,292-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	317-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	153-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	473-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	256-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.10	23.0	2	2	2
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	2889-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.10	23.0	3	3	3
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	652-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	474-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	628-UNIMOD:35	0.10	23.0	6	6	6
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	934-UNIMOD:4,936-UNIMOD:4	0.02	23.0	2	2	2
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	52-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.21	23.0	2	2	2
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	996-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	412-UNIMOD:4	0.07	23.0	3	3	3
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	714-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	260-UNIMOD:4,272-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q8N7H5|PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|P07741|APT_HUMAN	Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.07	23.0	1	1	1
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	207-UNIMOD:21,212-UNIMOD:4	0.01	22.0	2	2	2
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	11-UNIMOD:21	0.14	22.0	2	1	0
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	3	2	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	234-UNIMOD:4	0.03	22.0	2	2	2
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	2	2	2
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1877-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	43-UNIMOD:21,42-UNIMOD:21	0.06	22.0	2	1	0
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	43-UNIMOD:21,44-UNIMOD:4	0.06	22.0	2	1	0
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	501-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.19	22.0	1	1	1
PRT	sp|Q9Y6E2|BZW2_HUMAN	Basic leucine zipper and W2 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BZW2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	414-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	153-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	617-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	349-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	192-UNIMOD:35	0.13	21.0	6	4	2
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	61-UNIMOD:4	0.19	21.0	2	2	2
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	14-UNIMOD:21,15-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	225-UNIMOD:4	0.05	21.0	2	2	2
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	195-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.17	21.0	2	2	2
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	2	2	2
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	530-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	165-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	2	1	0
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	21.0	4	2	0
PRT	sp|Q99614|TTC1_HUMAN	Tetratricopeptide repeat protein 1 OS=Homo sapiens OX=9606 GN=TTC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	190-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O00469|PLOD2_HUMAN	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 OS=Homo sapiens OX=9606 GN=PLOD2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	202-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	186-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	199-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	819-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P60900|PSA6_HUMAN	Proteasome subunit alpha type-6 OS=Homo sapiens OX=9606 GN=PSMA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	47-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	2	2
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	17-UNIMOD:21	0.21	19.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1915-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	332-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	609-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	206-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	2	1	0
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1	0.34	19.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,7-UNIMOD:35	0.34	19.0	2	1	0
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	426-UNIMOD:35,441-UNIMOD:21	0.05	19.0	1	1	1
PRT	sp|Q5THK1|PR14L_HUMAN	Protein PRR14L OS=Homo sapiens OX=9606 GN=PRR14L PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1027-UNIMOD:4,1029-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	99-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	41-UNIMOD:4	0.02	18.0	2	2	2
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1131-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	3	2	1
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	434-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	398-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P62633-4|CNBP_HUMAN	Isoform 4 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	67-UNIMOD:4,75-UNIMOD:4,78-UNIMOD:4	0.09	18.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9Y2H0|DLGP4_HUMAN	Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	915-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	365-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	337-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	521-UNIMOD:21,280-UNIMOD:21	0.03	18.0	2	2	2
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	115-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q8NCL4|GALT6_HUMAN	Polypeptide N-acetylgalactosaminyltransferase 6 OS=Homo sapiens OX=9606 GN=GALNT6 PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	509-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	85-UNIMOD:35,95-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	895-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q00653|NFKB2_HUMAN	Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	703-UNIMOD:4,711-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.15	18.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	80-UNIMOD:28,82-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9Y536|PAL4A_HUMAN	Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1338-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	487-UNIMOD:35,488-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q03393|PTPS_HUMAN	6-pyruvoyl tetrahydrobiopterin synthase OS=Homo sapiens OX=9606 GN=PTS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	19-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	177-UNIMOD:21	0.00	17.0	1	1	1
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q96BD0|SO4A1_HUMAN	Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	40-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	109-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	343-UNIMOD:35	0.04	17.0	1	1	1
PRT	sp|Q9NYV6|RRN3_HUMAN	RNA polymerase I-specific transcription initiation factor RRN3 OS=Homo sapiens OX=9606 GN=RRN3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	172-UNIMOD:21,186-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	460-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	91-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|P28074|PSB5_HUMAN	Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P84077|ARF1_HUMAN	ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	99-UNIMOD:4,104-UNIMOD:4	0.04	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	1	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3270.2	42.06587	4	2988.161294	2988.155727	K	E	144	170
PSM	DATNVGDEGGFAPNILENK	2	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3395.2	44.51233	3	1959.919871	1959.917400	K	E	203	222
PSM	DNLTLWTSDTQGDEAEAGEGGEN	3	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.3575.2	48.12473	3	2407.989371	2407.988786	R	-	223	246
PSM	DNLTLWTSDSAGEECDAAEGAEN	4	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3648.2	49.0482	3	2453.972471	2453.976507	R	-	223	246
PSM	KMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGK	5	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	2-UNIMOD:35	ms_run[1]:scan=1.1.2607.2	27.36813	4	3959.424494	3959.357399	K	Q	214	249
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	6	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.2631.4	27.9494	4	3365.454894	3365.451593	K	K	799	833
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	7	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3359.2	43.84893	4	3393.345294	3393.345713	K	F	86	114
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	8	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3296.2	42.6704	5	3932.716618	3932.709658	K	T	6	40
PSM	TPEELDDSDFETEDFDVR	9	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	49.78243	3	2237.850071	2237.852550	R	S	634	652
PSM	NGSLDSPGKQDTEEDEEEDEK	10	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2314.2	20.68203	3	2429.928671	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	11	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2265.2	19.72602	4	2673.052494	2673.045055	K	G	134	157
PSM	VPSPLEGSEGDGDTD	12	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2856.3	33.12702	2	1553.574647	1553.577043	K	-	413	428
