MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000151 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617205149466520^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_09_K4_1.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0	null	488-UNIMOD:21	0.03	54.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53.0	null	495-UNIMOD:4,506-UNIMOD:4,507-UNIMOD:21	0.05	53.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0	null		0.18	50.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	175-UNIMOD:35,211-UNIMOD:35	0.18	50.0	10	4	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	null	145-UNIMOD:21,136-UNIMOD:21	0.10	48.0	16	3	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null	147-UNIMOD:21,162-UNIMOD:21	0.10	47.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	null		0.19	47.0	9	4	3
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	675-UNIMOD:21,670-UNIMOD:21	0.04	46.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	null	102-UNIMOD:21	0.12	46.0	2	1	0
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	296-UNIMOD:4,308-UNIMOD:21	0.05	45.0	2	2	2
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	441-UNIMOD:21,426-UNIMOD:35	0.05	44.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null	337-UNIMOD:4,339-UNIMOD:4	0.13	43.0	5	4	3
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.10	43.0	5	1	0
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.06	43.0	3	2	1
PRT	sp|Q8N7H5|PAF1_HUMAN	RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.08	43.0	2	1	0
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	576-UNIMOD:4,584-UNIMOD:21,592-UNIMOD:35	0.02	42.0	3	2	1
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	426-UNIMOD:21	0.04	40.0	4	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	63-UNIMOD:21	0.10	40.0	2	1	0
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.10	39.0	3	1	0
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null		0.07	38.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	235-UNIMOD:35	0.19	38.0	11	4	2
PRT	sp|Q9Y6Q9|NCOA3_HUMAN	Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	716-UNIMOD:4,728-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	37.0	1	1	1
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	641-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	138-UNIMOD:35	0.10	37.0	4	2	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	237-UNIMOD:4	0.10	37.0	2	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	57-UNIMOD:21	0.12	37.0	4	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,17-UNIMOD:4,16-UNIMOD:35	0.05	37.0	2	1	0
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	335-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null	447-UNIMOD:4	0.11	36.0	5	4	3
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.09	36.0	16	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	35.0	3	1	0
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.11	35.0	3	3	3
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	232-UNIMOD:21	0.14	35.0	9	2	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.07	35.0	4	4	4
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	35.0	null	2-UNIMOD:1,77-UNIMOD:35	0.29	35.0	3	3	3
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	46-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	27-UNIMOD:21,26-UNIMOD:21	0.07	33.0	2	2	2
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.34	33.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	308-UNIMOD:21,310-UNIMOD:21,307-UNIMOD:21	0.04	32.0	5	2	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.12	32.0	3	3	3
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.13	32.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.07	32.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	317-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|P80723|BASP1_HUMAN	Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.13	32.0	1	1	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	1036-UNIMOD:21,1055-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	114-UNIMOD:21,123-UNIMOD:4	0.03	31.0	4	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.06	31.0	3	3	3
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	473-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9H6Z4|RANB3_HUMAN	Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	363-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	51-UNIMOD:21,63-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	2	2	2
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	567-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	192-UNIMOD:35	0.10	30.0	3	3	3
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	183-UNIMOD:35	0.19	30.0	1	1	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	173-UNIMOD:4,180-UNIMOD:21,194-UNIMOD:4	0.10	30.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1	0.14	30.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.14	29.0	1	1	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	112-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	104-UNIMOD:21	0.05	29.0	3	2	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	203-UNIMOD:4,210-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	928-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	617-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	3	3	3
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.13	28.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	6	5	4
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	2	2	2
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	91-UNIMOD:4,47-UNIMOD:4	0.12	28.0	2	2	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	183-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	501-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	227-UNIMOD:21	0.05	28.0	3	1	0
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1015-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.10	27.0	2	2	2
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	290-UNIMOD:4	0.10	27.0	4	3	2
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	163-UNIMOD:4	0.05	27.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	891-UNIMOD:21,434-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	549-UNIMOD:35	0.08	27.0	5	4	3
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	996-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	108-UNIMOD:35	0.16	27.0	2	1	0
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	153-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	316-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.07	26.0	7	4	3
PRT	sp|O95466|FMNL1_HUMAN	Formin-like protein 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1031-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P46020|KPB1_HUMAN	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	7-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	186-UNIMOD:4,5-UNIMOD:21	0.08	26.0	3	2	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	234-UNIMOD:4	0.03	26.0	4	2	0
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	346-UNIMOD:21,348-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	362-UNIMOD:21	0.00	26.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.05	26.0	2	2	2
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	52-UNIMOD:21	0.09	26.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.12	26.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	61-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	103-UNIMOD:21	0.19	26.0	2	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	2-UNIMOD:1,3-UNIMOD:21,139-UNIMOD:4	0.23	26.0	4	3	2
PRT	sp|P05362|ICAM1_HUMAN	Intercellular adhesion molecule 1 OS=Homo sapiens OX=9606 GN=ICAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	530-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	521-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	345-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.20	25.0	1	1	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	663-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	112-UNIMOD:4	0.13	25.0	3	2	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	260-UNIMOD:4,271-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	474-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	82-UNIMOD:21,80-UNIMOD:28	0.05	24.0	2	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	207-UNIMOD:21,212-UNIMOD:4	0.00	24.0	2	1	0
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.23	24.0	2	2	2
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	225-UNIMOD:4	0.05	24.0	2	2	2
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	24.0	2	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	57-UNIMOD:21	0.13	24.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	2	2	2
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	62-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	722-UNIMOD:21,717-UNIMOD:35	0.05	24.0	3	2	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	186-UNIMOD:35,193-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	335-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	487-UNIMOD:35,488-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.14	23.0	4	4	4
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.08	23.0	2	2	2
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	249-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q53EL6|PDCD4_HUMAN	Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|O00180|KCNK1_HUMAN	Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	329-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P04439|HLAA_HUMAN	HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	848-UNIMOD:21,2102-UNIMOD:21,2104-UNIMOD:21,1003-UNIMOD:21,1043-UNIMOD:21,2100-UNIMOD:21,866-UNIMOD:21	0.03	23.0	7	4	1
