MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000151 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617205149466520^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_15_K4_3.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	null	273-UNIMOD:21	0.03	45.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	357-UNIMOD:4,337-UNIMOD:4,339-UNIMOD:4,97-UNIMOD:35	0.24	44.0	10	8	6
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.16	43.0	8	2	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	145-UNIMOD:21,136-UNIMOD:21	0.10	42.0	13	3	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null	237-UNIMOD:4	0.10	42.0	3	1	0
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	426-UNIMOD:21	0.04	40.0	5	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	641-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.18	39.0	2	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0	null	235-UNIMOD:35	0.17	38.0	8	3	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	63-UNIMOD:21	0.10	37.0	2	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.09	35.0	2	2	2
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.07	35.0	2	1	0
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.26	35.0	2	2	2
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.15	35.0	20	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.13	35.0	9	2	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	138-UNIMOD:35	0.10	35.0	5	2	1
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	147-UNIMOD:21	0.10	35.0	2	1	0
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	495-UNIMOD:4,506-UNIMOD:4,507-UNIMOD:21	0.05	35.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	34.0	3	1	0
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.08	34.0	3	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	57-UNIMOD:21	0.12	34.0	4	1	0
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.29	34.0	4	3	2
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	46-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	490-UNIMOD:35,494-UNIMOD:35	0.08	32.0	6	5	4
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	576-UNIMOD:4,584-UNIMOD:21	0.02	32.0	2	2	2
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	70-UNIMOD:21,447-UNIMOD:4	0.10	31.0	5	4	3
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	3	3	3
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	6	5	4
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	124-UNIMOD:4	0.15	31.0	4	4	4
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	521-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	31.0	3	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.15	31.0	4	4	4
PRT	sp|Q00653|NFKB2_HUMAN	Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	703-UNIMOD:4,710-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.10	30.0	2	2	2
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	152-UNIMOD:4,37-UNIMOD:21	0.12	29.0	5	5	5
PRT	sp|P14314|GLU2B_HUMAN	Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	97-UNIMOD:4,99-UNIMOD:4,100-UNIMOD:4,112-UNIMOD:4,116-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.07	29.0	5	4	3
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	1874-UNIMOD:21,1877-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	44-UNIMOD:4,43-UNIMOD:21	0.06	29.0	2	1	0
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	24-UNIMOD:4	0.26	29.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.08	29.0	4	4	4
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	2-UNIMOD:1,3-UNIMOD:21,139-UNIMOD:4	0.23	29.0	4	3	2
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	19-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	114-UNIMOD:21,123-UNIMOD:4	0.07	28.0	6	2	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	412-UNIMOD:4	0.08	28.0	5	4	3
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.11	28.0	3	3	3
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.10	28.0	2	1	0
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	102-UNIMOD:21,218-UNIMOD:35	0.26	28.0	4	2	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	164-UNIMOD:4	0.16	27.0	4	4	4
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	104-UNIMOD:21	0.05	27.0	3	2	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	39-UNIMOD:21	0.08	27.0	3	2	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	996-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.10	27.0	3	2	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	310-UNIMOD:21,427-UNIMOD:4,308-UNIMOD:21	0.07	27.0	5	3	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	663-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	317-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	2-UNIMOD:1,17-UNIMOD:4,16-UNIMOD:35	0.13	27.0	4	3	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	549-UNIMOD:35	0.08	26.0	4	4	4
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	163-UNIMOD:4	0.05	26.0	2	2	2
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	335-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.20	26.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	108-UNIMOD:35	0.16	26.0	1	1	1
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	2-UNIMOD:1	0.30	26.0	5	3	2
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.34	26.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.14	25.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.21	25.0	3	2	1
PRT	sp|Q9Y2R5|RT17_HUMAN	28S ribosomal protein S17, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS17 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.13	25.0	4	4	4
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.17	25.0	2	2	2
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.13	25.0	2	1	0
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	173-UNIMOD:4,182-UNIMOD:21,194-UNIMOD:4	0.10	25.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.16	25.0	6	5	4
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	290-UNIMOD:4	0.10	25.0	4	3	2
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	671-UNIMOD:21,675-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.18	25.0	3	3	3
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9H7D7|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	121-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	112-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	24.0	2	1	0
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	40-UNIMOD:21,43-UNIMOD:21	0.06	24.0	2	1	0
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	136-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	654-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	153-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q96G46|DUS3L_HUMAN	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS3L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	260-UNIMOD:4,272-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	617-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	475-UNIMOD:21,473-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	335-UNIMOD:4	0.03	23.0	2	1	0
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	53-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|P00505|AATM_HUMAN	Aspartate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GOT2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	225-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	1003-UNIMOD:21,1043-UNIMOD:21,2100-UNIMOD:21,2102-UNIMOD:21,2104-UNIMOD:21	0.02	23.0	5	3	2
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	404-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	95-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9H0D6|XRN2_HUMAN	5'-3' exoribonuclease 2 OS=Homo sapiens OX=9606 GN=XRN2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	501-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	468-UNIMOD:21,474-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	190-UNIMOD:21,193-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	4521-UNIMOD:21	0.00	22.0	2	1	0
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	369-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	3	3	3
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	38-UNIMOD:21	0.09	22.0	2	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	105-UNIMOD:4	0.06	22.0	2	2	2
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	186-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	2	2	2
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	337-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	49-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.11	21.0	2	2	2
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	82-UNIMOD:21,80-UNIMOD:28	0.05	21.0	3	1	0
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	161-UNIMOD:4	0.13	21.0	2	2	2
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	306-UNIMOD:35	0.10	21.0	5	3	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	2889-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P46020|KPB1_HUMAN	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	7-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|P05023|AT1A1_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UPZ3|HPS5_HUMAN	Hermansky-Pudlak syndrome 5 protein OS=Homo sapiens OX=9606 GN=HPS5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	463-UNIMOD:21,468-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	234-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	206-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.12	21.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.18	21.0	1	1	1
PRT	sp|Q96AT1|K1143_HUMAN	Uncharacterized protein KIAA1143 OS=Homo sapiens OX=9606 GN=KIAA1143 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	27-UNIMOD:21	0.07	21.0	2	2	2