PSM	TPEELDDSDFETEDFDVR	13	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3697.3	49.57597	3	2237.850071	2237.852550	R	S	634	652
PSM	DNLTLWTSENQGDEGDAGEGEN	14	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3536.2	47.3221	3	2349.938771	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	15	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3500.4	46.44432	3	2349.944771	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	16	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3585.2	48.33288	3	2407.989371	2407.988786	R	-	223	246
PSM	NADMSEEMQQDSVECATQALEK	17	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3442.2	45.38225	3	2513.037971	2513.035619	K	Y	10	32
PSM	VPSPLEGSEGDGDTD	18	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2846.5	32.92783	2	1553.574647	1553.577043	K	-	413	428
PSM	DNLTLWTSDMQGDGEEQNK	19	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3175.2	40.0763	3	2195.929871	2195.927707	R	E	226	245
PSM	DNLTLWTSENQGDEGDAGEGEN	20	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3518.2	46.88173	3	2349.944771	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	21	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3294.2	42.62955	3	2427.864071	2427.865619	K	K	129	151
PSM	DNLTLWTSDMQGDGEEQNK	22	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3476.2	45.95618	3	2179.932071	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	23	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3505.2	46.55795	3	2192.873471	2192.873028	R	-	228	248
PSM	TVGTPIASVPGSTNTGTVPGSEK	24	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2890.4	33.9376	3	2236.065971	2236.062423	R	D	270	293
PSM	DNLTLWTSDTQGDEAEAGEGGEN	25	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3621.2	48.75423	3	2407.989371	2407.988786	R	-	223	246
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	26	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3274.5	42.16891	3	2988.155471	2988.155727	K	E	144	170
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	27	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3368.4	44.04267	3	3014.186171	3014.188484	K	-	661	690
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	28	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2287.3	20.20323	4	3178.172494	3178.161241	R	K	494	522
PSM	PCSEETPAISPSK	29	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2402.4	22.53538	2	1481.6103	1481.6104	M	R	2	15
PSM	PCSEETPAISPSK	30	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2411.3	22.73555	2	1481.6103	1481.6104	M	R	2	15
PSM	STIGVMVTASHNPEEDNGVK	31	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2858.2	33.1657	3	2163.950471	2163.950764	K	L	55	75
PSM	DNLTLWTSDMQGDGEEQNK	32	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3487.3	46.16903	3	2179.932071	2179.932792	R	E	226	245
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	33	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	9-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2282.2	20.07747	5	3423.328618	3423.317893	R	A	81	114
PSM	LIAPVAEEEATVPNNK	34	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.2860.2	33.20265	3	1693.889471	1693.888666	K	I	8	24
PSM	DNLTLWTSDQQDDDGGEGNN	35	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3532.2	47.2116	3	2192.869271	2192.873028	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	36	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3640.2	48.95648	3	2407.989371	2407.988786	R	-	223	246
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	37	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3358.2	43.82238	3	3014.186171	3014.188484	K	-	661	690
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	38	sp|Q9NRF9|DPOE3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.2934.2	34.95808	4	3223.228494	3223.230486	K	-	122	148
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	39	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3724.2	49.91498	4	3756.436494	3756.438824	K	A	469	503
PSM	VPSPLEGSEGDGDTD	40	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2865.3	33.33047	2	1553.574647	1553.577043	K	-	413	428
PSM	TLSNAEDYLDDEDSD	41	sp|Q92882|OSTF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3350.2	43.65612	2	1780.614647	1780.620031	R	-	200	215
PSM	YADLTEDQLPSCESLK	42	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4	ms_run[1]:scan=1.1.3101.2	38.72158	3	1867.847171	1867.850960	R	D	142	158
PSM	SGPKPFSAPKPQTSPSPK	43	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2425.2	23.05883	4	1916.940494	1916.939729	R	R	295	313
PSM	DATNVGDEGGFAPNILENK	44	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3382.2	44.30773	3	1959.919871	1959.917400	K	E	203	222
PSM	KEESEESDDDMGFGLFD	45	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:21,7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=1.1.4564.2	58.22632	3	2124.679571	2124.679610	K	-	98	115
PSM	DNLTLWTSDQQDDDGGEGNN	46	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3541.2	47.44456	3	2192.869271	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	47	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3514.2	46.77232	3	2192.873471	2192.873028	R	-	228	248
PSM	DSGSDEDFLMEDDDDSDYGSSK	48	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3285.2	42.41645	3	2427.864071	2427.865619	K	K	129	151
PSM	NGSLDSPGKQDTEEDEEEDEK	49	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2304.2	20.46655	3	2429.928671	2429.923149	K	D	134	155
PSM	SDAAVDTSSEITTK	50	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=1.1.2697.2	29.52518	2	1465.6782	1465.6779	M	D	2	16
PSM	LAVDEEENADNNTK	51	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2340.2	21.21238	2	1560.691447	1560.690360	K	A	40	54
PSM	DAGDKDKEQELSEEDK	52	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2190.2	18.6853	3	1834.805771	1834.806846	R	Q	35	51
PSM	DLEAEHVEVEDTTLNR	53	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2895.2	34.0528	3	1868.879771	1868.875201	R	C	15	31
PSM	SLDSDESEDEEDDYQQK	54	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2462.3	23.97535	3	2030.775071	2030.771249	K	R	57	74
PSM	DNLTLWTSDQQDDDGGEGNN	55	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3562.2	47.8681	3	2192.869871	2192.873028	R	-	228	248
PSM	NGSLDSPGKQDTEEDEEEDEKDK	56	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2251.2	19.52413	4	2673.052494	2673.045055	K	G	134	157
PSM	AQGPAASAEEPKPVEAPAANSDQTVTVKE	57	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2636.2	28.07653	4	2891.414894	2891.414861	K	-	199	228
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	58	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3550.2	47.59857	4	3456.438094	3456.442334	R	-	207	238
PSM	ADQLTEEQIAEFK	59	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3580.2	48.23985	2	1562.7459	1562.7459	M	E	2	15
PSM	EALQDVEDENQ	60	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2620.2	27.65527	2	1288.542047	1288.541905	K	-	245	256
PSM	NGRVEIIANDQGNR	61	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2405.2	22.6099	3	1554.789371	1554.786266	K	I	47	61
PSM	RVSVCAETYNPDEEEEDTDPR	62	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.2762.2	30.97987	3	2590.022171	2590.016672	R	V	97	118
PSM	HVPDSGATATAYLCGVK	63	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2976.3	35.99809	3	1825.809671	1825.807001	K	G	110	127
PSM	DNLTLWTSDQQDDDGGEGNN	64	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3552.2	47.63992	3	2192.869871	2192.873028	R	-	228	248
PSM	DNLTLWTADNAGEEGGEAPQEPQS	65	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3585.3	48.34288	3	2528.091071	2528.093920	R	-	225	249
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	66	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2502.3	24.85662	5	3566.442618	3565.448950	K	D	124	155
PSM	DSAQNSVIIVDK	67	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2659.3	28.64472	2	1287.663847	1287.667045	K	N	194	206
PSM	GVVDSDDLPLNVSR	68	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3129.2	39.24353	2	1484.740647	1484.747087	K	E	435	449
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	69	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3349.3	43.63038	4	3393.345294	3393.345713	K	F	86	114
PSM	DCEECIQLEPTFIK	70	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.3515.2	46.80957	3	1780.798871	1780.801173	K	G	416	430
PSM	GDRSEDFGVNEDLADSDAR	71	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2865.2	33.3238	3	2066.880671	2066.877720	K	A	186	205
PSM	NGVIQHTGAAAEEFNDDTD	72	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2822.3	32.3283	3	2082.812171	2082.816773	R	-	646	665
PSM	DNLTLWTSDQQDEEAGEGN	73	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3531.2	47.18723	3	2120.875871	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	74	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3523.2	46.98983	3	2192.869271	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	75	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3708.2	49.75102	3	2192.869871	2192.873028	R	-	228	248
PSM	DSALQDTDDSDDDPVLIPGAR	76	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3495.2	46.31743	3	2293.957571	2293.958746	R	Y	648	669
PSM	DNLTLWTSDSAGEECDAAEGAEN	77	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3667.2	49.25077	3	2453.972471	2453.976507	R	-	223	246
PSM	NAGVEGSLIVEK	78	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.2723.3	30.10868	2	1214.652847	1214.650667	K	I	482	494