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	37-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|Q9HB09|B2L12_HUMAN	Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	242-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	4521-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	394-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P29803|ODPAT_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	291-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	1877-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	417-UNIMOD:4,420-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	136-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	105-UNIMOD:4	0.06	21.0	2	2	2
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	19-UNIMOD:21,23-UNIMOD:21	0.06	21.0	2	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	43-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1106-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	21.0	5	2	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	3	3	3
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	401-UNIMOD:21	0.02	20.0	3	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	165-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P28074|PSB5_HUMAN	Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	115-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q9H4G0|E41L1_HUMAN	Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	2	2	2
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	321-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	183-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P00505|AATM_HUMAN	Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	2	2	2
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	161-UNIMOD:4	0.21	19.0	4	4	4
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	332-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	2047-UNIMOD:21	0.00	19.0	1	1	1
PRT	sp|Q9H7D7|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	121-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	330-UNIMOD:35	0.03	19.0	2	1	0
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	404-UNIMOD:35	0.03	19.0	2	1	0
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	124-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q9BXP5|SRRT_HUMAN	Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	67-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1942-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,2-UNIMOD:21,9-UNIMOD:4,12-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	3	3	3
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1131-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	38-UNIMOD:21	0.10	18.0	2	2	2
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.18	18.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	183-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q58FF3|ENPLL_HUMAN	Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q03393|PTPS_HUMAN	6-pyruvoyl tetrahydrobiopterin synthase OS=Homo sapiens OX=9606 GN=PTS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	19-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1915-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	37-UNIMOD:21	0.08	17.0	2	2	2
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	609-UNIMOD:21,68-UNIMOD:4,75-UNIMOD:4	0.03	17.0	2	2	2
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P27482|CALL3_HUMAN	Calmodulin-like protein 3 OS=Homo sapiens OX=9606 GN=CALML3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|O75347|TBCA_HUMAN	Tubulin-specific chaperone A OS=Homo sapiens OX=9606 GN=TBCA PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q8TD16|BICD2_HUMAN	Protein bicaudal D homolog 2 OS=Homo sapiens OX=9606 GN=BICD2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	582-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	177-UNIMOD:21	0.00	16.0	1	1	1
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	273-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	260-UNIMOD:21	0.04	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LHSAEQDADDEAADDTDDTSSVTSSASSTTSSQSGSGTSR	1	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	54.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3307.2	25.72858	4	4042.586894	4042.579248	R	K	473	513
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	2	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	53.0	2-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2957.3	20.20925	4	3178.170094	3178.161241	R	K	494	522
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	3	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0		ms_run[1]:scan=1.1.3755.2	34.59703	4	3223.245294	3223.230486	K	-	122	148
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	4	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0		ms_run[1]:scan=1.1.3622.3	32.2395	4	4445.574894	4445.553592	K	G	177	218
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	5	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	50.0		ms_run[1]:scan=1.1.3611.2	32.0137	4	4445.574894	4445.553592	K	G	177	218
PSM	NGSLDSPGKQDTEEDEEEDEK	6	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	48.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2996.2	20.69823	3	2429.928971	2429.923149	K	D	134	155
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	7	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4303.2	42.0857	3	2988.171671	2988.155727	K	E	144	170
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVK	8	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	47.0		ms_run[1]:scan=1.1.3689.3	33.43163	4	4117.466894	4117.448322	K	K	158	194
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	9	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	15-UNIMOD:21	ms_run[1]:scan=1.1.4425.3	43.7857	3	3014.201171	3014.188484	K	-	661	690
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	10	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	46.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4405.2	43.45242	3	3393.359171	3393.345713	K	F	86	114
PSM	TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	11	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	3-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3671.4	33.06798	3	3340.238171	3340.220589	R	G	294	325
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	12	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=1.1.3702.5	33.63228	4	4118.454894	4118.435708	K	A	142	177
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	13	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3551.4	30.96963	3	2742.075371	2742.064016	R	E	424	448
PSM	ATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	14	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	6-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3511.3	30.14437	4	3668.425694	3668.406493	K	G	291	325
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	15	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3664.5	32.92967	3	3722.213171	3722.195067	K	A	158	190
PSM	DATNVGDEGGFAPNILENK	16	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.4476.2	44.3266	3	1959.927071	1959.917400	K	E	203	222
PSM	DNLTLWTSDTQGDEAEAGEGGEN	17	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.4766.2	47.92105	3	2407.999271	2407.988786	R	-	223	246
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	18	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3398.3	27.70545	4	3365.461294	3365.451593	K	K	799	833
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	19	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4419.2	43.67532	3	3393.359171	3393.345713	K	F	86	114
PSM	DKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQR	20	sp|Q8N7H5|PAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.3403.3	27.83193	5	4505.743118	4505.722755	R	S	449	493
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	21	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[1]:scan=1.1.3293.2	25.44948	3	2795.101571	2795.089914	K	M	571	596
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	22	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	19-UNIMOD:21	ms_run[1]:scan=1.1.4263.2	41.62112	3	2988.168671	2988.155727	K	E	144	170
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	23	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.3744.2	34.3957	4	3223.245294	3223.230486	K	-	122	148
PSM	DNLTLWTSDTQGDEAEAGEGGEN	24	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.4781.2	48.12522	3	2407.999271	2407.988786	R	-	223	246
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	25	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4279.2	41.8673	3	2988.171671	2988.155727	K	E	144	170
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	26	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.3595.3	31.75527	3	3722.213171	3722.195067	K	A	158	190
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	27	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=1.1.3652.6	32.72667	3	3722.213171	3722.195067	K	A	158	190
PSM	VPSPLEGSEGDGDTD	28	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3652.3	32.71667	2	1553.581447	1553.577043	K	-	413	428
PSM	SLDSDESEDEEDDYQQK	29	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3258.2	24.88402	3	2110.743671	2110.737580	K	R	57	74
PSM	DNLTLWTADNAGEEGGEAPQEPQS	30	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.4782.2	48.1509	3	2528.103671	2528.093920	R	-	225	249
