MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000151 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617205149466520^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\121113hi_18_K4_4.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=40
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0	null	337-UNIMOD:4,339-UNIMOD:4	0.15	44.0	7	6	5
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0	null		0.10	42.0	6	1	0
PRT	sp|Q9Y606|TRUA_HUMAN	tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	426-UNIMOD:21	0.04	40.0	3	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	null	235-UNIMOD:35	0.12	40.0	6	2	1
PRT	sp|Q9NRF9|DPOE3_HUMAN	DNA polymerase epsilon subunit 3 OS=Homo sapiens OX=9606 GN=POLE3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0	null		0.18	39.0	2	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.09	37.0	14	1	0
PRT	sp|P35221|CTNA1_HUMAN	Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	641-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|Q58WW2|DCAF6_HUMAN	DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	null	654-UNIMOD:21	0.03	37.0	1	1	1
PRT	sp|Q9ULX6|AKP8L_HUMAN	A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	296-UNIMOD:4,313-UNIMOD:21,308-UNIMOD:21	0.05	37.0	2	2	2
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0	null		0.08	36.0	1	1	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null		0.14	35.0	9	2	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	null	145-UNIMOD:21	0.10	35.0	8	3	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null		0.09	34.0	5	5	5
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	2-UNIMOD:1	0.29	34.0	4	3	2
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0	null	138-UNIMOD:35	0.10	33.0	5	2	0
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.34	33.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.12	32.0	3	3	3
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null		0.08	32.0	2	1	0
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	237-UNIMOD:4	0.10	32.0	2	1	0
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	null	57-UNIMOD:21	0.12	32.0	3	1	0
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	2	2	2
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	null	3-UNIMOD:4,11-UNIMOD:21	0.09	31.0	2	1	0
PRT	sp|Q2TAA2|IAH1_HUMAN	Isoamyl acetate-hydrolyzing esterase 1 homolog OS=Homo sapiens OX=9606 GN=IAH1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null		0.20	31.0	1	1	1
PRT	sp|P05187|PPB1_HUMAN	Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	114-UNIMOD:21,123-UNIMOD:4	0.07	31.0	5	2	1
PRT	sp|Q8WU17|RN139_HUMAN	E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	663-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	113-UNIMOD:4,114-UNIMOD:4,123-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	null	102-UNIMOD:21,218-UNIMOD:35	0.26	31.0	3	2	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	6	4	3
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	23-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	317-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null	227-UNIMOD:21,226-UNIMOD:21	0.05	30.0	4	1	0
PRT	sp|Q15527|SURF2_HUMAN	Surfeit locus protein 2 OS=Homo sapiens OX=9606 GN=SURF2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q6ZMR3|LDH6A_HUMAN	L-lactate dehydrogenase A-like 6A OS=Homo sapiens OX=9606 GN=LDHAL6A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	163-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null		0.26	29.0	3	3	3
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	290-UNIMOD:4	0.07	29.0	2	2	2
PRT	sp|Q96TC7|RMD3_HUMAN	Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	null	46-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P15531|NDKA_HUMAN	Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|O95714|HERC2_HUMAN	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	1944-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null		0.13	28.0	6	4	2
PRT	sp|Q5H9R7|PP6R3_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	null	617-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	54-UNIMOD:21,192-UNIMOD:35	0.19	27.0	6	5	4
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	161-UNIMOD:4	0.21	27.0	4	4	4
PRT	sp|Q9BQA1|MEP50_HUMAN	Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	186-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|Q9BX95|SGPP1_HUMAN	Sphingosine-1-phosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=SGPP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	112-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	53-UNIMOD:4	0.08	27.0	1	1	1
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	2	2	2
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	null	495-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q14568|HS902_HUMAN	Heat shock protein HSP 90-alpha A2 OS=Homo sapiens OX=9606 GN=HSP90AA2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	494-UNIMOD:35	0.10	26.0	8	6	4
PRT	sp|P09923|PPBI_HUMAN	Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	111-UNIMOD:21,120-UNIMOD:4	0.03	26.0	3	1	0
PRT	sp|Q86TC9|MYPN_HUMAN	Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	928-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P31947|1433S_HUMAN	14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null		0.10	26.0	2	1	0
PRT	sp|P29692|EF1D_HUMAN	Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	147-UNIMOD:21,162-UNIMOD:21	0.10	26.0	2	1	0
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	null	671-UNIMOD:21,673-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,3-UNIMOD:4,13-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	2	2	2
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	104-UNIMOD:4,125-UNIMOD:21	0.29	25.0	4	4	4
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.21	25.0	2	2	2
PRT	sp|Q9UGV2|NDRG3_HUMAN	Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	25.0	null	1043-UNIMOD:21,534-UNIMOD:21,536-UNIMOD:21,1003-UNIMOD:21,2104-UNIMOD:21,2102-UNIMOD:21	0.02	25.0	5	4	3