PSM	VAEDEAEAAAAAK	79	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.2358.3	21.62272	2	1244.592047	1244.588461	K	F	148	161
PSM	GILAADESTGSIAK	80	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.2722.3	30.09033	2	1331.695047	1331.693260	K	R	29	43
PSM	DSVFLSCSEDNR	81	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2815.2	32.15633	2	1427.596047	1427.598708	K	I	180	192
PSM	DNLTLWTSDQQDDDGGEGNN	82	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3694.2	49.52543	3	2192.869871	2192.873028	R	-	228	248
PSM	HEQNIDCGGGYVK	83	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2344.2	21.32375	2	1475.648247	1475.646327	K	L	99	112
PSM	KHHEEEIVHHKK	84	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.2141.2	18.12098	4	1549.818894	1549.811359	K	E	72	84
PSM	NSFREQLEEEEEAK	85	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.2797.2	31.73608	3	1736.787071	1736.785323	K	H	1339	1353
PSM	DASDDLDDLNFFNQK	86	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4247.2	55.35198	3	1755.754271	1755.758774	K	K	65	80
PSM	LGAGGGSPEKSPSAQELK	87	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2416.3	22.86003	3	1791.843671	1791.840409	R	E	13	31
PSM	HVPDSGATATAYLCGVK	88	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2968.2	35.78823	3	1825.809671	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	89	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3321.2	43.13138	3	1830.821471	1830.822317	R	A	107	124
PSM	SLDSDESEDEEDDYQQK	90	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2508.3	24.97173	3	2110.740071	2110.737580	K	R	57	74
PSM	DYEEVGVDSVEGEGEEEGEEY	91	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3429.2	45.14174	3	2347.896071	2347.897571	K	-	431	452
PSM	DNLTLWTSDTQGDEAEAGEGGEN	92	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3602.2	48.54213	3	2407.989371	2407.988786	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	93	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3565.2	47.92523	3	2407.989371	2407.988786	R	-	223	246
PSM	DDDIAALVVDNGSGMCK	94	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4249.2	55.4033	2	1820.7859	1820.7915	M	A	2	19
PSM	SADTLWDIQK	95	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3103.2	38.75445	2	1175.580647	1175.582253	K	D	320	330
PSM	KITIADCGQLE	96	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2777.3	31.28565	2	1246.621847	1246.622738	K	-	155	166
PSM	DGNGYISAAELR	97	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2943.3	35.1789	2	1264.603647	1264.604780	K	H	96	108
PSM	EAMEDGEIDGNK	98	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2372.4	21.86658	2	1306.539047	1306.534711	K	V	628	640
PSM	EGLELPEDEEEK	99	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2837.4	32.71283	2	1415.628447	1415.630385	K	K	412	424
PSM	PCSEETPAISPSK	100	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2390.2	22.3244	2	1481.6103	1481.6104	M	R	2	15
PSM	RNSLTGEEGQLAR	101	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2534.2	25.62413	3	1509.695171	1509.693685	R	V	110	123
PSM	LTFDSSFSPNTGKK	102	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2929.2	34.82493	3	1607.723171	1607.723254	K	N	97	111
PSM	NSSLLSFDNEDENE	103	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3392.2	44.48732	2	1611.650047	1611.653640	K	-	141	155
PSM	ESLKEEDESDDDNM	104	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2414.2	22.8095	2	1654.614447	1654.615206	K	-	242	256
PSM	HIAEEADRKYEEVAR	105	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2456.2	23.80817	4	1814.894494	1814.891125	K	K	154	169
PSM	HVPDSGATATAYLCGVK	106	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2986.2	36.2006	3	1825.809671	1825.807001	K	G	110	127
PSM	GEAAAERPGEAAVASSPSK	107	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2254.2	19.57992	3	1863.841571	1863.836387	K	A	12	31
PSM	DNLTLWTSDMQGDGEEQNK	108	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3499.3	46.41698	3	2179.929071	2179.932792	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	109	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3167.2	39.86907	3	2195.929871	2195.927707	R	E	226	245
PSM	DSGSDEDFLMEDDDDSDYGSSK	110	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3068.4	38.1208	3	2443.857971	2443.860534	K	K	129	151
PSM	IVRGDQPAASGDSDDDEPPPLPR	111	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2730.4	30.2924	4	2483.101694	2483.096577	K	L	45	68
PSM	MLAESDESGDEESVSQTDKTELQNTLR	112	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3322.4	43.16587	4	3171.284494	3171.283996	K	T	186	213
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	113	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	27-UNIMOD:21	ms_run[1]:scan=1.1.2396.2	22.43953	4	3173.332894	3173.326984	K	E	337	367
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	114	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:35	ms_run[1]:scan=1.1.3338.3	43.40479	4	3472.432494	3472.437249	R	-	207	238
PSM	ASGVAVSDGVIK	115	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1	ms_run[1]:scan=1.1.2943.2	35.1689	2	1143.6117	1143.6130	M	V	2	14
PSM	KQEEFDVANNGSSQANK	116	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2377.2	21.99352	3	1865.845271	1864.855134	R	L	152	169
PSM	DAGTIAGLNVLR	117	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3351.2	43.6818	2	1198.664447	1198.666986	K	I	160	172
PSM	TNQELQEINR	118	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2467.2	24.102	2	1243.617847	1243.615679	R	V	136	146
PSM	VIGSGCNLDSAR	119	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2449.2	23.65057	2	1247.594247	1247.592835	R	F	158	170
PSM	CDENILWLDYK	120	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3702.2	49.67105	2	1467.667847	1467.670417	K	N	152	163
PSM	NIIHGSDSVESAEK	121	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2385.2	22.1876	3	1484.715971	1484.710701	R	E	115	129
PSM	YYLAPKIEDEEGS	122	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2924.3	34.70638	2	1512.696247	1512.698405	K	-	249	262
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	123	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,9-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.2907.2	34.31578	4	3213.342894	3213.342046	K	F	173	200
PSM	CIPALDSLTPANEDQK	124	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3206.2	40.81407	3	1770.845471	1770.845815	R	I	447	463
PSM	AASPPASASDLIEQQQK	125	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2927.2	34.78357	3	1819.834271	1819.835324	R	R	333	350
PSM	HVPDSGATATAYLCGVK	126	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.2994.4	36.41727	3	1825.809671	1825.807001	K	G	110	127
PSM	DKGDEEEEGEEKLEEK	127	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2387.2	22.2351	4	1891.820494	1891.817077	K	Q	536	552
PSM	SSTPPGESYFGVSSLQLK	128	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3864.2	51.4895	3	1962.897971	1962.897590	K	G	1041	1059
PSM	STTPPPAEPVSLPQEPPKPR	129	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2845.2	32.90577	4	2204.087694	2204.087850	K	V	225	245
PSM	STTPPPAEPVSLPQEPPKPR	130	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2832.5	32.59128	3	2204.085071	2204.087850	K	V	225	245
PSM	DNLTLWTSENQGDEGDAGEGEN	131	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3527.4	47.10165	3	2349.944771	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	132	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3656.2	49.1576	3	2407.984271	2407.988786	R	-	223	246
PSM	DNLTLWTADNAGEEGGEAPQEPQS	133	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3602.3	48.55213	3	2528.091071	2528.093920	R	-	225	249
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	134	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.2796.2	31.71072	3	2650.998971	2651.000036	K	M	572	596
PSM	IRAEEEDLAAVPFLASDNEEEEDEK	135	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3698.3	49.60805	3	2927.261171	2927.259739	R	G	2913	2938
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	136	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	19-UNIMOD:21	ms_run[1]:scan=1.1.3251.3	41.74575	3	2988.157571	2988.155727	K	E	144	170
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	137	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2912.5	34.4344	4	3242.267694	3242.265475	K	D	929	958
PSM	QVPDSAATATAYLCGVK	138	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3335.3	43.34792	3	1831.826771	1830.822317	R	A	107	124
PSM	QVPDSAATATAYLCGVK	139	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3346.2	43.55307	3	1831.826771	1830.822317	R	A	107	124
PSM	GAVEKGEELSCEER	140	sp|P31947|1433S_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4	ms_run[1]:scan=1.1.2400.2	22.4849	3	1591.721771	1591.714801	K	N	28	42
PSM	TAAKGEAAAERPGEAAVASSPSK	141	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	19-UNIMOD:21	ms_run[1]:scan=1.1.2215.2	19.05037	4	2235.058494	2235.053256	K	A	8	31
PSM	TSRPENAIIYNNNEDFQVGQAK	142	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2915.2	34.49798	4	2507.205694	2507.204080	R	V	472	494
PSM	ELISNASDALDK	143	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2809.3	31.99765	2	1274.635447	1274.635411	R	I	103	115
PSM	ELISNASDALDK	144	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2817.2	32.207	2	1274.635447	1274.635411	R	I	103	115
PSM	LKDDEVAQLKK	145	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2324.2	20.91642	3	1285.725371	1285.724166	K	S	309	320
PSM	DSVFLSCSEDNR	146	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2807.2	31.95287	2	1427.596047	1427.598708	K	I	180	192