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	31	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3459.4	29.06222	3	2779.104971	2779.094999	K	M	571	596
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	32	sp|P34932|HSP74_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3407.4	27.90773	4	3365.461294	3365.451593	K	K	799	833
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	33	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	34-UNIMOD:35	ms_run[1]:scan=1.1.3424.2	28.25132	4	4134.454894	4134.430623	K	A	142	177
PSM	DVAEAKPELSLLGDGDH	34	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.4159.2	40.32668	3	1764.857771	1764.853008	R	-	232	249
PSM	DNLTLWTSDMQGDGEEQNK	35	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.4608.2	45.80592	3	2179.940771	2179.932792	R	E	226	245
PSM	DTSSITSCGDGNVVKQEQLSPK	36	sp|Q9Y6Q9|NCOA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	8-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3532.2	30.52272	3	2429.085671	2429.078150	K	K	709	731
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	37	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3795.2	35.30258	3	3044.165171	3044.151982	K	L	595	622
PSM	TPEELDDSDFETEDFDVR	38	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4955.2	49.591	3	2237.859971	2237.852550	R	S	634	652
PSM	DSGSDEDFLMEDDDDSDYGSSK	39	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.4312.2	42.22775	3	2427.876071	2427.865619	K	K	129	151
PSM	DNLTLWTSDSAGEECDAAEGAEN	40	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4866.2	48.85572	3	2453.988371	2453.976507	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	41	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3500.4	29.96833	3	2483.104871	2483.096577	K	L	45	68
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	42	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.3560.4	31.14253	4	4431.630894	4431.610713	K	A	139	177
PSM	NVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVK	43	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0		ms_run[1]:scan=1.1.3705.2	33.70835	5	5277.7432	5277.7112	K	E	231	275
PSM	DDDIAALVVDNGSGMCK	44	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.5698.2	55.22675	2	1820.7955	1820.7915	M	A	2	19
PSM	AASPPASASDLIEQQQK	45	sp|Q5VSL9|STRP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3771.2	34.88262	3	1819.841171	1819.835324	R	R	333	350
PSM	DNLTLWTSDMQGDGEEQNK	46	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4626.3	46.0178	3	2179.940771	2179.932792	R	E	226	245
PSM	DNLTLWTADNAGEEGGEAPQEPQS	47	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4767.2	47.9456	3	2528.103671	2528.093920	R	-	225	249
PSM	LVQDVANNTNEEAGDGTTTATVLAR	48	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3735.3	34.18607	3	2559.253871	2559.241253	K	S	97	122
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	49	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	35-UNIMOD:35	ms_run[1]:scan=1.1.3391.3	27.56952	4	4461.570894	4461.548507	K	G	177	218
PSM	DNLTLWTSDQQDDDGGEGNN	50	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4643.2	46.32877	3	2192.880371	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	51	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.4787.2	48.20077	3	2193.876971	2192.873028	R	-	228	248
PSM	PCSEETPAISPSK	52	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3132.2	22.69498	2	1481.6131	1481.6104	M	R	2	15
PSM	NLDIERPTYTNLNR	53	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3687.2	33.38093	3	1717.880171	1717.874747	R	L	216	230
PSM	TPEELDDSDFETEDFDVR	54	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4931.2	49.38754	3	2237.859971	2237.852550	R	S	634	652
PSM	DNLTLWTSENQGDEGDAGEGEN	55	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4627.2	46.04285	3	2349.954971	2349.946922	R	-	225	247
PSM	NGSLDSPGKQDTEEDEEEDEK	56	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.2958.2	20.22463	3	2349.964871	2349.956818	K	D	134	155
PSM	IVRGDQPAASGDSDDDEPPPLPR	57	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3491.5	29.7598	3	2483.104871	2483.096577	K	L	45	68
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	58	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3576.3	31.47742	3	2651.013971	2651.000036	K	M	572	596
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKK	59	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3511.6	30.15437	4	4245.562894	4245.543285	K	S	158	195
PSM	GVVDSEDLPLNISR	60	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4310.2	42.18677	2	1512.782647	1512.778387	R	E	387	401
PSM	ADQLTEEQIAEFK	61	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4778.2	48.08785	2	1562.7505	1562.7459	M	E	2	15
PSM	PCSEETPAISPSK	62	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3122.2	22.48402	2	1481.6131	1481.6104	M	R	2	15
PSM	DNLTLWTSDQQDDDGGEGNN	63	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4665.2	46.76378	3	2192.880371	2192.873028	R	-	228	248
PSM	DNLTLWTSENQGDEGDAGEGEN	64	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4639.2	46.2323	3	2349.954971	2349.946922	R	-	225	247
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	65	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3549.3	30.91938	4	4431.630894	4431.610713	K	A	139	177
PSM	DNLTLWTSDQQDDDGGEGNN	66	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4754.3	47.79233	3	2193.874571	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	67	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4734.2	47.58027	3	2193.874571	2192.873028	R	-	228	248
PSM	VPSPLEGSEGDGDTD	68	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3664.2	32.91633	2	1553.581447	1553.577043	K	-	413	428
PSM	DATNVGDEGGFAPNILENK	69	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.4459.2	44.1262	3	1959.927071	1959.917400	K	E	203	222
PSM	SQSLPNSLDYTQTSDPGR	70	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3844.2	36.15565	3	2044.879271	2044.873894	R	H	44	62
PSM	SQSLPNSLDYTQTSDPGR	71	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3829.2	35.94283	3	2044.879271	2044.873894	R	H	44	62
PSM	DNLTLWTSDMQGDGEEQNK	72	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4132.3	39.94613	3	2195.935271	2195.927707	R	E	226	245
PSM	TAAKGEAAAERPGEAAVASSPSK	73	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2878.2	19.10942	4	2235.061294	2235.053256	K	A	8	31
PSM	NGSLDSPGKQDTEEDEEEDEK	74	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2976.3	20.47832	3	2429.928971	2429.923149	K	D	134	155
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	75	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.3608.4	31.95683	3	3722.213171	3722.195067	K	A	158	190
PSM	ADKPDMGEIASFDK	76	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4135.2	40.00257	2	1564.7125	1564.7074	M	A	2	16
PSM	PFSAPKPQTSPSPK	77	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3178.3	23.48943	3	1547.742071	1547.738510	K	R	299	313
PSM	LIAPVAEEEATVPNNK	78	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3672.2	33.09322	3	1693.893671	1693.888666	K	I	8	24
PSM	DAGDKDKEQELSEEDK	79	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.2842.2	18.70322	3	1834.809671	1834.806846	R	Q	35	51
PSM	YFQINQDEEEEEDED	80	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3910.2	37.2466	2	1930.727447	1930.722842	R	-	114	129
PSM	HTGCCGDNDPIDVCEIGSK	81	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3559.5	31.11718	3	2132.862071	2132.856139	K	V	110	129
PSM	DNLTLWTSDQQDDDGGEGNN	82	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4714.2	47.38962	3	2192.883371	2192.873028	R	-	228	248
PSM	NTNDANSCQIIIPQNQVNR	83	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3609.2	31.98227	3	2198.058971	2198.049828	K	K	310	329
PSM	DYEEVGVDSVEGEGEEEGEEY	84	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4516.2	44.92247	3	2347.906871	2347.897571	K	-	431	452
PSM	DNLTLWTSDTQGDEAEAGEGGEN	85	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4802.2	48.3307	3	2407.999271	2407.988786	R	-	223	246
PSM	DSGSDEDFLMEDDDDSDYGSSK	86	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4323.3	42.45892	3	2427.876071	2427.865619	K	K	129	151
PSM	AQGPAASAEEPKPVEAPAANSDQTVTVKE	87	sp|P80723|BASP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3416.3	28.1053	4	2891.428894	2891.414861	K	-	199	228
PSM	WVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPK	88	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:21,30-UNIMOD:4	ms_run[1]:scan=1.1.3794.4	35.27715	4	4316.586894	4316.565632	K	K	1026	1063
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	89	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=1.1.3651.2	32.70105	4	3040.134894	3040.124922	R	E	92	118
PSM	HVPDSGATATAYLCGVK	90	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3816.2	35.66785	3	1825.810271	1825.807001	K	G	110	127
PSM	YHTSQSGDEMTSLSEYVSR	91	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3946.2	37.89855	3	2175.942671	2175.937877	R	M	457	476
PSM	DNLTLWTSDQQDDDGGEGNN	92	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4697.2	47.18923	3	2192.883371	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	93	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4127.2	39.85587	4	2195.934094	2195.927707	R	E	226	245
PSM	AGEEDEGEEDSDSDYEISAK	94	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3420.2	28.17732	3	2253.805871	2253.795823	R	A	463	483
PSM	DSGSDEDFLMEDDDDSDYGSSKK	95	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3917.2	37.41652	3	2555.971571	2555.960582	K	K	129	152