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	41-UNIMOD:21,43-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	136-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|A2RRP1|NBAS_HUMAN	Neuroblastoma-amplified sequence OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	null	473-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	37-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|P02786|TFR1_HUMAN	Transferrin receptor protein 1 OS=Homo sapiens OX=9606 GN=TFRC PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q9UPR0|PLCL2_HUMAN	Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	576-UNIMOD:4,584-UNIMOD:21,592-UNIMOD:35	0.02	24.0	3	2	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	38-UNIMOD:21	0.16	24.0	6	3	1
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	310-UNIMOD:21,308-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62633-4|CNBP_HUMAN	Isoform 4 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	67-UNIMOD:4,75-UNIMOD:4,78-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	null	153-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	335-UNIMOD:4	0.07	23.0	3	2	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	4	4	4
PRT	sp|P06493|CDK1_HUMAN	Cyclin-dependent kinase 1 OS=Homo sapiens OX=9606 GN=CDK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	15-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	2	2
PRT	sp|Q9H7D7|WDR26_HUMAN	WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	121-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	3	3	3
PRT	sp|P28074|PSB5_HUMAN	Proteasome subunit beta type-5 OS=Homo sapiens OX=9606 GN=PSMB5 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	280-UNIMOD:21,521-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	51-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	186-UNIMOD:21,183-UNIMOD:21	0.02	23.0	2	2	2
PRT	sp|P08195|4F2_HUMAN	4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	103-UNIMOD:21	0.19	23.0	2	1	0
PRT	sp|Q13098|CSN1_HUMAN	COP9 signalosome complex subunit 1 OS=Homo sapiens OX=9606 GN=GPS1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	474-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	87-UNIMOD:21,101-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.34	23.0	1	1	1
PRT	sp|O43865|SAHH2_HUMAN	S-adenosylhomocysteine hydrolase-like protein 1 OS=Homo sapiens OX=9606 GN=AHCYL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	null	64-UNIMOD:21,68-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P09382|LEG1_HUMAN	Galectin-1 OS=Homo sapiens OX=9606 GN=LGALS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|P00338|LDHA_HUMAN	L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.17	22.0	5	5	5
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.09	22.0	2	2	2
PRT	sp|P31327|CPSM_HUMAN	Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,3-UNIMOD:21	0.15	22.0	2	2	2
PRT	sp|Q16186|ADRM1_HUMAN	Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P55084|ECHB_HUMAN	Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	2	2	2
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	61-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	null	441-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,3-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|O60762|DPM1_HUMAN	Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,9-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	316-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|Q13627|DYR1A_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens OX=9606 GN=DYRK1A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	321-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	2	2	2
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null		0.18	21.0	1	1	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	306-UNIMOD:35	0.06	21.0	3	2	1
PRT	sp|Q9Y478|AAKB1_HUMAN	5'-AMP-activated protein kinase subunit beta-1 OS=Homo sapiens OX=9606 GN=PRKAB1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	173-UNIMOD:4,182-UNIMOD:21,194-UNIMOD:4	0.10	21.0	1	1	1
PRT	sp|O00180|KCNK1_HUMAN	Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	329-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q99460|PSMD1_HUMAN	26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	null	270-UNIMOD:21	0.04	21.0	2	2	2
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1	0.14	21.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	3	2	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	14-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q14192|FHL2_HUMAN	Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	150-UNIMOD:4,153-UNIMOD:4	0.05	20.0	1	1	1
PRT	sp|P31949|S10AB_HUMAN	Protein S100-A11 OS=Homo sapiens OX=9606 GN=S100A11 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q16719|KYNU_HUMAN	Kynureninase OS=Homo sapiens OX=9606 GN=KYNU PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	2	2	2
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	20.0	null	82-UNIMOD:21,78-UNIMOD:21,80-UNIMOD:28	0.07	20.0	3	2	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	2	2	2
PRT	sp|Q9GZT3|SLIRP_HUMAN	SRA stem-loop-interacting RNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLIRP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	15-UNIMOD:21	0.10	20.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	549-UNIMOD:35	0.08	20.0	5	4	3
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	47-UNIMOD:4,91-UNIMOD:4	0.16	20.0	3	3	3
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:21	0.12	20.0	3	3	3
PRT	sp|Q9HB90|RRAGC_HUMAN	Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	95-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O95297|MPZL1_HUMAN	Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	203-UNIMOD:4,210-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P31948|STIP1_HUMAN	Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	417-UNIMOD:4,420-UNIMOD:4	0.04	20.0	2	2	2
PRT	sp|P62070|RRAS2_HUMAN	Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	183-UNIMOD:4,186-UNIMOD:21	0.08	20.0	1	1	1
PRT	sp|P43487|RANG_HUMAN	Ran-specific GTPase-activating protein OS=Homo sapiens OX=9606 GN=RANBP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null		0.17	20.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	null	369-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P14868|SYDC_HUMAN	Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	249-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	26-UNIMOD:21	0.06	19.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1877-UNIMOD:21	0.01	19.0	2	1	0