PSM	DRVHHEPQLSDK	147	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2088.2	17.62537	3	1459.720871	1459.716790	K	V	26	38
PSM	VPSPLEGSEGDGDTD	148	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2874.2	33.53507	2	1553.574647	1553.577043	K	-	413	428
PSM	DHASIQMNVAEVDK	149	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2729.3	30.25695	3	1555.733771	1555.730056	K	V	28	42
PSM	NLDIERPTYTNLNR	150	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2875.2	33.5606	3	1717.877771	1717.874747	R	L	216	230
PSM	SQSLPNSLDYTQTSDPGR	151	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2993.2	36.37817	3	2044.874471	2044.873894	R	H	44	62
PSM	DKSPVREPIDNLTPEER	152	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2772.2	31.14913	3	2073.973271	2073.973214	K	D	134	151
PSM	DNLTLWTSDQQDDDGGEGNN	153	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3619.2	48.70412	3	2192.868971	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	154	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3653.3	49.11723	3	2192.869571	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	155	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3636.2	48.91102	3	2192.869571	2192.873028	R	-	228	248
PSM	QFYDQALQQAVVDDDANNAK	156	sp|P60033|CD81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3340.2	43.45627	3	2252.034071	2252.034555	K	A	125	145
PSM	NGSLDSPGKQDTEEDEEEDEK	157	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2286.2	20.16482	3	2349.964571	2349.956818	K	D	134	155
PSM	EAAAQEAGADTPGKGEPPAPKSPPK	158	sp|O95466|FMNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	22-UNIMOD:21	ms_run[1]:scan=1.1.2345.3	21.3487	4	2480.162894	2480.158449	K	A	1010	1035
PSM	IVRGDQPAASGDSDDDEPPPLPR	159	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2706.2	29.72887	3	2483.098271	2483.096577	K	L	45	68
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	160	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.2958.3	35.5515	4	3044.154894	3044.151982	K	L	595	622
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	161	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2861.3	33.23017	3	3722.195171	3722.195067	K	A	158	190
PSM	CNTPTYCDLGK	162	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.2911.2	34.4078	2	1449.5289	1449.5300	M	A	2	13
PSM	DHQYQFLEDAVR	163	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3163.2	39.7743	3	1519.703771	1519.705556	K	N	239	251
PSM	DGLTDVYNK	164	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2651.2	28.45757	2	1023.488647	1023.487290	K	I	182	191
PSM	NGQDLGVAFK	165	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2744.2	30.5947	2	1047.534847	1047.534909	K	I	424	434
PSM	GFEEEHKDSDDDSSDDEQEK	166	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2115.2	17.8206	4	2339.874894	2339.878567	K	K	423	443
PSM	GDNITLLQSVSN	167	sp|P62304|RUXE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3353.3	43.73302	2	1259.634047	1259.635745	K	-	81	93
PSM	LMIEMDGTENK	168	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2862.3	33.25453	2	1279.578647	1279.578824	K	S	93	104
PSM	ELISNSSDALDK	169	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2634.4	28.02587	2	1290.627047	1290.630326	R	I	47	59
PSM	DIQEESTFSSR	170	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2576.2	26.67007	2	1297.578247	1297.578624	K	K	67	78
PSM	AQTPPGPSLSGSK	171	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2433.2	23.27028	2	1305.596647	1305.596597	K	S	1001	1014
PSM	TAFQEALDAAGDK	172	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3118.2	39.00455	2	1335.630247	1335.630660	K	L	9	22
PSM	TLEEDEEELFK	173	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3423.3	45.02552	2	1380.628247	1380.629657	K	M	40	51
PSM	ESVPEFPLSPPK	174	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3473.3	45.87267	2	1405.652047	1405.653049	K	K	30	42
PSM	AFLAELEQNSPK	175	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3314.3	42.9889	2	1425.654247	1425.654112	K	I	4512	4524
PSM	DKKDEEEDMSLD	176	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2461.3	23.9431	3	1452.594371	1452.592620	K	-	396	408
PSM	LTFDSSFSPNTGK	177	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3190.3	40.4183	2	1479.626847	1479.628291	K	K	97	110
PSM	KYEEIDNAPEER	178	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2369.2	21.79012	3	1491.688271	1491.684152	K	A	91	103
PSM	EEASDYLELDTIK	179	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3360.2	43.87458	2	1524.716247	1524.719535	K	N	253	266
PSM	DQGTYEDYVEGLR	180	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3318.3	43.06823	2	1543.679047	1543.679067	K	V	82	95
PSM	DTGKTPVEPEVAIHR	181	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2521.2	25.29323	4	1647.864094	1647.858034	K	I	5	20
PSM	YHGHSMSDPGVSYR	182	sp|P29803|ODPAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2431.5	23.2198	3	1671.650471	1671.650106	R	T	287	301
PSM	SDEDKDKEGEALEVK	183	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2311.2	20.62472	3	1690.797071	1690.789740	K	E	279	294
PSM	HVPDSGATATAYLCGVK	184	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3004.3	36.63245	3	1825.809671	1825.807001	K	G	110	127
PSM	DGARPDVTESESGSPEYR	185	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2448.5	23.63512	3	1950.855671	1950.855528	K	Q	425	443
PSM	NGVIQHTGAAAEEFNDDTD	186	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2830.4	32.53357	3	2082.812171	2082.816773	R	-	646	665
PSM	DNLTLWTSDQQDEEAGEGN	187	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3551.3	47.62435	3	2120.875571	2120.877051	R	-	228	247
PSM	NTNDANSCQIIIPQNQVNR	188	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2814.2	32.13115	3	2198.051771	2198.049828	K	K	310	329
PSM	KVEPVPVTKQPTPPSEAAASK	189	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2491.2	24.6252	4	2240.148494	2240.145365	K	K	142	163
PSM	AGEEDEGEEDSDSDYEISAK	190	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2642.4	28.23088	3	2253.796571	2253.795823	R	A	463	483
PSM	TDAPQPDVKEEEEEKEEEK	191	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2320.2	20.8341	4	2258.015294	2258.007397	K	D	517	536
PSM	DNLTLWTSENQGDEGDAGEGEN	192	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3491.3	46.24218	3	2349.944771	2349.946922	R	-	225	247
PSM	RDHALLEEQSK	193	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2226.2	19.19667	3	1324.676171	1324.673528	K	Q	633	644
PSM	DGGFCEVCK	194	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2472.4	24.22907	2	1070.414847	1070.416116	K	K	405	414
PSM	ALLLLCGEDD	195	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3739.2	50.06952	2	1117.531647	1117.532526	K	-	311	321
PSM	ASSLEDLVLK	196	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3470.2	45.83952	2	1153.563047	1153.563172	R	E	254	264
PSM	NLQYYDISAK	197	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2862.2	33.2512	2	1213.597447	1213.597903	K	S	143	153
PSM	AGSSTPGDAPPAVAEVQGR	198	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2730.3	30.28573	3	1845.832271	1845.825822	R	S	2885	2904
PSM	DLFDPIIEDR	199	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3830.2	51.0315	2	1231.605247	1231.608468	K	H	87	97
PSM	SNVSDAVAQSTR	200	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2412.4	22.75335	2	1233.596247	1233.594943	K	I	232	244
PSM	NDSWGSFDLR	201	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3579.2	48.2157	2	1275.493847	1275.492132	R	A	650	660
PSM	DSAQNSVIIVDK	202	sp|P02786|TFR1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2669.4	28.84102	2	1287.663847	1287.667045	K	N	194	206
PSM	ISVYYNEATGGK	203	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2672.2	28.9245	2	1300.630047	1300.629932	R	Y	47	59
PSM	DLIHDQDEDEEEEEGQR	204	sp|Q9UNZ2|NSF1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2592.4	27.05342	3	2084.838371	2084.840666	R	F	77	94
PSM	NQIHVKSPPREGSQGELTPANSQSR	205	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2432.2	23.23502	4	2796.332894	2796.330434	R	M	462	487
PSM	STNEAMEWMNNK	206	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2971.2	35.86912	2	1453.595247	1453.596599	K	L	737	749
PSM	GYDSAGVGFDGGNDK	207	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2629.3	27.89823	2	1457.605847	1457.605902	R	D	34	49
PSM	GVVDSEDLPLNISR	208	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3280.3	42.3169	3	1512.775271	1512.778387	R	E	387	401
PSM	NHDEESLECLCR	209	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2627.4	27.8404	3	1560.638471	1560.629691	K	L	926	938
PSM	NRPTSISWDGLDSGK	210	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	38.64562	3	1711.752971	1711.756680	K	L	48	63
PSM	NLDIERPTYTNLNR	211	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2866.2	33.35145	3	1717.877771	1717.874747	R	L	216	230
PSM	NRFGAQQDTIEVPEK	212	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2648.5	28.38058	3	1730.863871	1730.858763	R	D	849	864
PSM	DRSSFYVNGLTLGGQK	213	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3173.2	40.02172	3	1740.881471	1740.879498	K	C	55	71
PSM	EVLDEDTDEEKETLK	214	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2659.2	28.63472	3	1871.793071	1871.792516	K	N	990	1005
PSM	STIGVMVTASHNPEEDNGVK	215	sp|O95394|AGM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2848.2	32.96397	3	2163.950471	2163.950764	K	L	55	75
PSM	YHTSQSGDEMTSLSEYVSR	216	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3059.2	37.95585	3	2175.937871	2175.937877	R	M	457	476