PSM	LNEVSSDANRENAAAESGSESSSQEATPEK	96	sp|Q9H6Z4|RANB3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	27-UNIMOD:21	ms_run[1]:scan=1.1.3114.3	22.3779	4	3173.335294	3173.326984	K	E	337	367
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	97	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	20-UNIMOD:21,32-UNIMOD:4	ms_run[1]:scan=1.1.4176.2	40.64363	4	3813.499294	3813.463279	R	G	32	65
PSM	DSAQNSVIIVDK	98	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3441.2	28.6264	2	1287.671647	1287.667045	K	N	194	206
PSM	DLEEDHACIPIKK	99	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3349.2	26.60437	2	1566.771047	1566.771193	K	S	560	573
PSM	NSSLLSFDNEDENE	100	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4475.2	44.30255	2	1611.659047	1611.653640	K	-	141	155
PSM	STAGDTHLGGEDFDNR	101	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3290.2	25.37357	3	1690.723271	1690.718306	K	M	224	240
PSM	SYELPDGQVITIGNER	102	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4698.2	47.21407	3	1789.891871	1789.884643	K	F	241	257
PSM	HVPDSGATATAYLCGVK	103	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3827.2	35.87857	3	1825.810271	1825.807001	K	G	110	127
PSM	DLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNK	104	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	20-UNIMOD:35	ms_run[1]:scan=1.1.3915.2	37.36797	4	4283.678894	4283.662252	K	L	164	202
PSM	DNLTLWTSDQQDDDGGEGNN	105	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4652.2	46.55655	3	2192.880371	2192.873028	R	-	228	248
PSM	DNLTLWTSDTQGDEAEAGEGGEN	106	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4748.2	47.71682	3	2407.999271	2407.988786	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	107	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3512.3	30.17992	4	2483.104494	2483.096577	K	L	45	68
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	108	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:4,8-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3724.2	33.9639	4	3213.356494	3213.342046	K	F	173	200
PSM	DKEEIFGSDADSEDDADSDDEDRGQAQGGSDNDSDSGSNGGGQR	109	sp|Q8N7H5|PAF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3407.5	27.9144	4	4505.738894	4505.722755	R	S	449	493
PSM	SDAAVDTSSEITTK	110	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3477.2	29.44305	2	1465.6838	1465.6779	M	D	2	16
PSM	HGGPKDEERHVGDLGNVTADK	111	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3214.2	24.2242	4	2230.081294	2230.072672	K	D	72	93
PSM	EALQDVEDENQ	112	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3395.3	27.63072	2	1288.544247	1288.541905	K	-	245	256
PSM	PCSEETPAISPSK	113	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3108.2	22.2835	2	1481.6131	1481.6104	M	R	2	15
PSM	RNSLTGEEGQLAR	114	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3297.2	25.50282	3	1509.694571	1509.693685	R	V	110	123
PSM	LTFDSSFSPNTGKK	115	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3762.2	34.70925	3	1607.725271	1607.723254	K	N	97	111
PSM	DYTGCSTSESLSPVK	116	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3476.4	29.41767	2	1709.691647	1709.685548	R	Q	199	214
PSM	GDRSEDFGVNEDLADSDAR	117	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3671.3	33.06132	3	2066.885771	2066.877720	K	A	186	205
PSM	TPVDESDDEIQHDEIPTGK	118	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3557.5	31.06312	3	2203.919771	2203.915819	R	C	923	942
PSM	ERIQQFDDGGSDEEDIWEEK	119	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4361.4	42.92723	3	2504.008571	2504.001674	K	H	607	627
PSM	NGSLDSPGKQDTEEDEEEDEK	120	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3063.3	21.6428	3	2430.915971	2429.923149	K	D	134	155
PSM	RQAQQERDELADEIANSSGK	121	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3482.3	29.55062	4	2244.080894	2244.073066	K	G	1697	1717
PSM	TAFQEALDAAGDK	122	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4017.3	38.66287	2	1335.633647	1335.630660	K	L	9	22
PSM	EGLELPEDEEEK	123	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3638.2	32.56365	2	1415.635447	1415.630385	K	K	412	424
PSM	TPELNLDQFHDK	124	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3798.2	35.36032	3	1455.700571	1455.699408	K	T	171	183
PSM	DINAYNCEEPTEK	125	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3289.2	25.34848	2	1581.662647	1581.661702	K	L	85	98
PSM	GEAAAERPGEAAVASSPSK	126	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2916.3	19.6007	3	1863.840671	1863.836387	K	A	12	31
PSM	SGPKPFSAPKPQTSPSPK	127	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	16-UNIMOD:21	ms_run[1]:scan=1.1.3153.2	23.04058	4	1916.943294	1916.939729	R	R	295	313
PSM	INSSGESGDESDEFLQSR	128	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3774.2	34.9089	3	2035.806971	2035.800789	R	K	180	198
PSM	RKAEDSDSEPEPEDNVR	129	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2853.2	18.82553	3	2051.846771	2051.843322	K	L	494	511
PSM	DYEEVGADSADGEDEGEEY	130	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3827.4	35.8919	2	2077.745447	2077.739614	K	-	431	450
PSM	DNLTLWTSDQQDDDGGEGNN	131	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4808.2	48.40398	3	2192.880971	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	132	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4679.2	46.95145	3	2192.883371	2192.873028	R	-	228	248
PSM	STTPPPAEPVSLPQEPPKPR	133	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3634.3	32.48962	3	2204.095271	2204.087850	K	V	225	245
PSM	DYHFKVDNDENEHQLSLR	134	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3637.3	32.5414	4	2258.043694	2258.035223	K	T	28	46
PSM	ETWDTAEEDSGTDSEYDESGK	135	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3615.3	32.11577	3	2429.860571	2429.854400	K	S	1004	1025
PSM	KVEEEQEADEEDVSEEEAESK	136	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3222.4	24.38707	3	2437.024871	2437.013998	K	E	234	255
PSM	DNLTLWTSDQQDDDGGEGNN	137	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4769.2	47.99418	3	2193.876971	2192.873028	R	-	228	248
PSM	NPDDITNEEYGEFYK	138	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4111.2	39.65732	3	1832.783471	1832.774089	R	S	300	315
PSM	EALQDVEDENQ	139	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3384.2	27.40658	2	1288.544247	1288.541905	K	-	245	256
PSM	IVSAQSLAEDDVE	140	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3920.2	37.47082	2	1374.651047	1374.651455	R	-	133	146
PSM	DRVHHEPQLSDK	141	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2700.2	17.64897	3	1459.720571	1459.716790	K	V	26	38
PSM	KYEEIDNAPEER	142	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3081.3	21.85058	3	1491.687971	1491.684152	K	A	91	103
PSM	NRVIGSGCNLDSAR	143	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3126.3	22.54705	3	1517.739971	1517.736873	K	F	156	170
PSM	EYIPGQPPLSQSSDSSPTRNSEPAGLETPEAK	144	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	21-UNIMOD:21	ms_run[1]:scan=1.1.4004.2	38.50165	4	3448.582894	3448.567155	K	V	871	903
PSM	NQTAEKEEFEHQQK	145	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2755.2	18.0336	3	1744.803671	1744.801642	K	E	584	598
PSM	HVPDSGATATAYLCGVK	146	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3842.2	36.0952	3	1825.810271	1825.807001	K	G	110	127
PSM	EVLDEDTDEEKETLK	147	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3442.2	28.65173	3	1871.797871	1871.792516	K	N	990	1005
PSM	DKGDEEEEGEEKLEEK	148	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3107.3	22.25748	3	1891.820471	1891.817077	K	Q	536	552
PSM	DDKHGSYEDAVHSGALND	149	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3310.2	25.80478	4	1928.819294	1928.813663	K	-	539	557
PSM	KEESEESDDDMGFGLFD	150	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.5239.2	52.12537	2	1948.763447	1948.752033	K	-	98	115
PSM	DYEEVGADSADGEDEGEEY	151	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3842.3	36.1052	2	2077.745447	2077.739614	K	-	431	450
PSM	DNLTLWTSDMQGDGEEQNK	152	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4640.3	46.25986	3	2179.939571	2179.932792	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	153	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4115.2	39.72968	3	2195.935271	2195.927707	R	E	226	245
PSM	EVEDKESEGEEEDEDEDLSK	154	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3153.3	23.05058	3	2418.901871	2418.895931	K	Y	147	167
PSM	NGSLDSPGKQDTEEDEEEDEKDK	155	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2914.3	19.55148	4	2673.052094	2673.045055	K	G	134	157
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	156	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4411.2	43.55528	3	3014.201171	3014.188484	K	-	661	690
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	157	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3636.4	32.522	3	3722.213171	3722.195067	K	A	158	190
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	158	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3251.2	24.73577	5	3566.443118	3565.448950	K	D	124	155
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	159	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3218.2	24.2861	5	3486.485618	3485.482619	K	D	124	155
PSM	ALLLLCGEDD	160	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4976.2	49.73977	2	1117.535447	1117.532526	K	-	311	321
PSM	VEIIANDQGNR	161	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3176.2	23.42923	2	1227.622647	1227.620764	R	I	50	61
PSM	EAAAQEAGADTPGKGEPPAPKSPPK	162	sp|O95466|FMNL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3038.2	21.31733	4	2480.168094	2480.158449	K	A	1010	1035