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.16	18.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	2047-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P24752|THIL_HUMAN	Acetyl-CoA acetyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q15052|ARHG6_HUMAN	Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	488-UNIMOD:21,487-UNIMOD:35	0.01	18.0	2	1	0
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	401-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q9BZF1|OSBL8_HUMAN	Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	808-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P18206|VINC_HUMAN	Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	721-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	4521-UNIMOD:21	0.00	18.0	1	1	1
PRT	sp|P36507|MP2K2_HUMAN	Dual specificity mitogen-activated protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP2K2 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	394-UNIMOD:21	0.04	18.0	2	2	2
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	234-UNIMOD:4	0.03	18.0	3	2	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	330-UNIMOD:35	0.03	18.0	2	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	608-UNIMOD:4,612-UNIMOD:4	0.02	18.0	2	1	0
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	345-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|P06753|TPM3_HUMAN	Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q5VSL9|STRP1_HUMAN	Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	335-UNIMOD:21,339-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	60-UNIMOD:21	0.10	18.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	186-UNIMOD:35,190-UNIMOD:21,193-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|Q7L2H7|EIF3M_HUMAN	Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	467-UNIMOD:21,225-UNIMOD:4	0.04	17.0	2	2	2
PRT	sp|Q15185|TEBP_HUMAN	Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P07602|SAP_HUMAN	Prosaposin OS=Homo sapiens OX=9606 GN=PSAP PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	409-UNIMOD:4,412-UNIMOD:4	0.04	17.0	2	2	2
PRT	sp|O43324|MCA3_HUMAN	Eukaryotic translation elongation factor 1 epsilon-1 OS=Homo sapiens OX=9606 GN=EEF1E1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P63098|CANB1_HUMAN	Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	460-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|P49840|GSK3A_HUMAN	Glycogen synthase kinase-3 alpha OS=Homo sapiens OX=9606 GN=GSK3A PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	17.0	4	2	1
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	183-UNIMOD:21	0.03	17.0	2	2	2
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	43-UNIMOD:21,44-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q96SB4|SRPK1_HUMAN	SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	null	51-UNIMOD:21,63-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q99471|PFD5_HUMAN	Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	49-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	2	1	0
PRT	sp|P30085|KCY_HUMAN	UMP-CMP kinase OS=Homo sapiens OX=9606 GN=CMPK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	608-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	207-UNIMOD:21,212-UNIMOD:4	0.00	16.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q08J23|NSUN2_HUMAN	RNA cytosine C(5)-methyltransferase NSUN2 OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	599-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P45880|VDAC2_HUMAN	Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	115-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|P25788|PSA3_HUMAN	Proteasome subunit alpha type-3 OS=Homo sapiens OX=9606 GN=PSMA3 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	null	60-UNIMOD:35,64-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	36-UNIMOD:21,39-UNIMOD:21	0.04	15.0	2	1	0
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.04	15.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.06	15.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	130-UNIMOD:4	0.07	15.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	177-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|Q7Z6Z7|HUWE1_HUMAN	E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	2889-UNIMOD:21	0.00	15.0	1	1	1
PRT	sp|P55786|PSA_HUMAN	Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.01	15.0	1	1	1
PRT	sp|Q6DD88|ATLA3_HUMAN	Atlastin-3 OS=Homo sapiens OX=9606 GN=ATL3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|Q5JRA6|TGO1_HUMAN	Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1745-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	332-UNIMOD:21	0.02	15.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null	11-UNIMOD:21	0.14	15.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	null		0.02	15.0	1	1	1
PRT	sp|O14929|HAT1_HUMAN	Histone acetyltransferase type B catalytic subunit OS=Homo sapiens OX=9606 GN=HAT1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	361-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q9Y536|PAL4A_HUMAN	Peptidyl-prolyl cis-trans isomerase A-like 4A OS=Homo sapiens OX=9606 GN=PPIAL4A PE=2 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|P00558|PGK1_HUMAN	Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	99-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q8WUM9|S20A1_HUMAN	Sodium-dependent phosphate transporter 1 OS=Homo sapiens OX=9606 GN=SLC20A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	264-UNIMOD:4,265-UNIMOD:21,269-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	68-UNIMOD:4,75-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	337-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.08	14.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.16	14.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	714-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q96K76|UBP47_HUMAN	Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1013-UNIMOD:21	0.02	14.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.05	14.0	2	2	2
PRT	sp|P50613|CDK7_HUMAN	Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	null	164-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.03	13.0	1	1	1
PRT	sp|Q9NVJ2|ARL8B_HUMAN	ADP-ribosylation factor-like protein 8B OS=Homo sapiens OX=9606 GN=ARL8B PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.05	13.0	1	1	1