PSM	DNLTLWTSDQQDDDGGEGNN	217	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3675.3	49.32353	3	2192.869571	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	218	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3199.3	40.64245	3	2195.927771	2195.927707	R	E	226	245
PSM	AGEEDEGEEDSDSDYEISAK	219	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2650.3	28.43192	3	2253.796571	2253.795823	R	A	463	483
PSM	DNLTLWTSENQGDEGDAGEGEN	220	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3556.2	47.73337	3	2349.937571	2349.946922	R	-	225	247
PSM	EADDDEEVDDNIPEMPSPKK	221	sp|P26358|DNMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2956.2	35.50985	3	2351.935571	2351.935234	K	M	698	718
PSM	DNLTLWTSDTQGDEAEAGEGGEN	222	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3677.2	49.37347	3	2407.984271	2407.988786	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	223	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2724.2	30.12698	3	2483.098271	2483.096577	K	L	45	68
PSM	QENCGAQQVPAGPGTSTPPSSPVR	224	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2682.2	29.15378	3	2501.101571	2501.100617	R	T	257	281
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	225	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3403.3	44.6451	3	3014.189171	3014.188484	K	-	661	690
PSM	DKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQR	226	sp|Q8N7H5|PAF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2627.5	27.84373	5	4505.731118	4505.722755	R	S	449	493
PSM	DNLTLWTSENQGDEGDAGEGEN	227	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3584.2	48.3183	3	2350.930871	2349.946922	R	-	225	247
PSM	PFSAPKPQTSPSPK	228	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2443.3	23.51558	3	1547.742071	1547.738510	K	R	299	313
PSM	ADSELQLVEQR	229	sp|P07741|APT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3338.2	43.39478	2	1328.6517	1328.6567	M	I	2	13
PSM	SCINLPTVLPGSPSK	230	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4110.2	54.32613	3	1690.8016	1690.7996	M	T	2	17
PSM	KGDECELLGHSK	231	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4	ms_run[1]:scan=1.1.2322.2	20.88475	3	1371.647471	1371.645264	K	N	286	298
PSM	NLQTVNVDEN	232	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2590.3	26.9984	2	1144.534447	1144.536031	K	-	116	126
PSM	FEDENFILK	233	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3193.3	40.49708	2	1153.564847	1153.565540	K	H	83	92
PSM	NFEDVAFDEK	234	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3021.3	37.01893	2	1212.529647	1212.529883	K	K	376	386
PSM	DSPSVWAAVPGK	235	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3035.3	37.35907	2	1212.613447	1212.613888	K	T	27	39
PSM	LGMLSPEGTCK	236	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.2885.3	33.79928	2	1271.527447	1271.529111	R	A	203	214
PSM	EALQDVEDENQ	237	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2611.2	27.45182	2	1288.542047	1288.541905	K	-	245	256
PSM	TAFQEALDAAGDK	238	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3106.4	38.80728	2	1335.630247	1335.630660	K	L	9	22
PSM	DNNQFASASLDR	239	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2671.5	28.89555	2	1336.600047	1336.600757	K	T	154	166
PSM	NNASTDYDLSDK	240	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2436.2	23.33332	2	1341.568047	1341.568454	K	S	301	313
PSM	DLLHPSPEEEK	241	sp|P42677|RS27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2720.2	30.0404	2	1372.591847	1372.591177	K	R	6	17
PSM	DVIELTDDSFDK	242	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3355.2	43.78432	2	1395.637847	1395.640556	K	N	161	173
PSM	ESVPEFPLSPPK	243	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3457.3	45.67342	2	1405.652047	1405.653049	K	K	30	42
PSM	IISSIEQKEENK	244	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2349.2	21.45028	3	1416.751871	1416.746024	R	G	62	74
PSM	TVIIEQSWGSPK	245	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3138.2	39.42187	2	1423.671047	1423.674847	R	V	61	73
PSM	DNPGVVTCLDEAR	246	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2873.3	33.51287	2	1444.662047	1444.661643	K	H	227	240
PSM	EFHLNESGDPSSK	247	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2508.2	24.96173	3	1445.644271	1445.642287	K	S	165	178
PSM	DADSITLFDVQQK	248	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3452.2	45.56317	3	1478.724971	1478.725289	R	R	468	481
PSM	NGSEADIDEGLYSR	249	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2779.2	31.32265	2	1524.669447	1524.669230	K	Q	44	58
PSM	SLTNDWEDHLAVK	250	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3099.2	38.68818	3	1526.737271	1526.736522	K	H	315	328
PSM	KHHEEEIVHHKK	251	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2158.2	18.32522	4	1549.818894	1549.811359	K	E	72	84
PSM	LTFDSSFSPNTGKK	252	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2938.2	35.04408	3	1607.721671	1607.723254	K	N	97	111
PSM	LTFDSSFSPNTGKK	253	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2921.2	34.62838	3	1607.723171	1607.723254	K	N	97	111
PSM	DSGRGDSVSDSGSDALR	254	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2318.4	20.78327	3	1679.740571	1679.734684	R	S	70	87
PSM	KASPPSGLWSPAYASH	255	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3078.2	38.32058	3	1734.774971	1734.776687	R	-	1872	1888
PSM	NQTAEKEEFEHQQK	256	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2135.2	18.02635	4	1744.808894	1744.801642	K	E	584	598
PSM	VVVAENFDEIVNNENK	257	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3284.2	42.377	3	1831.895171	1831.895208	K	D	380	396
PSM	NPDDITQEEYGEFYK	258	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3187.2	40.35002	3	1846.788371	1846.789740	R	S	292	307
PSM	DWILPSDYDHAEAEAR	259	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3327.3	43.2171	3	1886.844371	1886.843506	K	H	256	272
PSM	DKGDEEEEGEEKLEEK	260	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2387.5	22.2451	3	1891.820771	1891.817077	K	Q	536	552
PSM	IISSIEQKEENKGGEDK	261	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2307.2	20.54213	4	1902.961694	1902.953451	R	L	62	79
PSM	KEESEESDDDMGFGLFD	262	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3443.3	45.40103	3	1964.747771	1964.746948	K	-	98	115
PSM	DSSTSPGDYVLSVSENSR	263	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3475.2	45.93047	3	1978.815371	1978.815711	R	V	39	57
PSM	DSSTCPGDYVLSVSENSR	264	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3415.2	44.89457	3	2051.814071	2051.814331	R	V	40	58
PSM	RKAEDSDSEPEPEDNVR	265	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2197.3	18.8047	3	2051.844371	2051.843322	K	L	494	511
PSM	DNLTLWTSDQQDDDGGEGNN	266	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3726.2	49.96565	3	2192.869871	2192.873028	R	-	228	248
PSM	KLEKEEEEGISQESSEEEQ	267	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2403.5	22.56073	3	2235.990671	2235.986661	K	-	89	108
PSM	FVEWLQNAEEESESEGEEN	268	sp|Q9Y6E2|BZW2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.4252.2	55.45984	3	2333.882471	2333.884913	K	-	401	420
PSM	DYEEVGVDSVEGEGEEEGEEY	269	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3441.3	45.35017	3	2347.896071	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	270	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3509.3	46.65667	3	2349.944771	2349.946922	R	-	225	247
PSM	EVEDKESEGEEEDEDEDLSK	271	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2426.3	23.09405	3	2418.892571	2418.895931	K	Y	147	167
PSM	DNLTLWTSDSAGEECDAAEGAEN	272	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3629.2	48.82725	3	2453.972471	2453.976507	R	-	223	246
PSM	ERIQQFDDGGSDEEDIWEEK	273	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3319.4	43.0859	3	2504.002571	2504.001674	K	H	607	627
PSM	LVEDERSDREETESSEGEEAAAGGGAK	274	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2385.3	22.1976	4	2887.206494	2887.199264	K	S	335	362
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	275	sp|Q9C0C9|UBE2O_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21,19-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2319.3	20.80212	5	3503.289618	3503.284224	R	A	81	114
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	276	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2828.2	32.48853	4	4445.554894	4445.553592	K	G	177	218
PSM	NGSLDSPGKQDTEEDEEEDEKDK	277	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2294.2	20.34278	4	2674.038894	2673.045055	K	G	134	157
PSM	AGFAGDDAPR	278	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2358.2	21.61272	2	975.441447	975.441009	K	A	21	31
PSM	SVEAAAELSAK	279	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2494.2	24.69143	2	1074.550847	1074.555704	K	D	5	16
PSM	DGGAWGTEQR	280	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2395.2	22.40435	2	1075.469047	1075.468286	K	E	65	75
PSM	ALLYLCGGDD	281	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3443.2	45.39437	2	1095.490047	1095.490661	K	-	330	340
PSM	DNQLSEVANK	282	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2418.2	22.91052	2	1116.537647	1116.541117	R	F	24	34
PSM	DLEGSDIDTR	283	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2480.4	24.43248	2	1119.504647	1119.504397	R	R	373	383
PSM	GVTIKPTVDDD	284	sp|Q2VIR3|IF2GL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2524.4	25.3803	2	1158.576447	1158.576833	R	-	462	473
PSM	IGEGTYGVVYK	285	sp|P06493|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2922.3	34.64837	2	1264.569847	1264.574071	K	G	10	21