PSM	DGNGYISAAELR	163	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3779.2	34.9983	2	1264.606247	1264.604780	K	H	96	108
PSM	DNNQFASASLDR	164	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3453.3	28.91067	2	1336.604047	1336.600757	K	T	154	166
PSM	SNSGVRLDGYAR	165	sp|P46020|KPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3361.2	26.8882	3	1373.613071	1373.608893	R	L	5	17
PSM	DSVFLSCSEDNR	166	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3600.2	31.82672	2	1427.601047	1427.598708	K	I	180	192
PSM	DNPGVVTCLDEAR	167	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3685.2	33.33057	2	1444.664447	1444.661643	K	H	227	240
PSM	DNLTLWTSDQQDDDGGEGNN	168	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4938.2	49.44952	3	2192.880071	2192.873028	R	-	228	248
PSM	LVEDERSDREETESSEGEEAAAGGGAK	169	sp|Q96G23|CERS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=1.1.3080.3	21.8253	4	2967.178094	2967.165595	K	S	335	362
PSM	TGSTSSKEDDYESDAATIVQK	170	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3717.2	33.89793	3	2310.982571	2310.974062	R	C	360	381
PSM	NGRVEIIANDQGNR	171	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3123.2	22.49985	3	1554.790871	1554.786266	K	I	47	61
PSM	ATAGDTHLGGEDFDNR	172	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3298.2	25.53767	3	1674.726671	1674.723391	K	L	221	237
PSM	NRPTSISWDGLDSGK	173	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4005.2	38.5271	3	1711.757471	1711.756680	K	L	48	63
PSM	DRSSFYVNGLTLGGQK	174	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4133.2	39.9713	3	1740.885371	1740.879498	K	C	55	71
PSM	YNDWSDDDDDSNESK	175	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3291.2	25.38862	2	1883.605647	1883.600692	R	S	57	72
PSM	KEESEESDDDMGFGLFD	176	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:35	ms_run[1]:scan=1.1.4560.2	45.31262	3	1964.753471	1964.746948	K	-	98	115
PSM	SLDSDESEDEEDDYQQK	177	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3204.3	23.99303	3	2030.777171	2030.771249	K	R	57	74
PSM	DNLTLWTSDMQGDGEEQNK	178	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4168.4	40.49672	3	2195.935271	2195.927707	R	E	226	245
PSM	KLEKEEEEGISQESSEEEQ	179	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3127.4	22.57298	3	2235.993071	2235.986661	K	-	89	108
PSM	DNLTLWTSDSAGEECDAAEGAEN	180	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4839.2	48.65187	3	2453.988371	2453.976507	R	-	223	246
PSM	NGSLDSPGKQDTEEDEEEDEKDK	181	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2913.2	19.5267	4	2593.090494	2593.078724	K	G	134	157
PSM	NGSLDSPGKQDTEEDEEEDEK	182	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3066.3	21.69893	3	2350.949771	2349.956818	K	D	134	155
PSM	ASGVAVSDGVIK	183	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4109.2	39.62547	2	1223.5814	1223.5794	M	V	2	14
PSM	YALYDATYETK	184	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3706.2	33.73338	2	1336.622847	1336.618698	R	E	82	93
PSM	SGKYDLDFKSPDDPSR	185	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3507.2	30.05253	4	1825.854894	1825.848257	R	Y	254	270
PSM	GTPMKPNTQATPP	186	sp|P05362|ICAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3150.2	22.99403	2	1418.627447	1418.626517	K	-	520	533
PSM	NIIHGSDSVESAEK	187	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3104.2	22.22022	3	1484.712071	1484.710701	R	E	115	129
PSM	DVTPPPETEVVLIK	188	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4626.2	46.0078	3	1615.812971	1615.811007	K	N	519	533
PSM	NQLTSNPENTVFDAK	189	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3735.2	34.17607	3	1676.805671	1676.800579	K	R	82	97
PSM	QDENDDDDDWNPCK	190	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3443.2	28.67702	3	1764.621071	1764.616937	K	A	333	347
PSM	HVPDSGATATAYLCGVK	191	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3858.2	36.2959	3	1825.810271	1825.807001	K	G	110	127
PSM	NPDDITQEEYGEFYK	192	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4155.2	40.26395	3	1846.796171	1846.789740	R	S	292	307
PSM	DLEAEHVEVEDTTLNR	193	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3716.4	33.87273	3	1868.877971	1868.875201	R	C	15	31
PSM	NGVIQHTGAAAEEFNDDTD	194	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3624.3	32.28363	3	2082.823271	2082.816773	R	-	646	665
PSM	DNLTLWTSDQQDEEAGEGN	195	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4681.2	47.00462	3	2120.884571	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	196	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4863.2	48.81848	3	2192.880971	2192.873028	R	-	228	248
PSM	QENCGAQQVPAGPGTSTPPSSPVR	197	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3450.4	28.8539	3	2501.106371	2501.100617	R	T	257	281
PSM	NGSLDSPGKQDTEEDEEEDEKDK	198	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2932.2	19.77395	4	2673.052094	2673.045055	K	G	134	157
PSM	NQIHVKSPPREGSQGELTPANSQSR	199	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3164.3	23.19455	4	2796.340894	2796.330434	R	M	462	487
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	200	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3220.3	24.33047	5	3566.447118	3565.448950	K	D	124	155
PSM	QLSSGVSEIR	201	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3452.2	28.88523	2	1154.535447	1154.533268	R	H	80	90
PSM	LGMLSPEGTCK	202	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3703.2	33.64777	2	1271.530847	1271.529111	R	A	203	214
PSM	ELISNSSDALDK	203	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3413.3	28.02958	2	1290.631647	1290.630326	R	I	47	59
PSM	LPQPPEGQTYNN	204	sp|Q15819|UB2V2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3428.4	28.3534	2	1356.634447	1356.630994	K	-	134	146
PSM	TLEEDEEELFK	205	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4512.2	44.86013	2	1380.631847	1380.629657	K	M	40	51
PSM	DMNQVLDAYENK	206	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4367.2	43.00333	2	1438.646247	1438.639844	R	K	142	154
PSM	DNPGVVTCLDEAR	207	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3688.2	33.39628	3	1444.663271	1444.661643	K	H	227	240
PSM	HELQANCYEEVK	208	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3183.2	23.59668	3	1518.681371	1518.677293	K	D	133	145
PSM	VPSPLEGSEGDGDTD	209	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3675.4	33.126	2	1553.581447	1553.577043	K	-	413	428
PSM	LTFDSSFSPNTGKK	210	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3749.2	34.50383	3	1607.725271	1607.723254	K	N	97	111
PSM	NSFREQLEEEEEAK	211	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3585.2	31.57605	3	1736.788871	1736.785323	K	H	1339	1353
PSM	QVPDSAATATAYLCGVK	212	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4348.2	42.73405	3	1830.828071	1830.822317	R	A	107	124
PSM	TAENATSGETLEENEAGD	213	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3300.5	25.58797	2	1836.754847	1836.749725	K	-	377	395
PSM	QLEDGRTLSDYNIQK	214	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3666.2	32.96055	3	1858.851971	1858.846223	K	E	49	64
PSM	MKDTDSEEEIREAFR	215	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35	ms_run[1]:scan=1.1.3598.2	31.79347	4	1870.840094	1870.836707	K	V	77	92
PSM	KMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGK	216	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3455.4	28.95478	4	3943.372094	3943.362484	K	Q	214	249
PSM	DLLLTSSYLSDSGSTGEHTK	217	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4270.2	41.696	3	2110.016771	2110.006609	K	S	397	417
PSM	STIGVMVTASHNPEEDNGVK	218	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3658.2	32.86595	3	2163.955571	2163.950764	K	L	55	75
PSM	STTPPPAEPVSLPQEPPKPR	219	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3634.2	32.47962	4	2204.094494	2204.087850	K	V	225	245
PSM	DNLTLWTADNAGEEGGEAPQEPQS	220	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4803.2	48.35517	3	2528.103671	2528.093920	R	-	225	249
PSM	NQIHVKSPPREGSQGELTPANSQSR	221	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3175.2	23.40398	4	2796.340894	2796.330434	R	M	462	487
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	222	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=1.1.4653.3	46.58064	3	2881.109471	2881.094982	K	T	701	725
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	223	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3675.6	33.13267	3	3722.213171	3722.195067	K	A	158	190
PSM	DDDIAALVVDNGSGMCK	224	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.5168.2	51.20078	3	1836.7889	1836.7865	M	A	2	19
PSM	NGSLDSPGKQDTEEDEEEDEK	225	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3094.3	22.00077	3	2430.912371	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEK	226	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3043.3	21.44083	3	2430.915971	2429.923149	K	D	134	155
PSM	MLAESDESGDEESVSQTDKTELQNTLR	227	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=1.1.3922.2	37.50638	4	3107.324494	3107.312580	K	T	186	213
PSM	QLSSGVSEIR	228	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4217.2	41.03993	2	1137.5083	1137.5062	R	H	80	90
PSM	KHHEEEIVHHKK	229	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2848.2	18.77673	4	1549.816894	1549.811359	K	E	72	84
PSM	AGFAGDDAPR	230	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3064.2	21.66792	2	975.442047	975.441009	K	A	21	31
PSM	DGGFCEVCK	231	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3215.3	24.24905	2	1070.416447	1070.416116	K	K	405	414
PSM	ALLYLCGGDD	232	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4558.2	45.2818	2	1095.493447	1095.490661	K	-	330	340