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q96G23|CERS2_HUMAN	Ceramide synthase 2 OS=Homo sapiens OX=9606 GN=CERS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	346-UNIMOD:21,349-UNIMOD:21,348-UNIMOD:21	0.07	21.0	2	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,2-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|Q9HB09|B2L12_HUMAN	Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	242-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	3	2	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	145-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	316-UNIMOD:4	0.03	20.0	2	1	0
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	487-UNIMOD:35,488-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q13404|UB2V1_HUMAN	Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	3	3	3
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	398-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	153-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	1453-UNIMOD:4,1459-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9Y2H0|DLGP4_HUMAN	Disks large-associated protein 4 OS=Homo sapiens OX=9606 GN=DLGAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	915-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	593-UNIMOD:21,599-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	93-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P50395|GDIB_HUMAN	Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	202-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	47-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	227-UNIMOD:21	0.05	20.0	2	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	2	2	2
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1	0.14	20.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	173-UNIMOD:4	0.26	19.0	4	4	4
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	165-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	934-UNIMOD:4,936-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	409-UNIMOD:4,412-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	141-UNIMOD:4	0.11	19.0	2	2	2
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	321-UNIMOD:21	0.01	19.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	207-UNIMOD:21,212-UNIMOD:4	0.00	19.0	2	1	0
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	401-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	2	2	2
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	19.0	2	1	0
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1015-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q9BYX7|ACTBM_HUMAN	Putative beta-actin-like protein 3 OS=Homo sapiens OX=9606 GN=POTEKP PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	608-UNIMOD:4	0.05	19.0	2	2	2
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	19.0	1	1	1
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	815-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	15-UNIMOD:21	0.04	18.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	394-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.00	18.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.19	18.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|A6NHG4|DDTL_HUMAN	D-dopachrome decarboxylase-like protein OS=Homo sapiens OX=9606 GN=DDTL PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P06703|S10A6_HUMAN	Protein S100-A6 OS=Homo sapiens OX=9606 GN=S100A6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q58FF3|ENPLL_HUMAN	Putative endoplasmin-like protein OS=Homo sapiens OX=9606 GN=HSP90B2P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q99436|PSB7_HUMAN	Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	190-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	609-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|O94925|GLSK_HUMAN	Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	91-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|P29803|ODPAT_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	291-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q9UK59|DBR1_HUMAN	Lariat debranching enzyme OS=Homo sapiens OX=9606 GN=DBR1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	99-UNIMOD:21,101-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.15	17.0	1	1	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	183-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	714-UNIMOD:21	0.01	17.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	87-UNIMOD:21,101-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	TVGTPIASVPGSTNTGTVPGSEK	1	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	45.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3365.2	33.9979	3	2236.064471	2236.062423	R	D	270	293
PSM	DATNVGDEGGFAPNILENK	2	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.3878.2	44.607	3	1959.924671	1959.917400	K	E	203	222
PSM	DNLTLWTSDTQGDEAEAGEGGEN	3	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=1.1.4089.2	48.31207	3	2408.000171	2407.988786	R	-	223	246
PSM	NGSLDSPGKQDTEEDEEEDEK	4	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2775.2	20.96177	3	2429.924471	2429.923149	K	D	134	155
PSM	DNLTLWTSDSAGEECDAAEGAEN	5	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4182.3	49.23045	3	2453.986871	2453.976507	R	-	223	246
PSM	VPSPLEGSEGDGDTD	6	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3328.2	33.10383	2	1553.576647	1553.577043	K	-	413	428
PSM	TPEELDDSDFETEDFDVR	7	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4254.2	49.99077	3	2237.861471	2237.852550	R	S	634	652
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	8	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.3387.2	34.43585	4	3242.271694	3242.265475	K	D	929	958
PSM	TPEELDDSDFETEDFDVR	9	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4234.2	49.7875	3	2237.861471	2237.852550	R	S	634	652
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	10	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3413.2	35.06268	4	3223.240094	3223.230486	K	-	122	148
PSM	DNLTLWTSDMQGDGEEQNK	11	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3985.2	46.16125	3	2179.942271	2179.932792	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	12	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=1.1.3994.2	46.35563	3	2179.942271	2179.932792	R	E	226	245
PSM	SLDSDESEDEEDDYQQK	13	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.2942.2	24.3113	3	2030.775071	2030.771249	K	R	57	74
PSM	DNLTLWTSDTQGDEAEAGEGGEN	14	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.4108.2	48.527	3	2408.000171	2407.988786	R	-	223	246
PSM	GDRSEDFGVNEDLADSDAR	15	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3339.2	33.3393	3	2066.882171	2066.877720	K	A	186	205
PSM	DVAEAKPELSLLGDGDH	16	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3677.2	40.6964	3	1764.857471	1764.853008	R	-	232	249
PSM	TITLEVEPSDTIENVK	17	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3725.2	41.56337	3	1786.925171	1786.920025	K	A	12	28
PSM	DNLTLWTSDQQDDDGGEGNN	18	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4042.3	47.40097	3	2192.882171	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	19	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3655.2	40.21878	3	2195.933171	2195.927707	R	E	226	245
PSM	DNLTLWTSENQGDEGDAGEGEN	20	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4007.3	46.67923	3	2349.954371	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	21	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.3783.4	42.81472	3	2427.875471	2427.865619	K	K	129	151
PSM	NGSLDSPGKQDTEEDEEEDEKDK	22	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2716.2	19.97152	4	2673.048894	2673.045055	K	G	134	157
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	23	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3762.3	42.37555	3	2988.164171	2988.155727	K	E	144	170
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	24	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	2-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.2744.2	20.46432	4	3178.163694	3178.161241	R	K	494	522
PSM	PCSEETPAISPSK	25	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2877.4	22.96403	2	1481.6097	1481.6104	M	R	2	15
PSM	PCSEETPAISPSK	26	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2868.4	22.75823	2	1481.6097	1481.6104	M	R	2	15
PSM	DNLTLWTSDQQDEEAGEGN	27	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4040.2	47.3617	3	2120.882771	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	28	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4021.2	47.0049	3	2192.881571	2192.873028	R	-	228	248
PSM	IVRGDQPAASGDSDDDEPPPLPR	29	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3188.3	30.08693	3	2483.096771	2483.096577	K	L	45	68
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	30	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.3782.2	42.78583	5	3932.726118	3932.709658	K	T	6	40
PSM	SQSLPNSLDYTQTSDPGR	31	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3473.3	36.43902	3	2044.875971	2044.873894	R	H	44	62
PSM	DNLTLWTSDQQDDDGGEGNN	32	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.4073.2	48.03948	3	2192.882171	2192.873028	R	-	228	248
PSM	EGLELPEDEEEK	33	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3313.2	32.76317	2	1415.631847	1415.630385	K	K	412	424
PSM	DNLTLWTSDQQDDDGGEGNN	34	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4011.2	46.77153	3	2192.881571	2192.873028	R	-	228	248
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	35	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3151.3	29.25478	3	2779.103171	2779.094999	K	M	571	596
PSM	NAGVEGSLIVEK	36	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3194.2	30.20043	2	1214.650447	1214.650667	K	I	482	494