PSM	DIIACGFDINK	286	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3336.3	43.3732	2	1264.610047	1264.612173	K	T	221	232
PSM	AQTPPGPSLSGSK	287	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2441.4	23.4746	2	1305.596647	1305.596597	K	S	1001	1014
PSM	TTGTPPDSSLVTYELHSRPEQDK	288	sp|Q13561|DCTN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3025.2	37.10065	4	2637.200894	2637.195957	K	F	195	218
PSM	YSQVLANGLDNK	289	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2698.3	29.54318	2	1320.667447	1320.667380	K	L	95	107
PSM	NSNPALNDNLEK	290	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2469.4	24.14628	2	1327.637247	1327.636808	K	G	120	132
PSM	DAQPSFSAEDIAK	291	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2884.2	33.78357	2	1377.634047	1377.641225	K	I	271	284
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	292	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2731.3	30.30838	6	4245.558741	4245.543285	K	S	158	195
PSM	GTPMKPNTQATPP	293	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21	ms_run[1]:scan=1.1.2423.2	23.01772	2	1418.623247	1418.626517	K	-	520	533
PSM	DMNQVLDAYENK	294	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3322.3	43.1592	2	1438.639447	1438.639844	R	K	142	154
PSM	HVFGESDELIGQK	295	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2786.2	31.46312	3	1457.715371	1457.715058	R	V	138	151
PSM	AIDDNMSLDEIEK	296	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3117.2	38.97878	2	1491.674847	1491.676290	K	L	857	870
PSM	AGDLLEDSPKRPK	297	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2413.2	22.78458	3	1504.728071	1504.728674	R	E	158	171
PSM	MLAESDESGDEESVSQTDKTELQNTLR	298	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3161.3	39.73155	4	3091.315694	3091.317665	K	T	186	213
PSM	DHQTITIQEMPEK	299	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2684.3	29.20547	3	1568.754671	1568.750458	K	A	195	208
PSM	RHVFGESDELIGQK	300	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2648.4	28.37392	3	1613.816771	1613.816169	R	V	137	151
PSM	AASPPASASDLIEQQQK	301	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2935.2	34.96932	3	1819.834271	1819.835324	R	R	333	350
PSM	DGQVINETSQHHDDLE	302	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2495.4	24.717	3	1835.798471	1835.792199	R	-	451	467
PSM	QLVRGEPNVSYICSR	303	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2832.4	32.58462	3	1856.860271	1856.860433	K	Y	269	284
PSM	DNLTLWTSDQQDEEAGEGN	304	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3522.2	46.97875	3	2120.875871	2120.877051	R	-	228	247
PSM	QTIDNSQGAYQEAFDISKK	305	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2981.2	36.08993	3	2142.027371	2142.022927	K	E	140	159
PSM	QDSSTGSYSINFVQNPNNNR	306	sp|Q99614|TTC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3023.2	37.07882	3	2241.005771	2241.004652	K	-	273	293
PSM	DYHFKVDNDENEHQLSLR	307	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2840.2	32.78282	4	2258.037694	2258.035223	K	T	28	46
PSM	DNLTLWTSENQGDEGDAGEGEN	308	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3676.2	49.34857	3	2349.945071	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	309	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3057.3	37.91098	3	2443.857971	2443.860534	K	K	129	151
PSM	DNLTLWTSDSAGEECDAAEGAEN	310	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3686.2	49.45237	3	2453.972471	2453.976507	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	311	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2732.3	30.33383	3	2483.098271	2483.096577	K	L	45	68
PSM	CGDLEEELK	312	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=1.1.2683.3	29.17948	2	1091.478447	1091.480490	K	I	190	199
PSM	RHLTGEFEK	313	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2268.2	19.78367	3	1115.575871	1115.572357	K	K	29	38
PSM	ALLLLCGEDD	314	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3720.2	49.86912	2	1117.531647	1117.532526	K	-	311	321
PSM	DNLTLWTSENQGDEGDAGEGEN	315	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3501.2	46.46175	4	2349.948894	2349.946922	R	-	225	247
PSM	NLEELNISSAQ	316	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3124.2	39.15631	2	1216.589847	1216.593546	K	-	120	131
PSM	KITIADCGQLE	317	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2787.4	31.5018	2	1246.621847	1246.622738	K	-	155	166
PSM	IGEGTYGVVYK	318	sp|P06493|CDK1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2709.5	29.79985	2	1264.574047	1264.574071	K	G	10	21
PSM	NSLESYAFNMK	319	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:35	ms_run[1]:scan=1.1.2922.4	34.65503	2	1318.587047	1318.586353	K	A	540	551
PSM	GATQQILDEAER	320	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2839.2	32.76065	2	1329.647647	1329.652458	R	S	377	389
PSM	DLLHPSPEEEK	321	sp|P42677|RS27_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2711.2	29.83413	2	1372.591847	1372.591177	K	R	6	17
PSM	SEDYVDIVQGNR	322	sp|O00469|PLOD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2954.4	35.45182	2	1393.645647	1393.647373	R	V	441	453
PSM	RAGELTEDEVER	323	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2373.2	21.87865	3	1402.675871	1402.668836	K	V	55	67
PSM	CLELFSELAEDK	324	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3880.2	51.64597	2	1452.675447	1452.680647	K	E	412	424
PSM	TTPSYVAFTDTER	325	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2941.2	35.13048	2	1486.692647	1486.693989	R	L	37	50
PSM	NRVIGSGCNLDSAR	326	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2402.2	22.52205	3	1517.735771	1517.736873	K	F	156	170
PSM	NVTELNEPLSNEER	327	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2763.2	30.99197	3	1642.778771	1642.779843	K	N	29	43
PSM	STTPPPAEPVSLPQEPPKPR	328	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2835.2	32.6546	4	2204.089694	2204.087850	K	V	225	245
PSM	RLQSIGTENTEENRR	329	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2256.2	19.61155	4	1801.910094	1801.903087	K	F	43	58
PSM	DKPHVNVGTIGHVDHGK	330	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2389.2	22.2858	4	1808.936494	1808.928179	R	T	54	71
PSM	DWEDDSDEDMSNFDR	331	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3286.2	42.43253	3	1874.653871	1874.653716	K	F	108	123
PSM	TDDYLDQPCYETINR	332	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3035.4	37.3624	3	1901.812271	1901.810158	R	I	194	209
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	333	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2878.4	33.62872	4	3949.360494	3949.358444	K	A	156	190
PSM	INSSGESGDESDEFLQSR	334	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2944.3	35.19655	3	2035.801271	2035.800789	R	K	180	198
PSM	SQSLPNSLDYTQTSDPGR	335	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2985.4	36.1782	3	2044.874471	2044.873894	R	H	44	62
PSM	NGVIQHTGAAAEEFNDDTD	336	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:21	ms_run[1]:scan=1.1.2823.2	32.36067	2	2082.811447	2082.816773	R	-	646	665
PSM	SGSTSSLSYSTWTSSHSDK	337	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2890.3	33.93093	3	2083.833971	2083.837174	R	T	197	216
PSM	ESEDKPEIEDVGSDEEEEK	338	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2562.2	26.33092	3	2191.912271	2191.912828	K	K	251	270
PSM	DNLTLWTSENQGDEGDAGEGEN	339	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3546.2	47.53327	3	2349.938771	2349.946922	R	-	225	247
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	340	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2806.2	31.92708	3	2414.123471	2414.122732	R	L	815	839
PSM	LVQDVANNTNEEAGDGTTTATVLAR	341	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2908.5	34.34745	3	2559.236171	2559.241253	K	S	97	122
PSM	KMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGK	342	sp|Q99613|EIF3C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2674.4	28.97595	4	3943.366494	3943.362484	K	Q	214	249
PSM	ASGVAVSDGVIK	343	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3156.2	39.63902	2	1223.5774	1223.5794	M	V	2	14
PSM	NGQDLGVAFK	344	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2944.2	35.18988	2	1048.518247	1047.534909	K	I	424	434
PSM	DLTDYLMK	345	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3511.2	46.70092	2	997.478847	997.479034	R	I	186	194
PSM	QEYDESGPSIVHR	346	sp|Q9BYX7|ACTBM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2507.2	24.93635	3	1515.701771	1515.695386	K	K	360	373
PSM	DCAVIVTQK	347	sp|P60900|PSA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4	ms_run[1]:scan=1.1.2393.2	22.3625	2	1032.530647	1032.527381	K	K	46	55
PSM	NGRVEIIANDQGNR	348	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2394.2	22.3791	3	1554.789371	1554.786266	K	I	47	61
PSM	DLSLEEIQK	349	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2969.2	35.81697	2	1073.561247	1073.560455	K	K	44	53
PSM	SADTLWGIQK	350	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3010.2	36.7442	2	1117.575247	1117.576774	K	E	319	329
PSM	GYSFTTTAER	351	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2616.2	27.58805	2	1131.520047	1131.519653	R	E	197	207
PSM	DQIYDIFQK	352	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3491.2	46.23218	2	1168.572647	1168.576440	K	L	194	203
PSM	CIPALDSLTPANEDQK	353	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3188.2	40.38623	3	1770.845471	1770.845815	R	I	447	463
PSM	EAAENSLVAYK	354	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2612.2	27.47622	2	1193.591847	1193.592818	K	A	143	154