PSM	MSGFIYQGK	233	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3539.3	30.68268	2	1125.459247	1125.456598	R	I	487	496
PSM	VTLTSEEEAR	234	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3131.2	22.6609	2	1133.557847	1133.556432	K	L	306	316
PSM	YIDQEELNK	235	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3207.2	24.06768	2	1150.550847	1150.550619	K	T	198	207
PSM	VEVTEFEDIK	236	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3935.2	37.75218	2	1207.601047	1207.597235	K	S	133	143
PSM	NLEELNISSAQ	237	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4054.2	39.0555	2	1216.598647	1216.593546	K	-	120	131
PSM	EQVANSAFVER	238	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3319.3	26.02532	2	1248.611647	1248.609865	K	V	365	376
PSM	EDQTEYLEER	239	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3360.4	26.86283	2	1310.566247	1310.562640	K	R	166	176
PSM	NSNPALNDNLEK	240	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3210.2	24.1428	2	1327.640847	1327.636808	K	G	120	132
PSM	DFTPVCTTELGR	241	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3885.2	36.87425	2	1394.653447	1394.650015	R	A	42	54
PSM	RFDDAVVQSDMK	242	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3425.3	28.27778	3	1409.665571	1409.660914	R	H	77	89
PSM	LTFDSSFSPNTGK	243	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4147.2	40.1739	2	1479.631447	1479.628291	K	K	97	110
PSM	NNAYLAQSPQLYK	244	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3800.2	35.40093	3	1588.732871	1588.728674	K	Q	242	255
PSM	DSGRGDSVSDSGSDALR	245	sp|Q53EL6|PDCD4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3004.3	20.78638	3	1679.735771	1679.734684	R	S	70	87
PSM	CIPALDSLTPANEDQK	246	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4172.3	40.59822	3	1770.849671	1770.845815	R	I	447	463
PSM	QVPDSAATATAYLCGVK	247	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4362.3	42.95288	3	1830.828071	1830.822317	R	A	107	124
PSM	DAINQGMDEELERDEK	248	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3653.2	32.74188	3	1890.832871	1890.826536	R	V	37	53
PSM	IISSIEQKEENKGGEDK	249	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2987.2	20.56652	4	1902.961294	1902.953451	R	L	62	79
PSM	FQEQECPPSPEPTRK	250	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3102.3	22.16347	3	1908.812171	1908.807729	K	E	178	193
PSM	NGVIQHTGAAAEEFNDDTD	251	sp|Q8WU17|RN139_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3613.3	32.05824	3	2082.823271	2082.816773	R	-	646	665
PSM	QNEPFVATQSSACVDGPANH	252	sp|O00180|KCNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3563.4	31.21248	3	2127.939071	2127.927981	K	-	317	337
PSM	DNLTLWTSDQQDDDGGEGNN	253	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4911.2	49.24502	3	2192.880071	2192.873028	R	-	228	248
PSM	ESEDKPEIEDVGSDEEEEKK	254	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3206.3	24.03617	4	2320.014894	2320.007791	K	D	251	271
PSM	DNLTLWTSENQGDEGDAGEGEN	255	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4673.2	46.87083	3	2349.954071	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	256	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4895.2	49.12798	3	2349.955271	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	257	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3933.2	37.6886	3	2443.869671	2443.860534	K	K	129	151
PSM	DGEDQTQDTELVETRPAGDGTFQK	258	sp|P04439|HLAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3625.3	32.30913	3	2636.195771	2636.183798	R	W	244	268
PSM	SGTPPRQGSITSPQANEQSVTPQRR	259	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3194.2	23.7992	4	2758.324894	2758.314784	K	S	846	871
PSM	NHSGSRTPPVALNSSR	260	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3078.2	21.79385	3	1838.788571	1838.782591	R	M	2098	2114
PSM	ASGVAVSDGVIK	261	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4087.2	39.4125	2	1223.5814	1223.5794	M	V	2	14
PSM	QEYDESGPSIVHRK	262	sp|Q9BYX7|ACTBM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3091.2	21.95073	4	1643.792094	1643.790349	K	C	360	374
PSM	LKDDEVAQLKK	263	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3012.2	20.94898	3	1285.725971	1285.724166	K	S	309	320
PSM	SADTLWGIQK	264	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3877.2	36.67433	2	1117.579047	1117.576774	K	E	319	329
PSM	LGIHEDSTNR	265	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2883.2	19.21408	3	1140.557471	1140.552350	K	R	439	449
PSM	LDIDSPPITAR	266	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3963.2	38.13855	2	1276.608447	1276.606433	R	N	33	44
PSM	AQTPPGPSLSGSK	267	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3166.2	23.24458	2	1305.599847	1305.596597	K	S	1001	1014
PSM	NSLESYAFNMK	268	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3748.2	34.47793	2	1318.588247	1318.586353	K	A	540	551
PSM	LVRLSSDSFAR	269	sp|Q9HB09|B2L12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3676.2	33.14768	3	1329.645971	1329.644216	K	L	238	249
PSM	DVIELTDDSFDK	270	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4400.2	43.4014	2	1395.645047	1395.640556	K	N	161	173
PSM	AFLAELEQNSPK	271	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4356.2	42.84103	2	1425.656647	1425.654112	K	I	4512	4524
PSM	TLRLNQPGTPTR	272	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3209.3	24.1177	3	1432.722071	1432.718778	K	T	386	398
PSM	EFHLNESGDPSSK	273	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3262.2	24.95547	3	1445.646071	1445.642287	K	S	165	178
PSM	VPSPLEGSEGDGDTD	274	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3636.2	32.50867	2	1553.581447	1553.577043	K	-	413	428
PSM	NGRVEIIANDQGNR	275	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3133.3	22.71933	3	1554.790871	1554.786266	K	I	47	61
PSM	YHGHSMSDPGVSYR	276	sp|P29803|ODPAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3165.2	23.21978	3	1671.652571	1671.650106	R	T	287	301
PSM	KASPPSGLWSPAYASH	277	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3959.3	38.07645	3	1734.779771	1734.776687	R	-	1872	1888
PSM	DCEECIQLEPTFIK	278	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.4661.2	46.70105	3	1780.807271	1780.801173	K	G	416	430
PSM	DKPHVNVGTIGHVDHGK	279	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3114.2	22.3679	4	1808.934094	1808.928179	R	T	54	71
PSM	DGQVINETSQHHDDLE	280	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3241.2	24.66102	3	1835.800871	1835.792199	R	-	451	467
PSM	DKSPVREPIDNLTPEER	281	sp|Q14498|RBM39_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3550.2	30.94435	4	2073.981294	2073.973214	K	D	134	151
PSM	DNLTLWTSENQGDEGDAGEGEN	282	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4658.2	46.65453	3	2349.957671	2349.946922	R	-	225	247
PSM	KQEEFDVANNGSSQANK	283	sp|P29144|TPP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3095.3	22.03227	3	1865.838371	1864.855134	R	L	152	169
PSM	KETPPPLVPPAAR	284	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3496.3	29.86718	3	1451.758871	1451.753766	R	E	3	16
PSM	SCNCLLLK	285	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3457.2	29.01162	2	1006.492647	1006.493973	K	V	336	344
PSM	MSGFIYQGK	286	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3833.2	35.98829	2	1109.462647	1109.461683	R	I	487	496
PSM	YLSEVASGDNK	287	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3100.3	22.11372	2	1181.557647	1181.556432	R	Q	130	141
PSM	DIIACGFDINK	288	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=1.1.4383.2	43.19973	2	1264.613047	1264.612173	K	T	221	232
PSM	HKLDVTSVEDYK	289	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3412.2	28.00302	3	1432.717271	1432.719809	K	A	264	276
PSM	HEQNIDCGGGYVK	290	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3041.2	21.39108	3	1475.649671	1475.646327	K	L	99	112
PSM	LGAGGGSPEKSPSAQELK	291	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3182.2	23.56175	3	1791.845471	1791.840409	R	E	13	31
PSM	SSTPPGESYFGVSSLQLK	292	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.5181.2	51.35682	3	1962.900371	1962.897590	K	G	1041	1059
PSM	DSSTSPGDYVLSVSENSR	293	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4577.2	45.49608	3	1978.820771	1978.815711	R	V	39	57
PSM	EAQQKVPDEEENEESDNEKETEK	294	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2894.2	19.33693	4	2813.149694	2813.140018	K	S	1092	1115
PSM	DNSTMGYMMAK	295	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3623.2	32.26482	2	1247.500447	1247.498465	R	K	486	497
PSM	NGSLDSPGKQDTEEDEEEDEKDK	296	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2968.2	20.35408	4	2674.041294	2673.045055	K	G	134	157
PSM	GEPNVSYICSR	297	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3474.2	29.36748	2	1361.550647	1360.548267	R	Y	273	284
PSM	SCINLPTVLPGSPSK	298	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.5527.2	54.13872	2	1690.8031	1690.7996	M	T	2	17
PSM	DANNGNLQLR	299	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3187.3	23.69072	2	1113.556447	1113.552684	K	N	288	298
PSM	SADTLWDIQK	300	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4017.2	38.65287	2	1175.582847	1175.582253	K	D	320	330
PSM	ELISNASDALDK	301	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3601.2	31.85275	2	1274.637847	1274.635411	R	I	103	115
PSM	NFSDNQLQEGK	302	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3219.3	24.30542	2	1278.586447	1278.584044	R	N	161	172
PSM	SSPNPFVGSPPK	303	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3691.3	33.48237	2	1292.582647	1292.580219	K	G	393	405