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.07	13.0	1	1	1
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.01	13.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	206-UNIMOD:4	0.06	13.0	1	1	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null	559-UNIMOD:4,562-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|P25786|PSA1_HUMAN	Proteasome subunit alpha type-1 OS=Homo sapiens OX=9606 GN=PSMA1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	1
PRT	sp|Q9BWT1|CDCA7_HUMAN	Cell division cycle-associated protein 7 OS=Homo sapiens OX=9606 GN=CDCA7 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null		0.05	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DATNVGDEGGFAPNILENK	1	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=1.1.4351.2	42.94372	3	1959.925871	1959.917400	K	E	203	222
PSM	DNLTLWTSDTQGDEAEAGEGGEN	2	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=1.1.4542.3	46.07092	3	2408.000171	2407.988786	R	-	223	246
PSM	VPSPLEGSEGDGDTD	3	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3683.3	31.64337	2	1553.582447	1553.577043	K	-	413	428
PSM	DNLTLWTSDMQGDGEEQNK	4	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=1.1.4404.2	43.64275	3	2179.942571	2179.932792	R	E	226	245
PSM	DNLTLWTSDMQGDGEEQNK	5	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.4388.2	43.45218	3	2179.942571	2179.932792	R	E	226	245
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	6	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=1.1.3661.3	31.2939	4	3223.246894	3223.230486	K	-	122	148
PSM	DNLTLWTSDQQDDDGGEGNN	7	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=1.1.4450.2	44.3956	3	2192.882171	2192.873028	R	-	228	248
PSM	TPEELDDSDFETEDFDVR	8	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4675.2	47.43372	3	2237.864771	2237.852550	R	S	634	652
PSM	DSALQDTDDSDDDPVLIPGAR	9	sp|Q58WW2|DCAF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	7-UNIMOD:21	ms_run[1]:scan=1.1.4515.2	45.63498	3	2293.970471	2293.958746	R	Y	648	669
PSM	TDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	10	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=1.1.3656.2	31.15538	4	3340.230094	3340.220589	R	G	294	325
PSM	KVEEEQEADEEDVSEEEAESK	11	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=1.1.3204.2	22.02297	3	2437.018271	2437.013998	K	E	234	255
PSM	DNLTLWTSDQQDDDGGEGNN	12	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4492.2	45.23928	3	2192.882471	2192.873028	R	-	228	248
PSM	DNLTLWTSENQGDEGDAGEGEN	13	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=1.1.4457.2	44.57202	3	2349.958271	2349.946922	R	-	225	247
PSM	NGSLDSPGKQDTEEDEEEDEK	14	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2968.2	18.946	3	2429.930471	2429.923149	K	D	134	155
PSM	DATNVGDEGGFAPNILENK	15	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4339.2	42.72443	3	1959.925871	1959.917400	K	E	203	222
PSM	TPEELDDSDFETEDFDVR	16	sp|P35221|CTNA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4649.2	47.22798	3	2237.864771	2237.852550	R	S	634	652
PSM	DNLTLWTSENQGDEGDAGEGEN	17	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4448.3	44.35102	3	2349.958271	2349.946922	R	-	225	247
PSM	GVVDSEDLPLNISR	18	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=1.1.4234.2	41.19027	2	1512.780447	1512.778387	R	E	387	401
PSM	ADQLTEEQIAEFK	19	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4566.2	46.42605	2	1562.7572	1562.7462	M	E	2	15
PSM	DSGSDEDFLMEDDDDSDYGSSK	20	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=1.1.4140.2	39.56161	3	2427.875171	2427.865619	K	K	129	151
PSM	ADKPDMGEIASFDK	21	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1	ms_run[1]:scan=1.1.4051.2	38.14642	2	1564.7113	1564.7074	M	A	2	16
PSM	LIAPVAEEEATVPNNK	22	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.3710.2	32.137	3	1693.889471	1693.888666	K	I	8	24
PSM	DNLTLWTSDQQDEEAGEGN	23	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4486.2	45.07852	3	2120.884571	2120.877051	R	-	228	247
PSM	DNLTLWTSDQQDDDGGEGNN	24	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4484.2	45.0377	3	2192.882471	2192.873028	R	-	228	248
PSM	DNLTLWTSENQGDEGDAGEGEN	25	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=1.1.4440.2	44.1594	3	2349.958271	2349.946922	R	-	225	247
PSM	DNLTLWTSDSAGEECDAAEGAEN	26	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4617.3	46.98326	3	2453.991071	2453.976507	R	-	223	246
PSM	IVRGDQPAASGDSDDDEPPPLPR	27	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	32.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3546.3	29.03195	3	2483.103971	2483.096577	K	L	45	68
PSM	GDRSEDFGVNEDLADSDAR	28	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3634.2	30.84137	3	2066.884571	2066.877720	K	A	186	205
PSM	PCSEETPAISPSK	29	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3192.2	21.83345	2	1481.6131	1481.6104	M	R	2	15
PSM	DVAEAKPELSLLGDGDH	30	sp|Q2TAA2|IAH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4112.2	39.2085	3	1764.855671	1764.853008	R	-	232	249
PSM	DLEAEHVEVEDTTLNR	31	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3709.2	32.10145	3	1868.876771	1868.875201	R	C	15	31
PSM	DGARPDVTESESGSPEYR	32	sp|P05187|PPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.3198.2	21.92863	3	1950.864971	1950.855528	K	Q	425	443
PSM	NGVIQHTGAAAEEFNDDTD	33	sp|Q8WU17|RN139_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3612.3	30.37003	3	2082.822071	2082.816773	R	-	646	665
PSM	HTGCCGDNDPIDVCEIGSK	34	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4,5-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.3562.2	29.34285	3	2132.865071	2132.856139	K	V	110	129
PSM	DNLTLWTSDQQDDDGGEGNN	35	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4460.2	44.6253	3	2192.882171	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	36	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=1.1.4503.2	45.44238	3	2192.882471	2192.873028	R	-	228	248
PSM	DNLTLWTSDMQGDGEEQNK	37	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4029.3	37.69842	3	2195.932871	2195.927707	R	E	226	245
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	38	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	31.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4282.3	41.8521	4	3393.359294	3393.345713	K	F	86	114