PSM	VEIIANDQGNR	355	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2450.4	23.67965	2	1227.622447	1227.620764	R	I	50	61
PSM	PGPTPSGTNVGSSGRSPSK	356	sp|P60468|SC61B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2191.2	18.71017	3	1848.8432	1848.8362	M	A	2	21
PSM	DNSTMGYMMAK	357	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:35,9-UNIMOD:35	ms_run[1]:scan=1.1.2353.2	21.51425	2	1279.489847	1279.488295	R	K	486	497
PSM	HTIIPAKSPEK	358	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2262.2	19.67825	3	1299.660971	1299.658803	R	C	1908	1919
PSM	NSLESYAFNMK	359	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3197.5	40.59733	2	1302.589647	1302.591438	K	A	540	551
PSM	DVLSVAFSSDNR	360	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3334.3	43.31603	2	1308.626247	1308.630994	K	Q	107	119
PSM	TLNMTTSPEEK	361	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2509.2	24.99705	2	1329.551447	1329.552349	K	R	326	337
PSM	DVIELTDDSFDK	362	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3347.2	43.57942	2	1395.637847	1395.640556	K	N	161	173
PSM	DMTSEQLDDILK	363	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3551.2	47.61435	2	1406.655247	1406.659911	K	Y	672	684
PSM	RYPSSISSSPQK	364	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2306.3	20.51698	3	1415.647871	1415.644610	R	D	601	613
PSM	EVDEQMLNVQNK	365	sp|Q13885|TBB2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2725.2	30.15213	2	1445.682647	1445.682044	K	N	325	337
PSM	YKPESEELTAER	366	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2425.3	23.06883	3	1450.697471	1450.693989	K	I	327	339
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	367	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3136.2	39.35995	4	2908.185294	2908.189396	K	E	144	170
PSM	DLNHVCVISETGK	368	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2681.2	29.12463	3	1470.715871	1470.713678	R	A	201	214
PSM	DNGIRPSSLEQMAK	369	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2826.2	32.42773	3	1544.761271	1544.761691	K	L	278	292
PSM	PFSAPKPQTSPSPK	370	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2452.3	23.72728	3	1547.742071	1547.738510	K	R	299	313
PSM	DVAEAKPELSLLGDGDH	371	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3205.3	40.77813	3	1764.851171	1764.853008	R	-	232	249
PSM	SYELPDGQVITIGNER	372	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3539.2	47.38523	3	1789.881071	1789.884643	K	F	241	257
PSM	IKDPDASKPEDWDER	373	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2523.3	25.34772	4	1799.837294	1799.832607	K	A	208	223
PSM	QVPDSAATATAYLCGVK	374	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3311.2	42.92007	3	1830.821471	1830.822317	R	A	107	124
PSM	DGQVINETSQHHDDLE	375	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2506.4	24.92088	3	1835.798471	1835.792199	R	-	451	467
PSM	DLLLTSSYLSDSGSTGEHTK	376	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3252.2	41.76075	3	2110.008371	2110.006609	K	S	397	417
PSM	ESEDKPEIEDVGSDEEEEKK	377	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2463.4	24.00087	4	2320.013694	2320.007791	K	D	251	271
PSM	EADDDEEVDDNIPEMPSPKK	378	sp|P26358|DNMT1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2964.3	35.71643	3	2351.935571	2351.935234	K	M	698	718
PSM	NGSLDSPGKQDTEEDEEEDEKDK	379	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2250.2	19.49922	4	2593.086494	2593.078724	K	G	134	157
PSM	NGSLDSPGKQDTEEDEEEDEK	380	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2360.3	21.66662	3	2350.944671	2349.956818	K	D	134	155
PSM	SDKPDMAEIEKFDK	381	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3019.2	36.9661	3	1693.7843	1693.7864	M	S	2	16
PSM	ADKPDMGEIASFDK	382	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3176.4	40.11215	2	1564.7047	1564.7074	M	A	2	16
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	383	sp|Q9NPQ8|RIC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.2609.3	27.40982	3	2758.054571	2758.058931	R	E	424	448
PSM	DLLVSSGSNNSLPCGSPKK	384	sp|Q5THK1|PR14L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2841.2	32.81182	3	2038.936571	2038.939472	K	C	1014	1033
PSM	RKEDEVEEWQHR	385	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2380.4	22.06313	4	1639.776094	1639.770282	R	A	437	449
PSM	DKPHVNVGTIGHVDHGK	386	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2401.3	22.51012	4	1808.936494	1808.928179	R	T	54	71
PSM	DVDFELIK	387	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3369.2	44.06835	2	977.506247	977.506963	R	V	203	211
PSM	DVNAAIATIK	388	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2859.2	33.17827	2	1014.568847	1014.570960	K	T	327	337
PSM	DCVGPEVEK	389	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4	ms_run[1]:scan=1.1.2295.2	20.36852	2	1031.460847	1031.459361	K	A	98	107
PSM	YSGTLNLDR	390	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2630.3	27.92383	2	1037.512447	1037.514174	K	V	1996	2005
PSM	GVQYLNEIK	391	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2833.3	32.60702	2	1062.573247	1062.570960	K	D	668	677
PSM	ALLYLCGGDD	392	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3455.2	45.6123	2	1095.490047	1095.490661	K	-	330	340
PSM	FNAHGDANTIVCNSK	393	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4	ms_run[1]:scan=1.1.2456.4	23.81483	3	1646.749871	1646.747104	R	D	50	65
PSM	STLTDSLVCK	394	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:4	ms_run[1]:scan=1.1.2774.2	31.20012	2	1122.558447	1122.559075	K	A	33	43
PSM	DSLDQFDCK	395	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2685.2	29.23122	2	1126.462047	1126.460089	K	L	1124	1133
PSM	VTLTSEEEAR	396	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2409.2	22.67387	2	1133.556447	1133.556432	K	L	306	316
PSM	EAESSPFVER	397	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2545.2	25.90102	2	1149.531247	1149.530218	K	L	548	558
PSM	YIDQEELNK	398	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2466.2	24.06353	2	1150.552447	1150.550619	K	T	198	207
PSM	EITALAPSTMK	399	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2764.3	31.03063	2	1160.610047	1160.611110	K	I	318	329
PSM	DQIYDIFQK	400	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3480.2	46.04045	2	1168.572647	1168.576440	K	L	194	203
PSM	LLEELEEGQK	401	sp|Q13404|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2846.4	32.9245	2	1186.615047	1186.608134	R	G	17	27
PSM	LNLNNTVLSK	402	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2909.2	34.36585	2	1194.599047	1194.600954	R	R	426	436
PSM	DNSTMGYMAAK	403	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:35	ms_run[1]:scan=1.1.2309.2	20.57372	2	1203.492247	1203.490009	R	K	621	632
PSM	VEVTEFEDIK	404	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3053.3	37.80508	2	1207.593647	1207.597235	K	S	133	143
PSM	NLQDAMQVCR	405	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:4	ms_run[1]:scan=1.1.2728.2	30.2282	2	1233.558247	1233.559426	R	N	390	400
PSM	DQVANSAFVER	406	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2589.3	26.97275	2	1234.592447	1234.594215	K	L	500	511
PSM	DHPLPEVAHVK	407	sp|P13073|COX41_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2438.3	23.38775	3	1240.657871	1240.656421	R	H	43	54
PSM	DNSTMGYMMAK	408	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:35	ms_run[1]:scan=1.1.2577.3	26.68837	2	1263.493647	1263.493380	R	K	486	497
PSM	DGNGYISAAELR	409	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2951.2	35.36823	2	1264.603647	1264.604780	K	H	96	108
PSM	DCDLQEDEACYNCGR	410	sp|P62633-4|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.2671.4	28.89222	3	1903.676771	1903.677112	K	G	66	81
PSM	LDIDSPPITAR	411	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3080.2	38.37214	2	1276.605047	1276.606433	R	N	33	44
PSM	YALYDATYETK	412	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2889.3	33.90199	2	1336.617847	1336.618698	R	E	82	93
PSM	DSIKLDDDSERK	413	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2278.2	19.96833	3	1419.691271	1419.684152	K	V	37	49
PSM	DYQDNKADVILK	414	sp|P47813|IF1AX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2635.2	28.04118	3	1420.719071	1420.719809	R	Y	83	95
PSM	RRSPSPYYSR	415	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2206.2	18.919	3	1427.576471	1427.574830	R	Y	258	268
PSM	ANSWQLVETPEK	416	sp|Q9Y2H0|DLGP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3075.2	38.2758	2	1480.655247	1480.659926	K	R	907	919
PSM	HELQANCYEEVK	417	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2444.3	23.54137	3	1518.678671	1518.677293	K	D	133	145
PSM	TGSTSSKEDDYESDAATIVQK	418	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2898.3	34.1415	3	2310.973871	2310.974062	R	C	360	381
PSM	DIEREDIEFICK	419	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3110.2	38.90448	3	1565.739671	1565.739559	K	T	327	339
PSM	DVTPPPETEVVLIK	420	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	46.1657	3	1615.809671	1615.811007	K	N	519	533
PSM	LTFDTTFSPNTGKK	421	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3018.2	36.94137	3	1635.759371	1635.754554	K	S	108	122
PSM	NQLTSNPENTVFDAK	422	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2908.2	34.33745	3	1676.799371	1676.800579	K	R	82	97
PSM	YHGHSMSDPGVSYR	423	sp|P29803|ODPAT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=1.1.2272.3	19.86513	3	1687.647671	1687.645021	R	T	287	301
PSM	NLGTNQCLDVGENNR	424	sp|Q8NCL4|GALT6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2631.2	27.93607	3	1702.768871	1702.769296	K	G	503	518