PSM	VAEDEAEAAAAAK	37	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2824.2	21.85438	2	1244.588447	1244.588461	K	F	148	161
PSM	GVVDSDDLPLNVSR	38	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3608.2	39.30002	2	1484.751847	1484.747087	K	E	435	449
PSM	RHVFGESDELIGQK	39	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3129.3	28.69933	3	1613.818571	1613.816169	R	V	137	151
PSM	DVTPPPETEVVLIK	40	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3986.2	46.18665	3	1615.816871	1615.811007	K	N	519	533
PSM	STAGDTHLGGEDFDNR	41	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3001.2	25.57533	3	1690.720271	1690.718306	K	M	224	240
PSM	QVPDSAATATAYLCGVK	42	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3803.2	43.254	3	1830.827471	1830.822317	R	A	107	124
PSM	NGSLDSPGKQDTEEDEEEDEK	43	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.2743.2	20.43917	3	2349.955271	2349.956818	K	D	134	155
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	44	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4274.2	50.13868	4	3756.456094	3756.438824	K	A	469	503
PSM	EALQDVEDENQ	45	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3092.2	27.79827	2	1288.542647	1288.541905	K	-	245	256
PSM	VPSPLEGSEGDGDTD	46	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3338.3	33.31512	2	1553.576647	1553.577043	K	-	413	428
PSM	AGADIHAENEEPLCPLPSPPTSDSDSDSEGPEK	47	sp|Q00653|NFKB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=1.1.3602.2	39.1826	4	3527.466494	3527.455949	K	D	690	723
PSM	DATNVGDEGGFAPNILENK	48	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3868.2	44.37982	3	1959.924671	1959.917400	K	E	203	222
PSM	SLDSDESEDEEDDYQQK	49	sp|Q13442|HAP28_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2987.2	25.25543	3	2110.738871	2110.737580	K	R	57	74
PSM	DNLTLWTSENQGDEGDAGEGEN	50	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.4048.2	47.55847	3	2349.953171	2349.946922	R	-	225	247
PSM	IVRGDQPAASGDSDDDEPPPLPR	51	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3198.3	30.30055	3	2483.096771	2483.096577	K	L	45	68
PSM	KVEEEQEADEEDVSEEEAESKEGTNK	52	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.2962.4	24.78193	4	2966.273694	2966.263624	K	D	234	260
PSM	CDENILWLDYK	53	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4247.2	49.88955	2	1467.675447	1467.670417	K	N	152	163
PSM	VNDGVCDCCDGTDEYNSGVICENTCK	54	sp|P14314|GLU2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:4,8-UNIMOD:4,9-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:4	ms_run[1]:scan=1.1.3324.3	33.003	4	3040.130494	3040.124922	R	E	92	118
PSM	VPSPLEGSEGDGDTD	55	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3318.3	32.88233	2	1553.576647	1553.577043	K	-	413	428
PSM	NGRVEIIANDQGNR	56	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.2869.3	22.77375	3	1554.786671	1554.786266	K	I	47	61
PSM	KASPPSGLWSPAYASH	57	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3558.2	38.38474	3	1734.780071	1734.776687	R	-	1872	1888
PSM	DASDDLDDLNFFNQK	58	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.4854.2	55.62945	3	1755.761771	1755.758774	K	K	65	80
PSM	DSSTCPGDYVLSVSENSR	59	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3733.2	41.70642	3	1971.855371	1971.848000	R	V	40	58
PSM	NADMSEEMQQDSVECATQALEK	60	sp|P63167|DYL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:4	ms_run[1]:scan=1.1.3943.2	45.61543	3	2513.046971	2513.035619	K	Y	10	32
PSM	GVVDSEDLPLNISR	61	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3762.2	42.36555	2	1512.781447	1512.778387	R	E	387	401
PSM	ASGVAVSDGVIK	62	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3632.2	39.71157	2	1223.5804	1223.5794	M	V	2	14
PSM	TLEEDEEELFK	63	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3918.2	45.25818	2	1380.632847	1380.629657	K	M	40	51
PSM	LGAGGGSPEKSPSAQELK	64	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2920.2	23.76085	3	1791.843071	1791.840409	R	E	13	31
PSM	HVPDSGATATAYLCGVK	65	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3465.2	36.28683	3	1825.810571	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	66	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3793.2	43.03813	3	1830.827471	1830.822317	R	A	107	124
PSM	NPDDITQEEYGEFYK	67	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3669.2	40.55605	3	1846.792271	1846.789740	R	S	292	307
PSM	DNLTLWTSDQQDEEAGEGN	68	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4049.2	47.58332	3	2120.882771	2120.877051	R	-	228	247
PSM	YHTSQSGDEMTSLSEYVSR	69	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3544.5	38.07878	3	2175.943571	2175.937877	R	M	457	476
PSM	DNLTLWTSDQQDDDGGEGNN	70	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4104.2	48.46587	3	2192.879771	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	71	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4143.2	48.88527	3	2192.881571	2192.873028	R	-	228	248
PSM	DYEEVGVDSVEGEGEEEGEEY	72	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3941.2	45.56495	3	2347.905971	2347.897571	K	-	431	452
PSM	DNLTLWTADNAGEEGGEAPQEPQS	73	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4105.2	48.48034	3	2528.103971	2528.093920	R	-	225	249
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	74	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3839.3	43.96112	4	3393.359694	3393.345713	K	F	86	114
PSM	VNQIGSVTESLQACK	75	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	14-UNIMOD:4	ms_run[1]:scan=1.1.3396.3	34.64858	3	1632.814271	1632.814121	K	L	344	359
PSM	DNLTLWTSDQQDDDGGEGNN	76	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4166.2	49.089	3	2192.882171	2192.873028	R	-	228	248
PSM	SADTLWDIQK	77	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3582.2	38.8348	2	1175.583447	1175.582253	K	D	320	330
PSM	GNPTVEVDLFTSK	78	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3753.2	42.14435	2	1405.711247	1405.708910	R	G	16	29
PSM	VPSPLEGSEGDGDTD	79	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3310.2	32.68744	2	1553.576647	1553.577043	K	-	413	428
PSM	LTFDSSFSPNTGKK	80	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3406.2	34.88757	3	1607.727071	1607.723254	K	N	97	111
PSM	NLDIERPTYTNLNR	81	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3343.3	33.43073	3	1717.876871	1717.874747	R	L	216	230
PSM	DVAEAKPELSLLGDGDH	82	sp|Q2TAA2|IAH1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3667.2	40.49148	3	1764.857471	1764.853008	R	-	232	249
PSM	RLQSIGTENTEENRR	83	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.2701.2	19.78398	3	1801.902971	1801.903087	K	F	43	58
PSM	EVLDEDTDEEKETLK	84	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3133.3	28.80223	3	1871.794571	1871.792516	K	N	990	1005
PSM	DWILPSDYDHAEAEAR	85	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3809.2	43.36862	3	1886.849771	1886.843506	K	H	256	272
PSM	SGPKPFSAPKPQTSPSPK	86	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2889.2	23.18167	4	1916.945694	1916.939729	R	R	295	313
PSM	NGVIQHTGAAAEEFNDDTD	87	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3305.3	32.55055	3	2082.818171	2082.816773	R	-	646	665
PSM	DNLTLWTSDMQGDGEEQNK	88	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4006.2	46.6517	3	2179.938371	2179.932792	R	E	226	245
PSM	DNLTLWTSDQQDDDGGEGNN	89	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4062.3	47.83669	3	2192.882171	2192.873028	R	-	228	248
PSM	NTNDANSCQIIIPQNQVNR	90	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3285.2	32.18265	3	2198.053271	2198.049828	K	K	310	329
PSM	DNLTLWTSDTQGDEAEAGEGGEN	91	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4125.3	48.73262	3	2408.000171	2407.988786	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	92	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3177.2	29.86713	3	2483.096771	2483.096577	K	L	45	68
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	93	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3405.2	34.86178	4	3223.240094	3223.230486	K	-	122	148
PSM	DDDIAALVVDNGSGMCK	94	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.4853.2	55.6044	2	1820.7971	1820.7915	M	A	2	19
PSM	DAGTIAGLNVLR	95	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3829.2	43.72557	2	1198.669247	1198.666986	K	I	160	172
PSM	CLELFSELAEDK	96	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4	ms_run[1]:scan=1.1.4418.2	51.82407	2	1452.685447	1452.680647	K	E	412	424
PSM	NRVIGSGCNLDSAR	97	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2868.2	22.7449	3	1517.736371	1517.736873	K	F	156	170
PSM	PFSAPKPQTSPSPK	98	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2925.2	23.89885	3	1547.739071	1547.738510	K	R	299	313
PSM	NQVAMNPTNTVFDAK	99	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3425.2	35.34335	3	1648.792571	1648.787906	K	R	57	72
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	100	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4061.3	47.81143	4	3456.458094	3456.442334	R	-	207	238
PSM	AASPPASASDLIEQQQK	101	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3407.2	34.90345	3	1819.836971	1819.835324	R	R	333	350
PSM	QVPDSAATATAYLCGVK	102	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3814.2	43.46642	3	1830.827471	1830.822317	R	A	107	124
PSM	DLEAEHVEVEDTTLNR	103	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3370.2	34.0927	3	1868.878871	1868.875201	R	C	15	31
PSM	KEESEESDDDMGFGLFD	104	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3956.2	45.79678	3	1964.755871	1964.746948	K	-	98	115
PSM	DNLTLWTSDQQDEEAGEGN	105	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4060.2	47.78615	3	2120.882771	2120.877051	R	-	228	247
PSM	DNLTLWTSENQGDEGDAGEGEN	106	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4059.2	47.7606	3	2349.953171	2349.946922	R	-	225	247