PSM	SSPNPFVGSPPK	304	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3704.3	33.68333	2	1292.582647	1292.580219	K	G	393	405
PSM	AQTPPGPSLSGSK	305	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3177.2	23.45438	2	1305.599847	1305.596597	K	S	1001	1014
PSM	YSQVLANGLDNK	306	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3483.3	29.56952	2	1320.671047	1320.667380	K	L	95	107
PSM	EQFLDGDGWTSR	307	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4142.2	40.1133	2	1409.625047	1409.621158	K	W	25	37
PSM	TTPSYVAFTDTER	308	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3779.3	35.0083	2	1486.695447	1486.693989	R	L	37	50
PSM	AGDLLEDSPKRPK	309	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3140.2	22.87492	4	1504.730894	1504.728674	R	E	158	171
PSM	DNFGFIETANHDK	310	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3841.2	36.07927	3	1506.676271	1506.673922	K	E	528	541
PSM	NGSEADIDEGLYSR	311	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3562.3	31.18368	2	1524.670647	1524.669230	K	Q	44	58
PSM	PFSAPKPQTSPSPK	312	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3169.2	23.28175	3	1547.742071	1547.738510	K	R	299	313
PSM	RGPGLYYVDSEGNR	313	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3458.2	29.02693	3	1581.755171	1581.753569	K	I	166	180
PSM	LTFDTTFSPNTGKK	314	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3883.2	36.81125	3	1635.758771	1635.754554	K	S	108	122
PSM	DVQDSLTVSNEAQTAK	315	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3449.3	28.82187	3	1704.823271	1704.816623	K	E	211	227
PSM	KASPPSGLWSPAYASH	316	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3980.2	38.27713	3	1734.779771	1734.776687	R	-	1872	1888
PSM	DKPHVNVGTIGHVDHGK	317	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3128.2	22.58473	4	1808.934094	1808.928179	R	T	54	71
PSM	DYSEADGLSERTTPSK	318	sp|Q9H4G0|E41L1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3296.2	25.48715	3	1834.766771	1834.762219	K	A	67	83
PSM	NHSGSRTPPVALNSSR	319	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.3097.2	22.0633	3	1838.782571	1838.782591	R	M	2098	2114
PSM	QLVRGEPNVSYICSR	320	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3632.3	32.45793	3	1856.865971	1856.860433	K	Y	269	284
PSM	DWILPSDYDHAEAEAR	321	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4378.2	43.11942	3	1886.854871	1886.843506	K	H	256	272
PSM	DNLTLWTSDTQGDEAEAGEGGEN	322	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4833.2	48.57755	3	2407.995371	2407.988786	R	-	223	246
PSM	DGDSYDPYDFSDTEEEMPQVHTPK	323	sp|P25205|MCM3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	17-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=1.1.4196.2	40.86375	3	2897.103071	2897.089897	K	T	701	725
PSM	NAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	324	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	37-UNIMOD:35	ms_run[1]:scan=1.1.3333.6	26.27642	4	4447.622894	4447.605628	K	A	139	177
PSM	NGSLDSPGKQDTEEDEEEDEKDK	325	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2999.3	20.72855	4	2594.069694	2593.078724	K	G	134	157
PSM	DGQAMLWDLNEGK	326	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4653.2	46.57063	2	1476.672647	1475.671479	K	H	213	226
PSM	IYQYIQSR	327	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3263.2	24.99055	2	1149.524047	1149.521975	R	F	318	326
PSM	ADEGISFR	328	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3402.2	27.80645	2	893.426447	893.424296	K	G	121	129
PSM	DVIATDKEDVAFK	329	sp|P40925|MDHC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3541.2	30.73438	3	1449.737471	1449.735125	K	D	67	80
PSM	DGGAWGTEQR	330	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3123.3	22.50985	2	1075.470247	1075.468286	K	E	65	75
PSM	DFSPEALKK	331	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3444.2	28.70232	2	1113.513447	1113.510742	K	A	181	190
PSM	DVNQQEFVR	332	sp|P39019|RS19_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3339.2	26.40042	2	1133.547047	1133.546536	K	A	8	17
PSM	DAGMQLQGYR	333	sp|P00505|AATM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3473.3	29.3418	2	1137.526647	1137.523692	R	Y	171	181
PSM	NFEDVAFDEK	334	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3884.3	36.8428	2	1212.532047	1212.529883	K	K	376	386
PSM	DNWEELYNR	335	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4069.2	39.22843	2	1237.538647	1237.536366	K	Y	833	842
PSM	KITIADCGQLE	336	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3563.3	31.20915	2	1246.624447	1246.622738	K	-	155	166
PSM	NSLESYAFNMK	337	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4170.3	40.54097	2	1302.594647	1302.591438	K	A	540	551
PSM	DVLSVAFSSDNR	338	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4386.2	43.2368	2	1308.634647	1308.630994	K	Q	107	119
PSM	NELESYAYSLK	339	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4117.2	39.77102	2	1315.632447	1315.629597	R	N	563	574
PSM	TLNMTTSPEEK	340	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3261.2	24.94057	2	1329.555047	1329.552349	K	R	326	337
PSM	NNASTDYDLSDK	341	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3173.3	23.354	2	1341.570847	1341.568454	K	S	301	313
PSM	KGDECELLGHSK	342	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3010.2	20.91745	3	1371.645971	1371.645264	K	N	286	298
PSM	VSDQNSPVLPKK	343	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2937.2	19.86912	3	1390.687871	1390.685746	R	S	2042	2054
PSM	RLSQSDEDVIR	344	sp|Q9H7D7|WDR26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3301.2	25.60007	3	1396.635971	1396.634773	K	L	119	130
PSM	EVDEQMLNVQNK	345	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3510.2	30.11543	3	1445.683871	1445.682044	K	N	325	337
PSM	DKKDEEEDMSLD	346	sp|Q16186|ADRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3203.2	23.968	3	1452.597671	1452.592620	K	-	396	408
PSM	LAVDEEENADNNTK	347	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3032.2	21.17937	3	1560.692771	1560.690360	K	A	40	54
PSM	DHQTITIQEMPEK	348	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3465.2	29.20465	3	1568.755571	1568.750458	K	A	195	208
PSM	DCGATWVVLGHSER	349	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3907.2	37.17002	3	1585.732571	1585.730725	K	R	123	137
PSM	VDATEESDLAQQYGVR	350	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3930.2	37.63388	3	1779.837071	1779.827522	K	G	82	98
PSM	QLVRGEPNVSYICSR	351	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3622.2	32.2295	3	1856.865971	1856.860433	K	Y	269	284
PSM	ERFSPPRHELSPPQK	352	sp|Q9BXP5|SRRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	25.6387	4	1883.906494	1883.904347	R	R	64	79
PSM	DNLTLWTSDQQDEEAGEGN	353	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4700.2	47.24472	3	2120.884571	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	354	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4835.2	48.60803	3	2192.880971	2192.873028	R	-	228	248
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	355	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3788.4	35.17352	3	3054.257171	3054.246274	K	N	1928	1956
PSM	KEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMK	356	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	34-UNIMOD:35	ms_run[1]:scan=1.1.3434.6	28.46727	4	4134.454894	4134.430623	K	A	142	177
PSM	SRHEGVSCDACLK	357	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21,8-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3107.2	22.24748	3	1639.6592	1639.6482	M	G	2	15
PSM	NGQDLGVAFK	358	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3780.2	35.03348	2	1048.520047	1047.534909	K	I	424	434
PSM	DVNAAIATIK	359	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3670.2	33.03212	2	1014.571047	1014.570960	K	T	327	337
PSM	DSLDQFDCK	360	sp|Q9HAV4|XPO5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3468.2	29.27168	2	1126.463247	1126.460089	K	L	1124	1133
PSM	SIYYITGESK	361	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3567.2	31.32122	2	1159.577647	1159.576105	K	E	258	268
PSM	LNLNNTVLSK	362	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3736.3	34.20483	2	1194.602047	1194.600954	R	R	426	436
PSM	NNNSNQNFFK	363	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3340.2	26.42605	2	1225.549447	1225.547599	K	E	242	252
PSM	DRVTDALNATR	364	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3482.2	29.54062	3	1230.631871	1230.631663	K	A	419	430
PSM	DRVRDVFEAK	365	sp|P12268|IMDH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3299.2	25.56268	3	1233.648371	1233.646585	K	A	125	135
PSM	VIGSGCNLDSAR	366	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3186.3	23.66558	2	1247.594047	1247.592835	R	F	158	170
PSM	QVVESAYEVIK	367	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3729.2	34.04292	2	1263.672047	1263.671068	K	L	233	244
PSM	LGMLSPEGTCK	368	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3690.4	33.45707	2	1271.530847	1271.529111	R	A	203	214
PSM	DISTNYYASQK	369	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3355.3	26.73588	2	1288.595247	1288.593546	K	K	672	683
PSM	GEPNVSYICSR	370	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3493.2	29.7913	2	1360.551247	1360.548267	R	Y	273	284
PSM	ESVPEFPLSPPK	371	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4580.2	45.5329	2	1405.656647	1405.653049	K	K	30	42
PSM	EGLELPEDEEEK	372	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3627.3	32.36035	2	1415.635447	1415.630385	K	K	412	424
PSM	IISSIEQKEENK	373	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3046.2	21.4778	3	1416.742871	1416.746024	R	G	62	74