PSM	MSPNETLFLESTNK	425	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	39.51933	3	1705.730771	1705.727019	K	I	85	99
PSM	APVSSTESVIQSNTPTPPPSQPLNETAEEESR	426	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3131.2	39.2819	4	3458.580094	3458.572634	K	I	884	916
PSM	AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEK	427	sp|Q00653|NFKB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3128.2	39.21705	4	3527.449294	3527.455949	K	D	690	723
PSM	DVAEAKPELSLLGDGDH	428	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3194.3	40.52302	2	1764.846647	1764.853008	R	-	232	249
PSM	ILDSVGIEADDDRLNK	429	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2908.3	34.34078	3	1771.892771	1771.895208	K	V	26	42
PSM	HVPDSGATATAYLCGVK	430	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3014.2	36.84233	3	1825.809671	1825.807001	K	G	110	127
PSM	DNLTLWTSDQQDEEAGEGN	431	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3561.2	47.84233	3	2120.875571	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDEEAGEGN	432	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3540.2	47.40983	3	2120.875871	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	433	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3600.2	48.49088	3	2192.869271	2192.873028	R	-	228	248
PSM	KVEEEQEADEEDVSEEEAESK	434	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2478.5	24.37813	3	2437.017671	2437.013998	K	E	234	255
PSM	IVRGDQPAASGDSDDDEPPPLPR	435	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2715.5	29.931	4	2483.101694	2483.096577	K	L	45	68
PSM	NGSLDSPGKQDTEEDEEEDEKDK	436	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2317.4	20.75787	4	2594.067694	2593.078724	K	G	134	157
PSM	QLSSGVSEIR	437	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3226.2	41.21293	2	1137.5069	1137.5062	R	H	80	90
PSM	ADKPDMGEIASFDK	438	sp|P63313|TYB10_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=1.1.2818.2	32.23252	2	1580.7005	1580.7023	M	A	2	16
PSM	SRHEGVSCDACLK	439	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21,8-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.2387.3	22.23843	3	1639.6538	1639.6479	M	G	2	15
PSM	YIDQEELNK	440	sp|Q58FF8|H90B2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2471.2	24.20373	3	1150.555271	1150.550619	K	T	198	207
PSM	DLIDDLK	441	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3400.2	44.5697	2	830.438447	830.438549	R	S	63	70
PSM	TEWLDGK	442	sp|Q9Y536|PAL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2650.2	28.42192	2	847.407647	847.407583	K	H	119	126
PSM	ETKPEPMEEDLPENKK	443	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2439.2	23.4234	4	1912.910494	1912.908809	K	Q	208	224
PSM	NWTLEGSC	444	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3065.2	38.04943	2	965.391447	965.391281	R	-	1331	1339
PSM	SCNCLLLK	445	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.2671.2	28.88555	2	1006.493247	1006.493973	K	V	336	344
PSM	DLTDYLMK	446	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:35	ms_run[1]:scan=1.1.3171.2	39.96978	2	1013.473247	1013.473949	R	I	186	194
PSM	SGKYDLDFK	447	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2660.2	28.65725	3	1071.524171	1071.523676	R	S	254	263
PSM	DMESPTKLDVTLAK	448	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3073.3	38.25628	3	1626.763571	1626.757591	K	D	277	291
PSM	EIIDLVLDR	449	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3783.2	50.44335	2	1084.612847	1084.612825	K	I	113	122
PSM	NTDEMVELR	450	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2683.4	29.18282	2	1105.505647	1105.507374	R	I	38	47
PSM	MSGFIYQGK	451	sp|Q15052|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.2760.2	30.91832	2	1125.456447	1125.456598	R	I	487	496
PSM	RISFSASHR	452	sp|Q03393|PTPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2380.2	22.05647	3	1139.526071	1139.523707	R	L	17	26
PSM	GESPVDYDGGR	453	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2419.2	22.93572	2	1150.487447	1150.489081	K	T	246	257
PSM	AIEENNNFSK	454	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2334.2	21.09603	2	1164.542247	1164.541117	K	M	86	96
PSM	EVFEDAAEIR	455	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2887.3	33.85058	2	1177.563047	1177.561518	K	L	411	421
PSM	YLSEVASGDNK	456	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2381.5	22.09205	2	1181.557047	1181.556432	R	Q	130	141
PSM	VEIIANDQGNR	457	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2441.2	23.46127	3	1227.624371	1227.620764	R	I	50	61
PSM	DIDISSPEFK	458	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3176.3	40.10548	2	1229.522647	1229.521701	K	I	172	182
PSM	DKDDDEVFEK	459	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2402.3	22.52872	2	1238.532647	1238.530277	K	K	854	864
PSM	GYFEYIEENK	460	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3197.4	40.594	2	1290.576647	1290.576833	R	Y	256	266
PSM	HRPELIEYDK	461	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2472.3	24.2224	3	1298.664671	1298.661900	R	L	205	215
PSM	DQIVDLTVGNNK	462	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2938.4	35.05075	2	1314.677247	1314.677945	K	T	213	225
PSM	ASPGTPLSPGSLR	463	sp|Q96BD0|SO4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2894.2	34.03027	2	1318.627847	1318.628231	R	S	33	46
PSM	DKPHVNVGTIGHVDHGK	464	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2381.3	22.08538	4	1808.936494	1808.928179	R	T	54	71
PSM	GEPNVSYICSR	465	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2702.2	29.63855	2	1360.547047	1360.548267	R	Y	273	284
PSM	GEPNVSYICSR	466	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.2675.3	29.00157	2	1360.548247	1360.548267	R	Y	273	284
PSM	NRSNTPILVDGK	467	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2428.2	23.13433	3	1392.674471	1392.676244	R	D	105	117
PSM	YQIDPDACFSAK	468	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2964.2	35.70643	2	1413.627247	1413.623466	K	V	225	237
PSM	RFDDAVVQSDMK	469	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:35	ms_run[1]:scan=1.1.2441.3	23.46793	3	1425.659471	1425.655829	R	H	77	89
PSM	LFMAQALQEYNN	470	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:35	ms_run[1]:scan=1.1.3202.2	40.7196	2	1456.664847	1456.665666	K	-	341	353
PSM	EGDVDVSDSDDEDDNLPANFDTCHR	471	sp|Q9NYV6|RRN3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21,23-UNIMOD:4	ms_run[1]:scan=1.1.3069.2	38.13975	4	2916.070094	2916.066536	K	A	164	189
PSM	GNPTVEVDLFTSK	472	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3450.2	45.52055	2	1485.676247	1485.675241	R	G	16	29
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	473	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2860.3	33.20598	5	3722.205618	3722.195067	K	A	158	190
PSM	NSNSPPSPSSMNQR	474	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2351.2	21.48183	3	1581.627971	1581.624285	R	R	454	468
PSM	DINAYNCEEPTEK	475	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2525.4	25.3993	3	1581.666071	1581.661702	K	L	85	98
PSM	RGPGLYYVDSEGNR	476	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2671.3	28.88888	3	1581.753071	1581.753569	K	I	166	180
PSM	QDLPNAMNAAEITDK	477	sp|P84077|ARF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3009.2	36.72153	2	1629.766047	1629.766836	K	L	128	143
PSM	NQVAMNPTNTVFDAK	478	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2947.2	35.26503	3	1648.790171	1648.787906	K	R	57	72
PSM	DLEIERPILGQNDNK	479	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3018.3	36.9447	3	1752.901271	1752.900627	R	S	234	249
PSM	SYELPDGQVITIGNER	480	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3530.2	47.16273	3	1789.881071	1789.884643	K	F	241	257
PSM	IRYESLTDPSKLDSGK	481	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2749.2	30.70948	4	1807.933294	1807.931593	K	E	54	70
PSM	NHSGSRTPPVALNSSR	482	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2371.6	21.8412	3	1838.787971	1838.782591	R	M	2098	2114
PSM	QLVRGEPNVSYICSR	483	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.2824.4	32.37971	3	1856.860271	1856.860433	K	Y	269	284
PSM	DCAVKPCQSDEVPDGIK	484	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.2613.2	27.50075	3	1916.864771	1916.860813	R	S	98	115
PSM	DSSTCPGDYVLSVSENSR	485	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3241.2	41.52498	3	1971.855371	1971.848000	R	V	40	58
PSM	DSSTSPGDYVLSVSENSR	486	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3459.2	45.71408	3	1978.815371	1978.815711	R	V	39	57
PSM	DNLTLWTSDQQDDDGGEGNN	487	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3751.2	50.17038	3	2192.872871	2192.873028	R	-	228	248
PSM	STTPPPAEPVSLPQEPPKPR	488	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2825.2	32.39878	4	2204.089694	2204.087850	K	V	225	245
PSM	DDDIAALVVDNGSGMCK	489	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4179.2	54.88973	2	1821.7692	1820.7912	M	A	2	19
PSM	VNQIGSVTESLQACK	490	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:4	ms_run[1]:scan=1.1.2922.2	34.6417	3	1632.809771	1632.814121	K	L	344	359
PSM	NGRVEIIANDQGNR	491	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=1.1.2498.3	24.75497	3	1555.7742	1554.7862	K	I	47	61
PSM	NGSLDSPGKQDTEEDEEEDEK	492	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2359.3	21.64807	3	2430.912071	2429.923149	K	D	134	155
PSM	ASGVAVSDGVIK	493	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3166.2	39.83975	2	1223.5774	1223.5794	M	V	2	14