PSM	NGSLDSPGKQDTEEDEEEDEK	107	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2759.3	20.74643	3	2429.924471	2429.923149	K	D	134	155
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	108	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:35	ms_run[1]:scan=1.1.3817.3	43.55197	4	3472.450094	3472.437249	R	-	207	238
PSM	ADQLTEEQIAEFK	109	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4092.2	48.36037	2	1562.7517	1562.7459	M	E	2	15
PSM	NGSLDSPGKQDTEEDEEEDEK	110	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2836.2	22.02607	3	2350.943771	2349.956818	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	111	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.2779.2	21.02483	4	2594.066894	2593.078724	K	G	134	157
PSM	SDKPDMAEIEKFDK	112	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3502.2	37.0718	3	1693.7909	1693.7864	M	S	2	16
PSM	HGGPKDEERHVGDLGNVTADK	113	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2950.5	24.49532	4	2230.078494	2230.072672	K	D	72	93
PSM	DSPSVWAAVPGK	114	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3523.2	37.57577	2	1212.614647	1212.613888	K	T	27	39
PSM	NLEELNISSAQ	115	sp|Q9Y2R5|RT17_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3604.2	39.23395	2	1216.594047	1216.593546	K	-	120	131
PSM	QVVESAYEVIK	116	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3373.2	34.1795	2	1263.670247	1263.671068	K	L	233	244
PSM	EALQDVEDENQ	117	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3083.2	27.58518	2	1288.542647	1288.541905	K	-	245	256
PSM	YSQVLANGLDNK	118	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3167.3	29.6489	2	1320.666847	1320.667380	K	L	95	107
PSM	GILAADESTGSIAK	119	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3193.4	30.16858	2	1331.692647	1331.693260	K	R	29	43
PSM	TAFQEALDAAGDK	120	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3599.2	39.09482	2	1335.633047	1335.630660	K	L	9	22
PSM	DVIELTDDSFDK	121	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3828.2	43.70045	2	1395.644047	1395.640556	K	N	161	173
PSM	DRVHHEPQLSDK	122	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2512.2	17.70815	3	1459.719371	1459.716790	K	V	26	38
PSM	LAVDEEENADNNTK	123	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2799.2	21.3888	3	1560.690671	1560.690360	K	A	40	54
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	124	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3386.2	34.41002	4	3213.349694	3213.342046	K	F	173	200
PSM	IVRGDQPAASGDSDDDEPPPLPR	125	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3206.3	30.50418	3	2483.096771	2483.096577	K	L	45	68
PSM	VDATEESDLAQQYGVR	126	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3536.2	37.89922	3	1779.832571	1779.827522	K	G	82	98
PSM	SYELPDGQVITIGNER	127	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4053.2	47.66502	3	1789.890671	1789.884643	K	F	241	257
PSM	DKPHVNVGTIGHVDHGK	128	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2861.3	22.58942	4	1808.930894	1808.928179	R	T	54	71
PSM	DAGDKDKEQELSEEDK	129	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2638.2	18.80793	3	1834.807871	1834.806846	R	Q	35	51
PSM	DGARPDVTESESGSPEYR	130	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2924.6	23.87335	3	1950.855671	1950.855528	K	Q	425	443
PSM	DYEEVGADSADGEDEGEEY	131	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3464.3	36.26145	3	2077.743071	2077.739614	K	-	431	450
PSM	DNLTLWTSDQQDDDGGEGNN	132	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4030.2	47.19267	3	2192.881571	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	133	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4051.2	47.6043	3	2192.882171	2192.873028	R	-	228	248
PSM	TDAPQPDVKEEEEEKEEEK	134	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.2780.3	21.0498	4	2258.012494	2258.007397	K	D	517	536
PSM	DNLTLWTSDTQGDEAEAGEGGEN	135	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4076.2	48.11483	3	2408.000171	2407.988786	R	-	223	246
PSM	TSRPENAIIYNNNEDFQVGQAK	136	sp|P29401|TKT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3395.2	34.62292	3	2507.209271	2507.204080	R	V	472	494
PSM	NGSLDSPGKQDTEEDEEEDEKDK	137	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2700.3	19.75922	4	2673.048894	2673.045055	K	G	134	157
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	138	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3852.3	44.13572	3	3014.198171	3014.188484	K	-	661	690
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	139	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3335.4	33.24262	3	3722.201171	3722.195067	K	A	158	190
PSM	DSPSVWAAVPGK	140	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3515.3	37.38058	2	1212.614647	1212.613888	K	T	27	39
PSM	ELISNASDALDK	141	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3276.3	32.03578	2	1274.635647	1274.635411	R	I	103	115
PSM	LMIEMDGTENK	142	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3338.2	33.30512	2	1279.580847	1279.578824	K	S	93	104
PSM	ISVYYNEATGGK	143	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3145.5	29.09982	2	1300.631247	1300.629932	R	Y	47	59
PSM	TAFQEALDAAGDK	144	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3586.2	38.88985	2	1335.633047	1335.630660	K	L	9	22
PSM	RLSQSDEDVIR	145	sp|Q9H7D7|WDR26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3009.2	25.76295	3	1396.638971	1396.634773	K	L	119	130
PSM	DNLTLWTSDQQDDDGGEGNN	146	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4233.2	49.76263	3	2192.880371	2192.873028	R	-	228	248
PSM	KYEEIDNAPEER	147	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2837.2	22.05108	3	1491.685871	1491.684152	K	A	91	103
PSM	RNSLTGEEGQLAR	148	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3008.3	25.74065	3	1509.696671	1509.693685	R	V	110	123
PSM	YYLAPKIEDEEGS	149	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3401.3	34.7522	2	1512.697847	1512.698405	K	-	249	262
PSM	NSFREQLEEEEEAK	150	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3267.2	31.84282	3	1736.787371	1736.785323	K	H	1339	1353
PSM	DRSSFYVNGLTLGGQK	151	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3652.3	40.15427	3	1740.880271	1740.879498	K	C	55	71
PSM	HVPDSGATATAYLCGVK	152	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3456.2	36.05858	3	1825.810571	1825.807001	K	G	110	127
PSM	EAFSLFDKDGDGTITTK	153	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3712.2	41.35283	3	1843.883471	1843.883974	K	E	15	32
PSM	QLVRGEPNVSYICSR	154	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3309.2	32.64893	3	1856.859371	1856.860433	K	Y	269	284
PSM	DSSTSPGDYVLSVSENSR	155	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3980.2	46.0799	3	1978.821071	1978.815711	R	V	39	57
PSM	DKSPVREPIDNLTPEER	156	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3242.2	31.29223	4	2073.976894	2073.973214	K	D	134	151
PSM	DLLLTSSYLSDSGSTGEHTK	157	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3744.3	41.91168	3	2110.013171	2110.006609	K	S	397	417
PSM	HTGCCGDNDPIDVCEIGSK	158	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3245.3	31.3694	3	2132.859371	2132.856139	K	V	110	129
PSM	DSALQDTDDSDDDPVLIPGAR	159	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3995.2	46.38363	3	2293.965371	2293.958746	R	Y	648	669
PSM	DNLTLWTSDTQGDEAEAGEGGEN	160	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4148.2	48.93575	3	2408.000171	2407.988786	R	-	223	246
PSM	EVEDKESEGEEEDEDEDLSK	161	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2902.2	23.38873	3	2418.900371	2418.895931	K	Y	147	167
PSM	DSGSDEDFLMEDDDDSDYGSSK	162	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3774.3	42.60317	3	2427.875471	2427.865619	K	K	129	151
PSM	KVEEEQEADEEDVSEEEAESK	163	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2958.4	24.68002	3	2437.019171	2437.013998	K	E	234	255
PSM	QENCGAQQVPAGPGTSTPPSSPVR	164	sp|Q96G46|DUS3L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.3152.2	29.28068	3	2501.105771	2501.100617	R	T	257	281
PSM	ERIQQFDDGGSDEEDIWEEK	165	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3805.2	43.29412	3	2504.008571	2504.001674	K	H	607	627
PSM	DSGSDEDFLMEDDDDSDYGSSKK	166	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3359.3	33.8445	3	2571.960371	2571.955497	K	K	129	152
PSM	AGEEDEGEEDSDSDYEISAK	167	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3126.3	28.62215	3	2253.798371	2253.795823	R	A	463	483
PSM	AGFAGDDAPR	168	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2821.3	21.7976	2	975.439447	975.441009	K	A	21	31
PSM	SGKYDLDFK	169	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3137.2	28.89313	3	1071.526271	1071.523676	R	S	254	263
PSM	ALLYLCGGDD	170	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3948.3	45.68037	2	1095.494047	1095.490661	K	-	330	340
PSM	DVVICPDASLEDAKK	171	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3304.2	32.52507	3	1658.820071	1658.818537	R	E	49	64
PSM	DAGMQLQGYR	172	sp|P00505|AATM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3159.2	29.46107	2	1137.525647	1137.523692	R	Y	171	181
PSM	SNVSDAVAQSTR	173	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2879.3	23.00757	2	1233.595847	1233.594943	K	I	232	244
PSM	NSLDCEIVSAK	174	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3161.2	29.49337	2	1234.588447	1234.586353	K	S	423	434
PSM	VIGSGCNLDSAR	175	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.2923.3	23.84105	2	1247.592647	1247.592835	R	F	158	170
PSM	EDFDSLLQSAK	176	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3879.2	44.64118	2	1251.601647	1251.598297	K	K	288	299
PSM	DIIACGFDINK	177	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3814.3	43.47642	2	1264.615047	1264.612173	K	T	221	232