PSM	VEIIANDQGNR	39	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3225.3	22.49405	2	1227.622047	1227.620764	R	I	50	61
PSM	VPSPLEGSEGDGDTD	40	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3670.3	31.44063	2	1553.582447	1553.577043	K	-	413	428
PSM	LGAGGGSPEKSPSAQELK	41	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3183.2	21.6625	3	1791.846371	1791.840409	R	E	13	31
PSM	NTNDANSCQIIIPQNQVNR	42	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3629.2	30.71363	3	2198.055071	2198.049828	K	K	310	329
PSM	STTPPPAEPVSLPQEPPKPR	43	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3706.2	32.03485	3	2204.094671	2204.087850	K	V	225	245
PSM	DLGSTEDGDGTDDFLTDKEDEK	44	sp|Q15527|SURF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=1.1.3829.2	34.48095	3	2401.005371	2400.992869	K	A	180	202
PSM	NFSDNQLQEGK	45	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3222.3	22.4187	2	1278.586247	1278.584044	R	N	161	172
PSM	NRVIGSGCNLDSAR	46	sp|Q6ZMR3|LDH6A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3153.2	21.19822	3	1517.737571	1517.736873	K	F	156	170
PSM	NQLTSNPENTVFDAK	47	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3716.2	32.29053	3	1676.802071	1676.800579	K	R	82	97
PSM	TITLEVEPSDTIENVK	48	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.4195.2	40.39186	3	1786.923971	1786.920025	K	A	12	28
PSM	DKPHVNVGTIGHVDHGK	49	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=1.1.3193.2	21.85848	4	1808.926494	1808.928179	R	T	54	71
PSM	SQSLPNSLDYTQTSDPGR	50	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3836.2	34.61293	3	2044.877471	2044.873894	R	H	44	62
PSM	DNLTLWTSDMQGDGEEQNK	51	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:35	ms_run[1]:scan=1.1.4042.2	37.9183	3	2195.932871	2195.927707	R	E	226	245
PSM	EALQDVEDENQ	52	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3382.3	25.47027	2	1288.543447	1288.541905	K	-	245	256
PSM	NIIHGSDSVESAEK	53	sp|P15531|NDKA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3136.2	20.91118	3	1484.707271	1484.710701	R	E	115	129
PSM	LAELPAAAQPSAEDSDTEDDSEAEQTER	54	sp|O95714|HERC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3798.3	33.96805	4	3054.255694	3054.246274	K	N	1928	1956
PSM	NPDDITNEEYGEFYK	55	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.3989.2	37.10548	3	1832.775971	1832.774089	R	S	300	315
PSM	DNLTLWTSDQQDDDGGEGNN	56	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4475.2	44.8185	3	2192.882171	2192.873028	R	-	228	248
PSM	DYEEVGVDSVEGEGEEEGEEY	57	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4310.2	42.32022	3	2347.906571	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	58	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=1.1.4501.2	45.3913	3	2349.958271	2349.946922	R	-	225	247
PSM	ERIQQFDDGGSDEEDIWEEK	59	sp|Q5H9R7|PP6R3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4182.2	40.23642	3	2504.017871	2504.001674	K	H	607	627
PSM	HQGVMVGMGQKDSYVGDEAQSK	60	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3450.4	26.93133	4	2430.042094	2430.034511	R	R	42	64
PSM	KITIADCGQLE	61	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3572.2	29.59375	2	1246.624047	1246.622738	K	-	155	166
PSM	EGMNIVEAMER	62	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4155.2	39.87568	2	1277.576447	1277.574407	K	F	134	145
PSM	DSVFLSCSEDNR	63	sp|Q9BQA1|MEP50_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3584.2	29.8073	2	1427.600647	1427.598708	K	I	180	192
PSM	RNSLTGEEGQLAR	64	sp|Q9BX95|SGPP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3304.4	23.72947	3	1509.696971	1509.693685	R	V	110	123
PSM	DVVICPDASLEDAKK	65	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3658.2	31.21683	3	1658.822471	1658.818537	R	E	49	64
PSM	HVPDSGATATAYLCGVK	66	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3800.2	34.01898	3	1825.809071	1825.807001	K	G	110	127
PSM	VVVAENFDEIVNNENK	67	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4199.2	40.48378	3	1831.900571	1831.895208	K	D	380	396
PSM	DKGDEEEEGEEKLEEK	68	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3073.2	20.04065	4	1891.819294	1891.817077	K	Q	536	552
PSM	YAALSVDGEDENEGEDYAE	69	sp|P23588|IF4B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.3963.2	36.70005	3	2074.817471	2074.812719	K	-	593	612
PSM	DNLTLWTSDMQGDGEEQNK	70	sp|P62258|1433E_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4426.2	43.998	3	2179.938371	2179.932792	R	E	226	245
PSM	DNLTLWTSDTQGDEAEAGEGGEN	71	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4571.2	46.4966	3	2408.000171	2407.988786	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	72	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=1.1.4554.2	46.27345	3	2408.000171	2407.988786	R	-	223	246
PSM	DNLTLWTSDSAGEECDAAEGAEN	73	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	15-UNIMOD:4	ms_run[1]:scan=1.1.4594.2	46.77785	3	2453.991071	2453.976507	R	-	223	246
PSM	TCSDSEDIGSSECSDTDSEEQGDHARPK	74	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:21	ms_run[1]:scan=1.1.2943.2	18.68097	4	3178.171694	3178.161241	R	K	494	522
PSM	SADTLWDIQK	75	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3932.2	36.33555	2	1175.584047	1175.582253	K	D	320	330
PSM	ELISNSSDALDK	76	sp|Q14568|HS902_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3436.3	26.60965	2	1290.629047	1290.630326	R	I	47	59
PSM	EGLELPEDEEEK	77	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3623.2	30.57825	2	1415.634047	1415.630385	K	K	412	424
PSM	VPSPLEGSEGDGDTD	78	sp|Q9Y606|TRUA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3694.3	31.85142	2	1553.582447	1553.577043	K	-	413	428
PSM	HVPDSGATATAYLCGVK	79	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3811.2	34.21455	3	1825.809071	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	80	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4259.2	41.5496	3	1830.824171	1830.822317	R	A	107	124
PSM	QVPDSAATATAYLCGVK	81	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4243.2	41.36133	3	1830.824171	1830.822317	R	A	107	124
PSM	ESEDKPEIEDVGSDEEEEK	82	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.3332.2	24.2819	3	2191.920071	2191.912828	K	K	251	270
PSM	DNLTLWTSDQQDDDGGEGNN	83	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4516.2	45.6602	3	2192.882471	2192.873028	R	-	228	248