PSM	KETPPPLVPPAAR	374	sp|Q9BQA1|MEP50_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3487.2	29.6585	3	1451.758871	1451.753766	R	E	3	16
PSM	DKKDEEEDMSLD	375	sp|Q16186|ADRM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:35	ms_run[1]:scan=1.1.2800.2	18.376	3	1468.590371	1468.587535	K	-	396	408
PSM	DAHNALLDIQSSGR	376	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3675.2	33.11934	3	1495.740671	1495.737919	K	A	628	642
PSM	EGLELPEDEEEKK	377	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3446.2	28.7529	3	1543.728971	1543.725348	K	K	412	425
PSM	DHASIQMNVAEVDK	378	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3514.3	30.221	3	1555.731371	1555.730056	K	V	28	42
PSM	ESVPEFPLSPPKKK	379	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3734.2	34.1509	3	1661.847371	1661.842975	K	D	30	44
PSM	EGEDGDQPTTPPKPLK	380	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3157.2	23.11258	3	1787.802671	1787.797876	K	T	174	190
PSM	DNLTLWTSDQQDDDGGEGNN	381	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4886.2	49.03585	3	2192.880671	2192.873028	R	-	228	248
PSM	KLEKEEEEGISQESSEEEQ	382	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3100.4	22.12038	3	2315.956271	2315.952992	K	-	89	108
PSM	QENCGAQQVPAGPGTSTPPSSPVR	383	sp|Q96G46|DUS3L_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=1.1.3459.3	29.05555	3	2501.106371	2501.100617	R	T	257	281
PSM	CNTPTYCDLGK	384	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3734.3	34.1609	2	1449.5335	1449.5300	M	A	2	13
PSM	LSDGVAVLK	385	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3432.2	28.43518	2	900.529247	900.528033	K	V	397	406
PSM	ELVLDNSR	386	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3278.2	25.16417	2	944.492047	944.492710	K	S	21	29
PSM	SGTSEFLNK	387	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3255.2	24.82725	2	981.476447	981.476725	K	M	169	178
PSM	SGPKPFSAPKPQTSPSPK	388	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3213.2	24.19927	4	1996.909694	1996.906060	R	R	295	313
PSM	GLFDEYGSK	389	sp|Q58FF3|ENPLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3847.2	36.19353	2	1014.467647	1014.465826	R	K	53	62
PSM	DLPEHAVLK	390	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3306.2	25.70203	2	1020.559647	1020.560395	K	M	627	636
PSM	DVIEEYFK	391	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4515.2	44.89697	2	1041.501847	1041.501878	K	C	122	130
PSM	TTHFVEGGDAGNREDQINR	392	sp|P18124|RL7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3127.3	22.56632	4	2114.982894	2114.972957	K	L	224	243
PSM	DGYNYTLSK	393	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3395.2	27.62072	2	1059.488447	1059.487290	K	T	28	37
PSM	ITIADCGQLE	394	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3839.2	36.04767	2	1118.529247	1118.527775	K	-	156	166
PSM	RISFSASHR	395	sp|Q03393|PTPS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	22.10705	3	1139.524571	1139.523707	R	L	17	26
PSM	GDLGIEIPAEK	396	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3904.2	37.10325	2	1140.605047	1140.602654	R	V	295	306
PSM	NSGQNLEEDMGQSEQK	397	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3315.2	25.9191	3	1792.755671	1792.753371	K	A	35	51
PSM	DRVTDALNATR	398	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3473.2	29.3318	3	1230.631871	1230.631663	K	A	419	430
PSM	EGMNIVEAMER	399	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4322.3	42.42387	2	1277.578847	1277.574407	K	F	134	145
PSM	LMIEMDGTENK	400	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3675.3	33.12267	2	1279.582047	1279.578824	K	S	93	104
PSM	HTIIPAKSPEK	401	sp|Q9NZM1|MYOF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2924.2	19.68732	3	1299.662471	1299.658803	R	C	1908	1919
PSM	NCNDFQYESK	402	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3176.3	23.43923	2	1303.516247	1303.513916	K	V	111	121
PSM	GILAADESTGSIAK	403	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3626.4	32.33482	2	1411.660647	1411.659591	K	R	29	43
PSM	RYPSSISSSPQK	404	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2988.2	20.59168	3	1415.647271	1415.644610	R	D	601	613
PSM	NQDECVIALHDCNGDVNR	405	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3465.3	29.21465	3	2127.912371	2127.906200	K	A	64	82
PSM	EVDEQMLNVQNK	406	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=1.1.3178.2	23.47943	3	1461.679271	1461.676959	K	N	325	337
PSM	QQEGESRLNLVQR	407	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3285.2	25.24753	3	1555.803971	1555.806667	R	N	100	113
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	408	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4323.2	42.44892	5	3932.732118	3932.709658	K	T	6	40
PSM	LGAGGGSPEKSPSAQELK	409	sp|Q9UNE7|CHIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3137.4	22.80015	3	1791.846971	1791.840409	R	E	13	31
PSM	RLQSIGTENTEENRR	410	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2923.2	19.6626	3	1801.905671	1801.903087	K	F	43	58
PSM	SGPKPFSAPKPQTSPSPK	411	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3139.2	22.83663	4	1916.943294	1916.939729	R	R	295	313
PSM	STTPPPAEPVSLPQEPPKPR	412	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3624.4	32.2903	3	2204.095271	2204.087850	K	V	225	245
PSM	NGSLDSPGKQDTEEDEEEDEKDK	413	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2999.4	20.73522	4	2674.040894	2673.045055	K	G	134	157
PSM	NGRVEIIANDQGNR	414	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3172.2	23.32893	3	1555.776671	1554.786266	K	I	47	61
PSM	HIAEEADRKYEEVAR	415	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3204.2	23.98303	4	1814.894894	1814.891125	K	K	154	169
PSM	EAFSLFDK	416	sp|P27482|CALL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4304.2	42.10078	2	955.466447	955.465098	K	D	15	23
PSM	DLTDYLMK	417	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:35	ms_run[1]:scan=1.1.4129.2	39.88868	2	1013.474847	1013.473949	R	I	186	194
PSM	DLEGSDIDTR	418	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3223.4	24.4122	2	1119.505847	1119.504397	R	R	373	383
PSM	DLEEAEEYK	419	sp|O75347|TBCA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3355.2	26.72588	2	1124.487847	1124.487350	K	E	87	96
PSM	FEDENFILK	420	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4165.3	40.43375	2	1153.568847	1153.565540	K	H	83	92
PSM	DQIYDIFQK	421	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4620.2	45.92935	2	1168.579847	1168.576440	K	L	194	203
PSM	DAGTIAGLNVLR	422	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4408.2	43.51475	2	1198.667447	1198.666986	K	I	160	172
PSM	DLEAHIDSANK	423	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3174.2	23.38895	3	1211.582471	1211.578230	K	N	1621	1632
PSM	GRRSPILLPK	424	sp|Q8TD16|BICD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3237.2	24.6158	3	1215.685271	1215.685293	R	G	579	589
PSM	DIDISSPEFK	425	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4132.2	39.93613	2	1229.524847	1229.521701	K	I	172	182
PSM	GYFEYIEENK	426	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4170.2	40.5343	2	1290.580047	1290.576833	R	Y	256	266
PSM	SSPNPFVGSPPK	427	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3682.2	33.27288	2	1292.582647	1292.580219	K	G	393	405
PSM	SGTPPRQGSITSPQANEQSVTPQRR	428	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=1.1.3187.4	23.69738	4	2838.288894	2838.281115	K	S	846	871
PSM	STNEAMEWMNNK	429	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3818.2	35.70525	2	1453.598047	1453.596599	K	L	737	749
PSM	DQGTYEDYVEGLR	430	sp|P60660|MYL6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4361.2	42.9139	2	1543.684447	1543.679067	K	V	82	95
PSM	ESLKEEDESDDDNM	431	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3138.2	22.81498	3	1654.619171	1654.615206	K	-	242	256
PSM	DLEIERPILGQNDNK	432	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3883.3	36.81458	3	1752.903671	1752.900627	R	S	234	249
PSM	ESEDKPEIEDVGSDEEEEK	433	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3333.4	26.26975	3	2191.919771	2191.912828	K	K	251	270
PSM	TVGTPIASVPGSTNTGTVPGSEK	434	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3702.4	33.62562	3	2236.067171	2236.062423	R	D	270	293
PSM	DNLTLWTSENQGDEGDAGEGEN	435	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4704.2	47.27913	3	2349.954071	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	436	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4648.2	46.44785	3	2349.954971	2349.946922	R	-	225	247
PSM	IVRGDQPAASGDSDDDEPPPLPR	437	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3490.2	29.72448	4	2483.104494	2483.096577	K	L	45	68
PSM	NGRVEIIANDQGNR	438	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3312.2	25.85567	3	1555.774871	1554.786266	K	I	47	61
PSM	GEPNVSYICSR	439	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3483.4	29.57618	2	1361.550647	1360.548267	R	Y	273	284
PSM	NGSEADIDEGLYSR	440	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3785.3	35.11628	2	1525.656047	1524.669230	K	Q	44	58
PSM	DNLTLWTSENQGDEGDAGEGEN	441	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4764.2	47.89103	3	2431.965071	2429.913253	R	-	225	247
PSM	RRSPSPYYSR	442	sp|Q13595|TRA2A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2854.3	18.8504	3	1347.610271	1347.608499	R	Y	258	268
PSM	DANNGNLQLR	443	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3198.2	23.8988	2	1114.538247	1113.552684	K	N	288	298
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	444	sp|Q9NPQ8|RIC8A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=1.1.3390.3	27.54485	3	2758.071371	2758.058931	R	E	424	448