PSM	NFSDNQLQEGK	178	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2953.5	24.5493	2	1278.584847	1278.584044	R	N	161	172
PSM	AQTPPGPSLSGSK	179	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2916.3	23.66205	2	1305.596447	1305.596597	K	S	1001	1014
PSM	DKKDEEEDMSLD	180	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:35	ms_run[1]:scan=1.1.2599.2	18.46395	3	1468.591271	1468.587535	K	-	396	408
PSM	LTFDSSFSPNTGK	181	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3673.2	40.62214	2	1479.631647	1479.628291	K	K	97	110
PSM	DNFGFIETANHDK	182	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3466.2	36.3129	3	1506.675971	1506.673922	K	E	528	541
PSM	HRVIGSGCNLDSAR	183	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:4	ms_run[1]:scan=1.1.2769.2	20.86708	3	1540.747271	1540.752858	K	F	157	171
PSM	SVTEQGAELSNEER	184	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2933.3	24.0955	3	1547.717171	1547.706344	K	N	28	42
PSM	PFSAPKPQTSPSPK	185	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2917.2	23.68423	3	1547.739071	1547.738510	K	R	299	313
PSM	VPSPLEGSEGDGDTD	186	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3347.3	33.5375	2	1553.576647	1553.577043	K	-	413	428
PSM	VDNDENEHQLSLR	187	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.2939.3	24.22848	3	1567.721771	1567.722663	K	T	33	46
PSM	EALLSSAVDHGSDEVK	188	sp|P78371|TCPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3248.3	31.44983	3	1655.800271	1655.800245	R	F	139	155
PSM	MSPNETLFLESTNK	189	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3798.3	43.12868	3	1689.734171	1689.732104	K	I	85	99
PSM	GADFLVTEVENGGSLGSK	190	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4075.2	48.0898	3	1778.873771	1778.868659	K	K	189	207
PSM	HVPDSGATATAYLCGVK	191	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3475.2	36.48112	3	1825.810571	1825.807001	K	G	110	127
PSM	SSTPPGESYFGVSSLQLK	192	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4406.2	51.62467	3	1962.906071	1962.897590	K	G	1041	1059
PSM	DSSTSPGDYVLSVSENSR	193	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3961.3	45.88663	3	1978.821071	1978.815711	R	V	39	57
PSM	SQSLPNSLDYTQTSDPGR	194	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3463.2	36.22523	3	2044.875971	2044.873894	R	H	44	62
PSM	RKAEDSDSEPEPEDNVR	195	sp|Q9H0D6|XRN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2644.2	18.9667	3	2051.844971	2051.843322	K	L	494	511
PSM	DNLTLWTSDQQDDDGGEGNN	196	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4086.2	48.23973	3	2192.882171	2192.873028	R	-	228	248
PSM	TVGTPIASVPGSTNTGTVPGSEK	197	sp|Q99460|PSMD1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3357.5	33.79332	3	2236.064471	2236.062423	R	D	270	293
PSM	DNLTLWTSENQGDEGDAGEGEN	198	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4039.4	47.33028	3	2349.953171	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	199	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4208.2	49.52707	3	2349.952271	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	200	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4017.2	46.89578	3	2349.954371	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	201	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3551.3	38.20488	3	2443.867271	2443.860534	K	K	129	151
PSM	NQIHVKSPPREGSQGELTPANSQSR	202	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2915.4	23.64313	4	2796.334494	2796.330434	R	M	462	487
PSM	MLAESDESGDEESVSQTDKTELQNTLR	203	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.3808.2	43.34337	4	3171.297694	3171.283996	K	T	186	213
PSM	DDDIAALVVDNGSGMCK	204	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,15-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=1.1.4400.2	51.49272	2	1836.7936	1836.7865	M	A	2	19
PSM	NSLLSLSDT	205	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3775.2	42.63525	2	948.477647	948.476391	K	-	366	375
PSM	AFLAELEQNSPK	206	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3798.2	43.11868	3	1425.660371	1425.654112	K	I	4512	4524
PSM	HELQANCYEEVK	207	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2921.3	23.78657	3	1518.678971	1518.677293	K	D	133	145
PSM	DVNAAIATIK	208	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3336.2	33.2535	2	1014.572047	1014.570960	K	T	327	337
PSM	DGGAWGTEQR	209	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2866.2	22.70698	2	1075.467447	1075.468286	K	E	65	75
PSM	GHTDTEGRPPSPPPTSTPEK	210	sp|Q00613|HSF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:21	ms_run[1]:scan=1.1.2657.3	19.15892	4	2166.959694	2166.958293	R	C	353	373
PSM	ALLYLCGGDD	211	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3934.3	45.48017	2	1095.494047	1095.490661	K	-	330	340
PSM	RQAQQERDELADEIANSSGK	212	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3169.3	29.69385	4	2244.077294	2244.073066	K	G	1697	1717
PSM	VTLTSEEEAR	213	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2873.3	22.85303	2	1133.557647	1133.556432	K	L	306	316
PSM	LKDDEVAQLK	214	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2911.2	23.5418	3	1157.631371	1157.629203	K	K	309	319
PSM	DQVANSAFVER	215	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3062.4	27.08103	2	1234.594447	1234.594215	K	L	500	511
PSM	ADLINNLGTIAK	216	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3709.2	41.26573	2	1241.699447	1241.697952	K	F	96	108
PSM	INVYYNEATGGK	217	sp|P68371|TBB4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3153.4	29.30627	2	1327.641247	1327.640831	R	Y	47	59
PSM	YALYDATYETK	218	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3363.4	33.93997	2	1336.620847	1336.618698	R	E	82	93
PSM	ESVPEFPLSPPK	219	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3965.2	45.94963	2	1405.656247	1405.653049	K	K	30	42
PSM	EQFLDGDGWTSR	220	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3662.2	40.37483	2	1409.623047	1409.621158	K	W	25	37
PSM	TVIIEQSWGSPK	221	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3627.2	39.60218	2	1423.675247	1423.674847	R	V	61	73
PSM	AFLAELEQNSPK	222	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3799.2	43.15417	2	1425.655847	1425.654112	K	I	4512	4524
PSM	DSVFLSCSEDNR	223	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3288.2	32.21058	2	1427.598847	1427.598708	K	I	180	192
PSM	EFHLNESGDPSSK	224	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.2984.2	25.17037	3	1445.645171	1445.642287	K	S	165	178
PSM	DNLTLWTSDQQDDDGGEGNN	225	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4210.2	49.5583	3	2192.880371	2192.873028	R	-	228	248
PSM	DIEREDIEFICK	226	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3594.2	39.03192	3	1565.744471	1565.739559	K	T	327	339
PSM	SYELPDGQVITIGNER	227	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4044.2	47.45018	3	1789.890671	1789.884643	K	F	241	257
PSM	AASPPASASDLIEQQQK	228	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3417.3	35.15098	3	1819.836971	1819.835324	R	R	333	350
PSM	NHSGSRTPPVALNSSR	229	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2835.4	22.001	3	1838.781371	1838.782591	R	M	2098	2114
PSM	DNLTLWTSDTQGDEAEAGEGGEN	230	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4083.2	48.1982	4	2407.996494	2407.988786	R	-	223	246
PSM	DSGSDEDFLMEDDDDSDYGSSK	231	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3539.4	37.97993	3	2443.867271	2443.860534	K	K	129	151
PSM	DNLTLWTSDSAGEECDAAEGAEN	232	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4159.2	49.02567	3	2453.986871	2453.976507	R	-	223	246
PSM	KIIEDQQESLNK	233	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2802.2	21.44213	3	1443.754271	1443.756923	K	W	317	329
PSM	DCLNVLNK	234	sp|Q99471|PFD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3162.3	29.52003	2	974.484447	974.485516	K	S	48	56
PSM	LVLVGDGGTGK	235	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3097.2	27.91337	2	1014.570247	1014.570960	K	T	13	24
PSM	DGLTDVYNK	236	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3125.3	28.59612	2	1023.487447	1023.487290	K	I	182	191
PSM	QLSSGVSEIR	237	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2989.2	25.30568	2	1074.568647	1074.566937	R	H	80	90
PSM	QNLIAEVSTK	238	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3295.2	32.32468	2	1101.602047	1101.602989	K	D	198	208
PSM	IGAEVYHNLK	239	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2975.2	25.01787	2	1142.611247	1142.608408	R	N	184	194
PSM	FEDENFILK	240	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3672.2	40.58632	2	1153.566047	1153.565540	K	H	83	92
PSM	GVTIKPTVDDD	241	sp|Q2VIR3|IF2GL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2994.3	25.4325	2	1158.578047	1158.576833	R	-	462	473
PSM	DQIYDIFQK	242	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0		ms_run[1]:scan=1.1.3996.2	46.41843	2	1168.5779	1168.5759	K	L	194	203
PSM	NFEDVAFDEK	243	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3503.2	37.08665	2	1212.530647	1212.529883	K	K	376	386
PSM	NLQYYDISAK	244	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3337.2	33.28097	2	1213.597847	1213.597903	K	S	143	153
PSM	AGSSTPGDAPPAVAEVQGR	245	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3203.3	30.42148	3	1845.829571	1845.825822	R	S	2885	2904
PSM	DLFDPIIEDR	246	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4374.2	51.146	2	1231.612047	1231.608468	K	H	87	97
PSM	DNSTMGYMMAK	247	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:35	ms_run[1]:scan=1.1.3013.4	25.87903	2	1263.495047	1263.493380	R	K	486	497
PSM	DNNQFASASLDR	248	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3144.4	29.06735	2	1336.602847	1336.600757	K	T	154	166
PSM	SNSGVRLDGYAR	249	sp|P46020|KPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3059.2	27.01267	3	1373.612171	1373.608893	R	L	5	17