PSM	TPVDESDDEIQHDEIPTGK	84	sp|Q86TC9|MYPN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3563.2	29.37197	3	2203.922771	2203.915819	R	C	923	942
PSM	DNLTLWTSENQGDEGDAGEGEN	85	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4680.2	47.48465	3	2349.959471	2349.946922	R	-	225	247
PSM	DNLTLWTADNAGEEGGEAPQEPQS	86	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=1.1.4593.2	46.75248	3	2528.107271	2528.093920	R	-	225	249
PSM	NGSLDSPGKQDTEEDEEEDEKDK	87	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2896.3	18.11122	4	2673.047694	2673.045055	K	G	134	157
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	88	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:21	ms_run[1]:scan=1.1.4147.3	39.71338	3	2988.166871	2988.155727	K	E	144	170
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	89	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4312.4	42.37063	3	3014.204171	3014.188484	K	-	661	690
PSM	SCINLPTVLPGSPSK	90	sp|P04183|KITH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,2-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.5573.2	54.72313	3	1690.8040	1690.7996	M	T	2	17
PSM	STTPPPAEPVSLPQEPPKPR	91	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3714.2	32.23948	4	2204.089694	2204.087850	K	V	225	245
PSM	VEVTEFEDIK	92	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3901.2	35.80143	2	1207.595847	1207.597235	K	S	133	143
PSM	IVRGDQPAASGDSDDDEPPPLPR	93	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3556.2	29.19188	4	2483.103294	2483.096577	K	L	45	68
PSM	DVIELTDDSFDK	94	sp|Q15084|PDIA6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4262.2	41.62025	2	1395.643847	1395.640556	K	N	161	173
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	95	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=1.1.3879.2	35.50023	4	3459.449294	3459.429735	K	L	104	135
PSM	DRSSFYVNGLTLGGQK	96	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4050.2	38.11115	3	1740.881171	1740.879498	K	C	55	71
PSM	DLEIERPILGQNDNK	97	sp|Q9UGV2|NDRG3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3876.2	35.44328	3	1752.900671	1752.900627	R	S	234	249
PSM	HVPDSGATATAYLCGVK	98	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3827.2	34.4165	3	1825.809071	1825.807001	K	G	110	127
PSM	QVPDSAATATAYLCGVK	99	sp|P09923|PPBI_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.4272.2	41.76357	3	1830.824171	1830.822317	R	A	107	124
PSM	SSTPPGESYFGVSSLQLK	100	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4937.2	49.7516	3	1962.906671	1962.897590	K	G	1041	1059
PSM	DSSTSPGDYVLSVSENSR	101	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4378.2	43.31098	3	1978.823471	1978.815711	R	V	39	57
PSM	DKSPVREPIDNLTPEER	102	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3570.2	29.54292	3	2073.976571	2073.973214	K	D	134	151
PSM	DNLTLWTSDQQDDDGGEGNN	103	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4441.3	44.18472	3	2192.882171	2192.873028	R	-	228	248
PSM	AGEEDEGEEDSDSDYEISAK	104	sp|A2RRP1|NBAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3398.3	25.88022	3	2253.802271	2253.795823	R	A	463	483
PSM	DYHFKVDNDENEHQLSLR	105	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.3631.2	30.75487	4	2258.043294	2258.035223	K	T	28	46
PSM	DYEEVGVDSVEGEGEEEGEEY	106	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4326.2	42.52202	3	2347.906571	2347.897571	K	-	431	452
PSM	DNLTLWTSENQGDEGDAGEGEN	107	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=1.1.4490.3	45.189	3	2349.958271	2349.946922	R	-	225	247
PSM	FEEESKEPVADEEEEDSDDDVEPITEFR	108	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:21	ms_run[1]:scan=1.1.4263.3	41.6454	4	3393.359294	3393.345713	K	F	86	114
PSM	TEDSIRDYEDGMEVDTTPTVAGQFEDADVDH	109	sp|P54105|ICLN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:35	ms_run[1]:scan=1.1.4248.2	41.43192	4	3472.452894	3472.437249	R	-	207	238
PSM	DDDIAALVVDNGSGMCK	110	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.5445.2	53.89833	2	1820.8052	1820.7912	M	A	2	19
PSM	GDLGIEIPAEK	111	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3903.2	35.84257	2	1140.603447	1140.602654	R	V	295	306
PSM	DSAQNSVIIVDK	112	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3491.3	27.80828	2	1287.668247	1287.667045	K	N	194	206
PSM	TAFQEALDAAGDK	113	sp|P10599|THIO_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3888.2	35.66393	2	1335.632647	1335.630660	K	L	9	22
PSM	IVSAQSLAEDDVE	114	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3883.3	35.6023	2	1374.654047	1374.651455	R	-	133	146
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	115	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4,14-UNIMOD:21,22-UNIMOD:35	ms_run[1]:scan=1.1.3294.4	23.51558	4	2795.090894	2795.089914	K	M	571	596
PSM	ESVPEFPLSPPK	116	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4479.2	44.91051	2	1405.659247	1405.653049	K	K	30	42
PSM	EGLELPEDEEEK	117	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3632.4	30.78392	2	1415.634047	1415.630385	K	K	412	424
PSM	DHQYQFLEDAVR	118	sp|Q13263|TIF1B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.4008.2	37.33875	3	1519.708271	1519.705556	K	N	239	251
PSM	PFSAPKPQTSPSPK	119	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3238.3	22.67083	3	1547.741171	1547.738510	K	R	299	313
PSM	DHQTITIQEMPEK	120	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3489.3	27.75738	3	1568.750471	1568.750458	K	A	195	208
PSM	NLDIERPTYTNLNR	121	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3685.2	31.69208	3	1717.879271	1717.874747	R	L	216	230
PSM	SGKYDLDFKSPDDPSR	122	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.3501.3	28.04232	4	1825.849694	1825.848257	R	Y	254	270
PSM	DCDLQEDEACYNCGR	123	sp|P62633-4|CNBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.3407.2	26.11657	3	1903.682771	1903.677112	K	G	66	81
PSM	EVEDKESEGEEEDEDEDLSK	124	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3139.2	20.98595	3	2418.903671	2418.895931	K	Y	147	167
PSM	NGSLDSPGKQDTEEDEEEDEKDK	125	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=1.1.2983.3	19.07457	4	2594.068894	2593.078724	K	G	134	157
PSM	ALLYLCGGDD	126	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4390.2	43.4834	2	1095.490647	1095.490661	K	-	330	340