PSM	IVSAQSLAEDDVE	250	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3527.2	37.67658	2	1374.653447	1374.651455	R	-	133	146
PSM	GYDVIAQAQSGTGK	251	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3168.3	29.66798	3	1393.684571	1393.683758	K	T	69	83
PSM	DVIELTDDSFDK	252	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3837.2	43.91002	2	1395.644047	1395.640556	K	N	161	173
PSM	ELEEIVQPIISK	253	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3811.3	43.40014	2	1396.784247	1396.781347	K	L	622	634
PSM	DMTSEQLDDILK	254	sp|P05023|AT1A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4062.2	47.82668	2	1406.663247	1406.659911	K	Y	672	684
PSM	RGSQSDEDSCSLHSQTLSEDERFK	255	sp|Q9UPZ3|HPS5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3101.2	28.01503	4	2877.192494	2877.187260	R	E	459	483
PSM	DNPGVVTCLDEAR	256	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3348.2	33.55307	2	1444.659847	1444.661643	K	H	227	240
PSM	STNEAMEWMNNK	257	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3451.3	35.93632	2	1453.597247	1453.596599	K	L	737	749
PSM	HVFGESDELIGQK	258	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3255.3	31.57098	3	1457.715971	1457.715058	R	V	138	151
PSM	DLNHVCVISETGK	259	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3151.2	29.24478	3	1470.716771	1470.713678	R	A	201	214
PSM	DADSITLFDVQQK	260	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3947.2	45.6616	3	1478.733071	1478.725289	R	R	468	481
PSM	PCSEETPAISPSK	261	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.2859.2	22.54897	3	1481.6113	1481.6104	M	R	2	15
PSM	KHHEEEIVHHKK	262	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2619.2	18.6518	4	1549.813694	1549.811359	K	E	72	84
PSM	DHASIQMNVAEVDK	263	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3201.3	30.36708	3	1555.735271	1555.730056	K	V	28	42
PSM	NSSLLSFDNEDENE	264	sp|Q96AT1|K1143_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3877.2	44.59275	2	1611.657647	1611.653640	K	-	141	155
PSM	CIPALDSLTPANEDQK	265	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3677.3	40.7064	3	1770.849071	1770.845815	R	I	447	463
PSM	DVDEAYMNKVELESR	266	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3454.3	36.01047	3	1796.825771	1796.825079	K	L	199	214
PSM	IRYESLTDPSKLDSGK	267	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3222.3	30.8318	3	1807.935071	1807.931593	K	E	54	70
PSM	HVPDSGATATAYLCGVK	268	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3487.2	36.68028	3	1825.810571	1825.807001	K	G	110	127
PSM	HVPDSGATATAYLCGVK	269	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3448.3	35.85793	3	1825.810571	1825.807001	K	G	110	127
PSM	NPDDITQEEYGEFYK	270	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3680.2	40.7515	3	1846.792271	1846.789740	R	S	292	307
PSM	GEAAAERPGEAAVASSPSK	271	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	16-UNIMOD:21	ms_run[1]:scan=1.1.2698.2	19.7097	3	1863.838271	1863.836387	K	A	12	31
PSM	KMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGK	272	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3146.3	29.12578	4	3943.372894	3943.362484	K	Q	214	249
PSM	LSSGNEENKKEEDNDEIK	273	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.2505.2	17.64652	4	2076.950494	2076.944737	K	I	135	153
PSM	DNLTLWTSDSAGEECDAAEGAEN	274	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4196.3	49.43112	3	2453.986871	2453.976507	R	-	223	246
PSM	NQIHVKSPPREGSQGELTPANSQSR	275	sp|Q13098|CSN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2904.3	23.42	4	2796.334494	2796.330434	R	M	462	487
PSM	LVEDERSDREETESSEGEEAAAGGGAK	276	sp|Q96G23|CERS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.2842.3	22.17648	4	2967.164894	2967.165595	K	S	335	362
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	277	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3830.3	43.75107	3	3393.362171	3393.345713	K	F	86	114
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	278	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2982.3	25.14928	4	3566.438494	3565.448950	K	D	124	155
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	279	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2975.3	25.0212	5	3566.439618	3565.448950	K	D	124	155
PSM	DNLTLWTSDQQDDDGGEGNN	280	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4123.2	48.68263	3	2193.878471	2192.873028	R	-	228	248
PSM	ASGVAVSDGVIK	281	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3417.2	35.14765	2	1143.6135	1143.6130	M	V	2	14
PSM	SCINLPTVLPGSPSK	282	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.4655.2	54.22265	2	1690.8055	1690.7996	M	T	2	17
PSM	CNTPTYCDLGK	283	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:4,3-UNIMOD:21,7-UNIMOD:4	ms_run[1]:scan=1.1.3389.2	34.46808	2	1449.5315	1449.5300	M	A	2	13
PSM	LVRLSSDSFAR	284	sp|Q9HB09|B2L12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3341.2	33.3879	2	1329.643647	1329.644216	K	L	238	249
PSM	RKEDEVEEWQHR	285	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2861.2	22.58608	4	1639.772894	1639.770282	R	A	437	449
PSM	NGQDLGVAFK	286	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3215.2	30.6742	2	1047.533647	1047.534909	K	I	424	434
PSM	NVTELNEPLSNEER	287	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3234.2	31.10547	3	1642.782971	1642.779843	K	N	29	43
PSM	GSDFDCELR	288	sp|P61978|HNRPK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3119.3	28.44278	2	1097.447247	1097.444774	K	L	140	149
PSM	ALLLLCGEDD	289	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4252.2	49.9405	2	1117.535047	1117.532526	K	-	311	321
PSM	SADTLWGIQK	290	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3490.2	36.75823	2	1117.578247	1117.576774	K	E	319	329
PSM	MSGFIYQGK	291	sp|Q15052|ARHG6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3224.2	30.88188	2	1125.458647	1125.456598	R	I	487	496
PSM	QLSSGVSEIR	292	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3142.5	29.01903	2	1154.534447	1154.533268	R	H	80	90
PSM	LLEELEEGQK	293	sp|Q13404|UB2V1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3323.2	32.96729	2	1186.619647	1186.608134	R	G	17	27
PSM	ITLDNAYMEK	294	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3344.2	33.45205	2	1196.574047	1196.574725	K	C	142	152
PSM	GGSGSGPTIEEVD	295	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3115.2	28.34688	2	1203.526047	1203.525526	K	-	629	642
PSM	VEIIANDQGNR	296	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2913.4	23.58585	2	1227.622247	1227.620764	R	I	50	61
PSM	NLQDAMQVCR	297	sp|P49368|TCPG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3199.2	30.3127	2	1233.558047	1233.559426	R	N	390	400
PSM	YADLTEDQLPSCESLK	298	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4	ms_run[1]:scan=1.1.3581.2	38.80903	3	1867.857971	1867.850960	R	D	142	158
PSM	DNSTMGYMMAK	299	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:35	ms_run[1]:scan=1.1.3050.2	26.80148	2	1263.494647	1263.493380	R	K	486	497
PSM	ELISNASDALDK	300	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3289.2	32.23367	2	1274.635647	1274.635411	R	I	103	115
PSM	CSGPGLSPGMVR	301	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1.1.3321.2	32.94532	2	1296.533447	1296.535594	K	A	1453	1465
PSM	NNASTDYDLSDK	302	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2913.5	23.58918	2	1341.569047	1341.568454	K	S	301	313
PSM	KGDECELLGHSK	303	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4	ms_run[1]:scan=1.1.2781.3	21.06818	3	1371.647771	1371.645264	K	N	286	298
PSM	RAGELTEDEVER	304	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2842.2	22.16648	3	1402.670471	1402.668836	K	V	55	67
PSM	RFDDAVVQSDMK	305	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3116.3	28.36578	3	1409.661671	1409.660914	R	H	77	89
PSM	GILAADESTGSIAK	306	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3304.3	32.53507	2	1411.656247	1411.659591	K	R	29	43
PSM	ANSWQLVETPEK	307	sp|Q9Y2H0|DLGP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3557.3	38.35938	2	1480.663047	1480.659926	K	R	907	919
PSM	NNSGEEFDCAFR	308	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3550.3	38.17845	2	1524.538647	1524.534073	R	L	591	603
PSM	GDRSPEPGQTWTR	309	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2934.2	24.12765	3	1565.672171	1565.662385	K	E	90	103
PSM	DHQTITIQEMPEK	310	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3155.2	29.34443	3	1568.752871	1568.750458	K	A	195	208
PSM	LTFDSSFSPNTGKK	311	sp|P21796|VDAC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3398.2	34.68082	3	1607.727071	1607.723254	K	N	97	111
PSM	ESLKEEDESDDDNM	312	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2882.3	23.07098	2	1654.615247	1654.615206	K	-	242	256
PSM	DFMIQGGDFTRGDGTGGK	313	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3570.2	38.63602	3	1857.835571	1857.831562	K	S	99	117
PSM	DAINQGMDEELERDEK	314	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3326.2	33.04342	3	1890.829871	1890.826536	R	V	37	53
PSM	TDDYLDQPCYETINR	315	sp|P50395|GDIB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3516.2	37.39982	3	1901.814671	1901.810158	R	I	194	209
PSM	SCSGVEFSTSGSSNTDTGK	316	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4	ms_run[1]:scan=1.1.2956.4	24.62232	3	1906.783571	1906.785065	K	V	46	65
PSM	DNLTLWTSDQQDDDGGEGNN	317	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4316.2	50.48362	3	2192.879771	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	318	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4186.2	49.33013	3	2192.882171	2192.873028	R	-	228	248
PSM	STTPPPAEPVSLPQEPPKPR	319	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3311.2	32.69958	4	2204.095294	2204.087850	K	V	225	245
PSM	DYHFKVDNDENEHQLSLR	320	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3314.2	32.77492	4	2258.040094	2258.035223	K	T	28	46
PSM	LVEDERSDREETESSEGEEAAAGGGAK	321	sp|Q96G23|CERS2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.2858.3	22.5237	4	2887.204494	2887.199264	K	S	335	362
PSM	AAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAK	322	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3302.3	32.4843	5	4445.563618	4445.553592	K	G	177	218
PSM	DGNGYISAAELR	323	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3485.3	36.64163	2	1265.589847	1264.604780	K	H	96	108
PSM	DGNGYISAAELR	324	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3467.3	36.33912	2	1265.588447	1264.604780	K	H	96	108
PSM	NGSLDSPGKQDTEEDEEEDEK	325	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2834.3	21.976	3	2430.906371	2429.923149	K	D	134	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	326	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2753.2	20.65183	4	2674.032494	2673.045055	K	G	134	157
PSM	SDAAVDTSSEITTK	327	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3166.4	29.62313	2	1465.6790	1465.6779	M	D	2	16
PSM	ADEGISFR	328	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3096.2	27.88823	2	893.424447	893.424296	K	G	121	129
PSM	SGTSEFLNK	329	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2974.2	25.00637	2	981.478047	981.476725	K	M	169	178
PSM	AGDLLEDSPKRPK	330	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.2874.2	22.87827	3	1504.729871	1504.728674	R	E	158	171
PSM	SCNCLLLK	331	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3142.4	29.0157	2	1006.495247	1006.493973	K	V	336	344
PSM	NHDEESLECLCR	332	sp|Q04637|IF4G1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1.1.3100.2	27.9861	3	1560.631871	1560.629691	K	L	926	938
PSM	DGGFCEVCK	333	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.2947.3	24.43772	2	1070.416047	1070.416116	K	K	405	414
PSM	ALLLLCGEDD	334	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4275.2	50.16395	2	1117.535047	1117.532526	K	-	311	321
PSM	TAAKGEAAAERPGEAAVASSPSK	335	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	20-UNIMOD:21	ms_run[1]:scan=1.1.2662.2	19.21705	4	2235.058494	2235.053256	K	A	8	31
PSM	ITIADCGQLE	336	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3464.2	36.25145	2	1118.526447	1118.527775	K	-	156	166
PSM	VAVVAGYGDVGK	337	sp|P23526|SAHH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3143.3	29.04145	2	1133.609447	1133.608074	K	G	215	227
PSM	DVQDSLTVSNEAQTAK	338	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3141.5	28.9966	3	1704.821471	1704.816623	K	E	211	227
PSM	LGIHEDSTNR	339	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2663.2	19.24207	3	1140.552971	1140.552350	K	R	439	449
PSM	IYQYIQSR	340	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.2985.2	25.19563	2	1149.523447	1149.521975	R	F	318	326
PSM	DQIYDIFQK	341	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3988.2	46.21858	2	1168.578447	1168.576440	K	L	194	203
PSM	HQGVMVGMGQK	342	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2834.2	21.966	3	1170.564671	1170.563783	R	D	42	53
PSM	EAAENSLVAYK	343	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3082.2	27.55747	2	1193.594247	1193.592818	K	A	143	154
PSM	DSYVGDEAQSK	344	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2699.4	19.7344	2	1197.516647	1197.514961	K	R	53	64
PSM	DRVTDALNATR	345	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3162.2	29.51003	3	1230.633071	1230.631663	K	A	419	430
PSM	LGMLSPEGTCK	346	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3349.3	33.58887	2	1271.529447	1271.529111	R	A	203	214
PSM	SSPNPFVGSPPK	347	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3358.3	33.81212	2	1292.580247	1292.580219	K	G	393	405
PSM	LMIEMDGTENK	348	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:35	ms_run[1]:scan=1.1.2980.3	25.09945	2	1295.574647	1295.573739	K	S	93	104
PSM	HRPELIEYDK	349	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2954.2	24.578	3	1298.662271	1298.661900	R	L	205	215
PSM	EAMEDGEIDGNK	350	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2841.5	22.15142	2	1306.533647	1306.534711	K	V	628	640
PSM	NSLESYAFNMK	351	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3399.4	34.70107	2	1318.588447	1318.586353	K	A	540	551
PSM	RRSPSPYYSR	352	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2653.2	19.09673	3	1427.573471	1427.574830	R	Y	258	268
PSM	YKPESEELTAER	353	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2891.2	23.23197	3	1450.695371	1450.693989	K	I	327	339
PSM	DHYSNGFCTVYAK	354	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3167.2	29.6389	3	1560.667571	1560.666728	K	T	134	147
PSM	DFTVSAMHGDMDQK	355	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3108.2	28.17558	3	1596.656471	1596.654843	R	E	296	310
PSM	ETWDTAEEDSGTDSEYDESGK	356	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3302.2	32.4743	3	2429.860271	2429.854400	K	S	1004	1025
PSM	QEYDESGPSIVHRK	357	sp|Q9BYX7|ACTBM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2840.2	22.12643	3	1643.788571	1643.790349	K	C	360	374
PSM	DTGKTPVEPEVAIHR	358	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2992.3	25.37147	4	1647.863694	1647.858034	K	I	5	20
PSM	NQLTSNPENTVFDAK	359	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3385.2	34.37115	3	1676.803271	1676.800579	K	R	82	97
PSM	SDEDKDKEGEALEVK	360	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2761.2	20.77792	4	1690.795294	1690.789740	K	E	279	294
PSM	LIAPVAEEEATVPNNK	361	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3336.3	33.25683	3	1693.892471	1693.888666	K	I	8	24
PSM	KASPPSGLWSPAYASH	362	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3550.2	38.16845	3	1734.780071	1734.776687	R	-	1872	1888
PSM	NHSGSRTPPVALNSSR	363	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=1.1.2749.2	20.58948	3	1758.816071	1758.816260	R	M	2098	2114
PSM	VVVAENFDEIVNNENK	364	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3770.2	42.51193	3	1831.901171	1831.895208	K	D	380	396
PSM	MEEFKDQLPADECNK	365	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3169.4	29.70052	3	1852.791371	1852.797150	K	L	596	611
PSM	DWEDDSDEDMSNFDR	366	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3778.2	42.68053	3	1874.660171	1874.653716	K	F	108	123
PSM	FQEQECPPSPEPTRK	367	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.2852.3	22.36597	3	1908.810671	1908.807729	K	E	178	193
PSM	DNLTLWTSDMQGDGEEQNK	368	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3681.4	40.7909	3	2195.932571	2195.927707	R	E	226	245
PSM	STTPPPAEPVSLPQEPPKPR	369	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3303.3	32.50308	3	2204.090171	2204.087850	K	V	225	245
PSM	QFYDQALQQAVVDDDANNAK	370	sp|P60033|CD81_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3826.2	43.63997	3	2252.040371	2252.034555	K	A	125	145
PSM	AGEEDEGEEDSDSDYEISAK	371	sp|A2RRP1|NBAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3118.5	28.42065	3	2253.798371	2253.795823	R	A	463	483
PSM	DNLTLWTSENQGDEGDAGEGEN	372	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4070.2	47.98322	3	2349.953171	2349.946922	R	-	225	247
PSM	DNLTLWTSENQGDEGDAGEGEN	373	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4027.2	47.11877	3	2349.954371	2349.946922	R	-	225	247
PSM	SRSPTPPSSAGLGSNSAPPIPDSR	374	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3273.2	31.96895	3	2414.123471	2414.122732	R	L	815	839
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	375	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3263.3	31.74335	3	2651.002571	2651.000036	K	M	572	596
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	376	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3838.3	43.92902	3	3014.198171	3014.188484	K	-	661	690
PSM	MLAESDESGDEESVSQTDKTELQNTLR	377	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3642.5	39.93262	4	3091.324494	3091.317665	K	T	186	213
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	378	sp|P43487|RANG_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3783.3	42.81138	5	3932.726118	3932.709658	K	T	6	40
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	379	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3754.2	42.17028	3	2988.164171	2988.155727	K	E	144	170
PSM	QLSSGVSEIR	380	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.3710.2	41.29182	2	1137.5061	1137.5062	R	H	80	90
PSM	NGQDLGVAFK	381	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3420.2	35.22102	2	1048.518247	1047.534909	K	I	424	434
PSM	RDHALLEEQSK	382	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2671.2	19.35765	3	1324.673771	1324.673528	K	Q	633	644
PSM	DKPHVNVGTIGHVDHGK	383	sp|P49411|EFTU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2871.2	22.80027	4	1808.930894	1808.928179	R	T	54	71
PSM	NHSGSRTPPVALNSSR	384	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.2846.2	22.23893	4	1838.786894	1838.782591	R	M	2098	2114
PSM	GVQYLNEIK	385	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3308.3	32.63017	2	1062.571047	1062.570960	K	D	668	677
PSM	DQLIYNLLK	386	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4333.2	50.6506	2	1118.636647	1118.633560	K	E	6	15
PSM	GDLGIEIPAEK	387	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3517.2	37.4255	2	1140.602047	1140.602654	R	V	295	306
PSM	YIDQEELNK	388	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2941.3	24.27627	2	1150.552247	1150.550619	K	T	198	207
PSM	HGEVCPAGWKPGSDTIKPDVQK	389	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3124.4	28.57705	4	2405.182094	2405.179779	K	S	169	191
PSM	DITSDTSGDFR	390	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3153.3	29.2996	2	1212.525047	1212.525861	K	N	167	178