PSM	STTPPPAEPVSLPQEPPKPR	127	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3705.2	31.99932	4	2204.091294	2204.087850	K	V	225	245
PSM	ITIADCGQLE	128	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3835.2	34.58758	2	1118.528447	1118.527775	K	-	156	166
PSM	DRVTDALNATR	129	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3445.2	26.83708	3	1230.630371	1230.631663	K	A	419	430
PSM	DQVANSAFVER	130	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3382.2	25.46693	2	1234.595847	1234.594215	K	L	500	511
PSM	IGEGTYGVVYK	131	sp|P06493|CDK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3511.2	28.25352	2	1264.574647	1264.574071	K	G	10	21
PSM	GYFEYIEENK	132	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4025.3	37.61503	2	1290.578047	1290.576833	R	Y	256	266
PSM	RLSQSDEDVIR	133	sp|Q9H7D7|WDR26_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3319.3	24.01367	3	1396.633871	1396.634773	K	L	119	130
PSM	YHTSQSGDEMTSLSEYVSR	134	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3874.3	35.39292	3	2175.941771	2175.937877	R	M	457	476
PSM	PCSEETPAISPSK	135	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	2-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=1.1.3181.3	21.61222	2	1481.6131	1481.6104	M	R	2	15
PSM	RGPGLYYVDSEGNR	136	sp|P28074|PSB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3453.3	27.0144	3	1581.752771	1581.753569	K	I	166	180
PSM	DMESPTKLDVTLAK	137	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3988.2	37.0801	3	1626.759671	1626.757591	K	D	277	291
PSM	GRSRSPQRPGWSR	138	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2942.2	18.6556	4	1685.72809419132	1685.7301015848898	R	S	532	545
PSM	STAGDTHLGGEDFDNR	139	sp|P54652|HSP72_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3292.3	23.47193	3	1690.722671	1690.718306	K	M	224	240
PSM	NRPTSISWDGLDSGK	140	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3927.2	36.21655	3	1711.757171	1711.756680	K	L	48	63
PSM	DSSTSPGDYVLSVSENSR	141	sp|P46108|CRK_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4392.2	43.51525	3	1978.823471	1978.815711	R	V	39	57
PSM	SGPKPFSAPKPQTSPSPK	142	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.3287.2	23.36432	4	1996.906894	1996.906060	R	R	295	313
PSM	INSSGESGDESDEFLQSR	143	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3725.2	32.4928	3	2035.805471	2035.800789	R	K	180	198
PSM	DKSPVREPIDNLTPEER	144	sp|Q14498|RBM39_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3569.3	29.51737	4	2073.972494	2073.973214	K	D	134	151
PSM	DLLLTSSYLSDSGSTGEHTK	145	sp|P08195|4F2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4172.2	40.10333	3	2110.017971	2110.006609	K	S	397	417
PSM	KLEKEEEEGISQESSEEEQ	146	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.3118.2	20.66403	3	2235.993371	2235.986661	K	-	89	108
PSM	DNLTLWTSENQGDEGDAGEGEN	147	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4473.2	44.77798	3	2349.958271	2349.946922	R	-	225	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	148	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4530.3	45.86577	3	2408.000171	2407.988786	R	-	223	246
PSM	NQIHVKSPPREGSQGELTPANSQSR	149	sp|Q13098|CSN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3207.4	22.07893	4	2796.337694	2796.330434	R	M	462	487
PSM	LIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGR	150	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=1.1.2936.2	18.58205	5	3423.328118	3423.317893	R	A	81	114
PSM	NPDDITQEEYGEFYK	151	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=1.1.4029.2	37.68842	3	1846.792871	1846.789740	R	S	292	307
PSM	SDKPDMAEIEKFDK	152	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3835.3	34.59758	3	1693.7873	1693.7864	M	S	2	16
PSM	SLSRSISQSSTDSYSSAASYTDSSDDEVSPR	153	sp|O43865|SAHH2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3904.5	35.87831	4	3431.373294	3431.356309	R	E	62	93
PSM	DLHDANTDLIGRHPK	154	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3290.2	23.42108	4	1700.856894	1700.859431	K	Q	225	240
PSM	LVLVGDGGTGK	155	sp|P62826|RAN_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3449.2	26.91255	2	1014.568847	1014.570960	K	T	13	24
PSM	DGGAWGTEQR	156	sp|P09382|LEG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3110.2	20.52035	2	1075.469047	1075.468286	K	E	65	75
PSM	VTLTSEEEAR	157	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3154.3	21.23362	2	1133.556847	1133.556432	K	L	306	316
PSM	FEDENFILK	158	sp|P62937|PPIA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4068.2	38.42347	2	1153.565647	1153.565540	K	H	83	92
PSM	NFEDVAFDEK	159	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3823.2	34.34627	2	1212.530047	1212.529883	K	K	376	386
PSM	DSPSVWAAVPGK	160	sp|P07737|PROF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3898.2	35.75182	2	1212.615247	1212.613888	K	T	27	39
PSM	DNSTMGYMMAK	161	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3598.3	30.07293	2	1247.499447	1247.498465	R	K	486	497
PSM	EQVANSAFVER	162	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3343.2	24.54578	2	1248.610647	1248.609865	K	V	365	376
PSM	AQTPPGPSLSGSK	163	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3218.3	22.31875	2	1305.599047	1305.596597	K	S	1001	1014
PSM	GQNQPVLNITNK	164	sp|P31327|CPSM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3451.2	26.96352	2	1324.709047	1324.709913	R	Q	317	329
PSM	DNNQFASASLDR	165	sp|P35606|COPB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3452.4	26.98227	2	1336.603047	1336.600757	K	T	154	166
PSM	YALYDATYETK	166	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3677.2	31.57138	2	1336.620047	1336.618698	R	E	82	93
PSM	DKKDEEEDMSLD	167	sp|Q16186|ADRM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3208.2	22.10455	3	1452.591971	1452.592620	K	-	396	408
PSM	HVFGESDELIGQK	168	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3583.2	29.7719	3	1457.715371	1457.715058	R	V	138	151
PSM	DNGIRPSSLEQMAK	169	sp|P55084|ECHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3618.2	30.48687	3	1544.761571	1544.761691	K	L	278	292
PSM	NGRVEIIANDQGNR	170	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3171.3	21.4199	3	1554.786971	1554.786266	K	I	47	61
PSM	ATAGDTHLGGEDFDNR	171	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3301.2	23.66082	3	1674.725471	1674.723391	K	L	221	237