PSM	NPDDITNEEYGEFYK	391	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3642.3	39.92262	3	1832.780171	1832.774089	R	S	300	315
PSM	DNWEELYNR	392	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3621.2	39.50373	2	1237.539847	1237.536366	K	Y	833	842
PSM	IGEGTYGVVYK	393	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3179.3	29.89858	2	1264.576847	1264.574071	K	G	10	21
PSM	LGMLSPEGTCK	394	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3357.3	33.78332	2	1271.529447	1271.529111	R	A	203	214
PSM	LDIDSPPITAR	395	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3553.2	38.24303	2	1276.607447	1276.606433	R	N	33	44
PSM	EDQTEYLEER	396	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3058.3	26.98713	2	1310.565647	1310.562640	K	R	166	176
PSM	FASENDLPEWK	397	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3580.3	38.78235	2	1334.619047	1334.614282	R	E	58	69
PSM	LNQPGTPTRTAV	398	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.2930.3	24.01942	2	1333.638647	1333.639131	R	-	389	401
PSM	DISTNYYASQKK	399	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2922.2	23.82215	3	1416.689771	1416.688509	K	T	672	684
PSM	YISPDQLADLYK	400	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4028.3	47.15673	2	1424.722847	1424.718747	R	S	270	282
PSM	DSDQLDVIQENR	401	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3307.3	32.60453	2	1430.668647	1430.663751	K	Q	1478	1490
PSM	HKLDVTSVEDYK	402	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3105.2	28.09835	3	1432.717571	1432.719809	K	A	264	276
PSM	TTPSVVAFTADGER	403	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3420.3	35.22768	2	1449.710847	1449.709973	R	L	86	100
PSM	DRVHHEPQLSDK	404	sp|O43852|CALU_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2522.2	17.78798	4	1459.720494	1459.716790	K	V	26	38
PSM	TTPSYVAFTDTER	405	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3418.3	35.17885	2	1486.694047	1486.693989	R	L	37	50
PSM	EGLELPEDEEEKK	406	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3134.3	28.82802	3	1543.729271	1543.725348	K	K	412	425
PSM	DFTVSAMHGDMDQK	407	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3324.2	32.993	3	1580.662871	1580.659928	R	E	296	310
PSM	ATAGDTHLGGEDFDNR	408	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3006.3	25.69353	3	1674.727271	1674.723391	K	L	221	237
PSM	CIPALDSLTPANEDQK	409	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3686.2	40.90983	3	1770.849071	1770.845815	R	I	447	463
PSM	DSSTCPGDYVLSVSENSR	410	sp|P46109|CRKL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3907.2	45.0613	3	2051.821871	2051.814331	R	V	40	58
PSM	DNLTLWTADNAGEEGGEAPQEPQS	411	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4124.2	48.69767	3	2528.103971	2528.093920	R	-	225	249
PSM	NGRVEIIANDQGNR	412	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2906.4	23.4709	3	1555.770971	1554.786266	K	I	47	61
PSM	KLEKEEEEGISQESSEEEQ	413	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.2873.4	22.85637	3	2235.989171	2235.986661	K	-	89	108
PSM	DPGVLDR	414	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2843.2	22.2016	2	770.392247	770.392267	K	M	56	63
PSM	ELALGQDR	415	sp|A6NHG4|DDTL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2935.2	24.153	2	900.469847	900.466495	K	F	88	96
PSM	ALMDEVVK	416	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3278.2	32.09668	2	903.473247	903.473554	K	A	354	362
PSM	NLLSVAYK	417	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3400.2	34.71988	2	906.516847	906.517468	R	N	44	52
PSM	LQDAEIAR	418	sp|P06703|S10A6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2793.2	21.29283	2	914.480247	914.482145	K	L	48	56
PSM	GLFIIDDK	419	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3763.2	42.40128	2	919.502247	919.501484	R	G	129	137
PSM	DLTDYLMK	420	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4016.2	46.87195	2	997.481847	997.479034	R	I	186	194
PSM	GLFDEYGSK	421	sp|Q58FF3|ENPLL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3470.2	36.37978	2	1014.467047	1014.465826	R	K	53	62
PSM	DGIVLGADTR	422	sp|Q99436|PSB7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3158.2	29.42497	2	1015.529247	1015.529824	K	A	53	63
PSM	CGDLEEELK	423	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=1.1.3155.3	29.34777	2	1091.482047	1091.480490	K	I	190	199
PSM	GYSFTTTAER	424	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3088.2	27.6859	2	1131.520447	1131.519653	R	E	197	207
PSM	EAESSPFVER	425	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3016.3	25.94968	2	1149.531647	1149.530218	K	L	548	558
PSM	NQYDNDVTVWSPQGR	426	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3517.3	37.43217	3	1777.801271	1777.801976	R	I	4	19
PSM	VEVTEFEDIK	427	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3534.2	37.84848	2	1207.598447	1207.597235	K	S	133	143
PSM	QITVNDLPVGR	428	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3437.3	35.60693	2	1210.666047	1210.666986	R	S	141	152
PSM	DVDGLTSINAGR	429	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3298.2	32.37262	2	1216.603447	1216.604780	K	L	123	135
PSM	EQVANSAFVER	430	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3022.4	26.10437	2	1248.610047	1248.609865	K	V	365	376
PSM	DGNGYISAAELR	431	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3428.4	35.41457	2	1264.605247	1264.604780	K	H	96	108
PSM	DSAQNSVIIVDK	432	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3130.3	28.72195	2	1287.667247	1287.667045	K	N	194	206
PSM	GYFEYIEENK	433	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3683.3	40.83272	2	1290.579647	1290.576833	R	Y	256	266
PSM	NSNPALNDNLEK	434	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2943.4	24.32997	2	1327.637247	1327.636808	K	G	120	132
PSM	RRSPSPYYSR	435	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2642.2	18.91725	3	1347.607571	1347.608499	R	Y	258	268
PSM	ESVPEFPLSPPK	436	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3940.2	45.54005	2	1405.656247	1405.653049	K	K	30	42
PSM	RYPSSISSSPQK	437	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.2759.2	20.73643	3	1415.643971	1415.644610	R	D	601	613
PSM	HEQNIDCGGGYVK	438	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=1.1.2805.2	21.51818	3	1475.646071	1475.646327	K	L	99	112
PSM	DGPGETDAFGNSEGK	439	sp|O94925|GLSK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2968.3	24.89613	2	1479.611247	1479.611381	K	E	107	122
PSM	SLTNDWEDHLAVK	440	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3580.2	38.77235	3	1526.739071	1526.736522	K	H	315	328
PSM	DINAYNCEEPTEK	441	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3000.3	25.53957	3	1581.663071	1581.661702	K	L	85	98
PSM	DCGATWVVLGHSER	442	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3514.2	37.3479	3	1585.729271	1585.730725	K	R	123	137
PSM	YHGHSMSDPGVSYR	443	sp|P29803|ODPAT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=1.1.2905.4	23.439	3	1671.652871	1671.650106	R	T	287	301
PSM	NQAIYAAVDDDDDDAA	444	sp|Q9UK59|DBR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3440.2	35.6945	2	1680.677247	1680.675104	R	-	529	545
PSM	RVSVCAETYNPDEEEEDTDPR	445	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.3232.3	31.06458	3	2590.019771	2590.016672	R	V	97	118
PSM	ILDSVGIEADDDRLNK	446	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3384.3	34.34905	3	1771.895171	1771.895208	K	V	26	42
PSM	QLEDGRTLSDYNIQK	447	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3218.3	30.72405	3	1778.881271	1778.879892	K	E	49	64
PSM	EGEDGDQPTTPPKPLK	448	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=1.1.2899.2	23.31232	3	1787.799671	1787.797876	K	T	174	190
PSM	DGQVINETSQHHDDLE	449	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2968.2	24.88613	3	1835.796371	1835.792199	R	-	451	467
PSM	QLVRGEPNVSYICSR	450	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3301.3	32.44893	3	1856.859371	1856.860433	K	Y	269	284
PSM	VAPEEHPVLLTEAPLNPK	451	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3495.3	36.88725	3	1953.060971	1953.057128	R	A	96	114
PSM	SGPKPFSAPKPQTSPSPK	452	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.2947.2	24.42772	4	1996.908894	1996.906060	R	R	295	313
PSM	DKSPVREPIDNLTPEER	453	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3232.2	31.05458	3	2073.978071	2073.973214	K	D	134	151
PSM	DNLTLWTSDQQDDDGGEGNN	454	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4253.2	49.96575	3	2192.880371	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	455	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4284.2	50.24052	3	2192.880371	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	456	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4011.5	46.78153	2	2192.881447	2192.873028	R	-	228	248
PSM	EADDDEEVDDNIPEMPSPKK	457	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3439.2	35.6687	3	2351.941271	2351.935234	K	M	698	718
PSM	DNLTLWTSDTQGDEAEAGEGGEN	458	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4188.2	49.36105	3	2407.997171	2407.988786	R	-	223	246
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	459	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3444.3	35.7879	4	3044.159294	3044.151982	K	L	595	622
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	460	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2737.2	20.31303	5	3423.322618	3423.317893	R	A	81	114
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	461	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=1.1.2958.3	24.67335	5	3566.448118	3565.448950	K	D	124	155
PSM	NGSLDSPGKQDTEEDEEEDEKDK	462	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2782.3	21.09995	4	2674.027294	2673.045055	K	G	134	157
PSM	DLIDDLK	463	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3883.2	44.68483	2	830.439447	830.438549	R	S	63	70