PSM	DGQVINETSQHHDDLE	172	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.3265.5	23.05193	3	1835.796371	1835.792199	R	-	451	467
PSM	YNDWSDDDDDSNESK	173	sp|Q9UH62|ARMX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3228.2	22.5507	3	1883.607071	1883.600692	R	S	57	72
PSM	INSSGESGDESDEFLQSRK	174	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3486.2	27.68762	3	2163.903671	2163.895752	R	G	180	199
PSM	DNLTLWTSENQGDEGDAGEGEN	175	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4482.2	44.9869	3	2349.958271	2349.946922	R	-	225	247
PSM	DSGSDEDFLMEDDDDSDYGSSK	176	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=1.1.4149.3	39.75552	3	2427.875171	2427.865619	K	K	129	151
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	177	sp|Q9NPQ8|RIC8A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	18-UNIMOD:21	ms_run[1]:scan=1.1.3531.3	28.69107	3	2742.075671	2742.064016	R	E	424	448
PSM	NGSLDSPGKQDTEEDEEEDEKDK	178	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2984.2	19.09922	4	2674.035294	2673.045055	K	G	134	157
PSM	GTPQKDVIIK	179	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.3484.2	27.63657	2	1219.6201	1219.6208	M	S	2	12
PSM	ASLEVSRSPR	180	sp|O60762|DPM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=1.1.3399.2	25.91223	2	1222.5733	1222.5702	M	R	2	12
PSM	DAHNALLDIQSSGR	181	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3662.2	31.31958	3	1495.738571	1495.737919	K	A	628	642
PSM	ALLLLCGEDD	182	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4817.2	48.4954	2	1117.534647	1117.532526	K	-	311	321
PSM	NLQTVNVDEN	183	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3388.3	25.62507	2	1144.536647	1144.536031	K	-	116	126
PSM	IYQYIQSR	184	sp|Q13627|DYR1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3291.2	23.44678	2	1149.521647	1149.521975	R	F	318	326
PSM	QVVESAYEVIK	185	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3721.2	32.39045	2	1263.671447	1263.671068	K	L	233	244
PSM	NNASTDYDLSDK	186	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3176.3	21.50825	2	1341.566647	1341.568454	K	S	301	313
PSM	ESVPEFPLSPPK	187	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4487.2	45.1036	2	1405.659247	1405.653049	K	K	30	42
PSM	EQFLDGDGWTSR	188	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4023.2	37.56408	2	1409.623047	1409.621158	K	W	25	37
PSM	HKLDVTSVEDYK	189	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3415.2	26.26467	3	1432.721471	1432.719809	K	A	264	276
PSM	EFHLNESGDPSSK	190	sp|P0DME0|SETLP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3268.2	23.08928	3	1445.643671	1445.642287	K	S	165	178
PSM	DHASIQMNVAEVDK	191	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3533.2	28.729	3	1555.732571	1555.730056	K	V	28	42
PSM	DFTVSAMHGDMDQK	192	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3628.2	30.67803	3	1580.662571	1580.659928	R	E	296	310
PSM	CSDVSELSSSPPGPYHQEPYVCKPEER	193	sp|Q9Y478|AAKB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,10-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=1.1.3721.3	32.40045	4	3213.354494	3213.342046	K	F	173	200
PSM	DVTPPPETEVVLIK	194	sp|P27816|MAP4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4531.2	45.88093	3	1615.814171	1615.811007	K	N	519	533
PSM	QNEPFVATQSSACVDGPANH	195	sp|O00180|KCNK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3585.2	29.8228	3	2127.932771	2127.927981	K	-	317	337
PSM	DNLTLWTSDQQDDDGGEGNN	196	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.4712.2	47.76507	3	2192.883371	2192.873028	R	-	228	248
PSM	TVGTPIASVPGSTNTGTVPGSEK	197	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3760.3	33.24683	3	2236.068971	2236.062423	R	D	270	293
PSM	ESEDKPEIEDVGSDEEEEKK	198	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1.1.3213.3	22.21177	4	2320.012894	2320.007791	K	D	251	271
PSM	SDAAVDTSSEITTK	199	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=1.1.3501.5	28.04898	2	1465.6810	1465.6779	M	D	2	16
PSM	SKAELMEISEDK	200	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3401.2	25.95028	3	1378.663871	1378.664997	K	T	75	87
PSM	HGESAWNLENR	201	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3488.3	27.73187	3	1391.560271	1391.561943	R	F	11	22
PSM	SCNCLLLK	202	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.3477.3	27.45783	2	1006.495447	1006.493973	K	V	336	344
PSM	DNQNFCVPCYEK	203	sp|Q14192|FHL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=1.1.3701.2	31.94362	3	1572.634571	1572.633714	K	Q	145	157
PSM	DGYNYTLSK	204	sp|P31949|S10AB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3383.3	25.49877	2	1059.486447	1059.487290	K	T	28	37
PSM	SADTLWGIQK	205	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3825.2	34.37808	2	1117.575247	1117.576774	K	E	319	329
PSM	TYLEEELDK	206	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3630.2	30.73928	2	1138.546047	1138.539385	K	W	85	94
PSM	YIDQEELNK	207	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3219.2	22.33375	2	1150.549847	1150.550619	K	T	198	207
PSM	QLSSGVSEIR	208	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3474.4	27.39273	2	1154.533047	1154.533268	R	H	80	90
PSM	NSFREQLEEEEEAK	209	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3525.2	28.54618	3	1736.787071	1736.785323	K	H	1339	1353
PSM	YLSEVASGDNK	210	sp|P31946|1433B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3134.2	20.86142	2	1181.554447	1181.556432	R	Q	130	141
PSM	SINQPVAFVR	211	sp|Q9GZT3|SLIRP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3964.2	36.72548	2	1209.589047	1209.590724	R	R	15	25
PSM	DGNGYISAAELR	212	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3750.2	32.98707	2	1264.605847	1264.604780	K	H	96	108
PSM	ELISNASDALDK	213	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3604.3	30.19757	2	1274.637047	1274.635411	R	I	103	115
PSM	NSLESYAFNMK	214	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3699.3	31.91172	2	1318.587647	1318.586353	K	A	540	551
PSM	DFTPVCTTELGR	215	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3881.2	35.55157	2	1394.650647	1394.650015	R	A	42	54
PSM	LTFDSSFSPNTGKK	216	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3739.3	32.79443	2	1607.730047	1607.723254	K	N	97	111
PSM	MSPNETLFLESTNK	217	sp|Q9HB90|RRAGC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:21	ms_run[1]:scan=1.1.4235.2	41.2152	3	1689.735071	1689.732104	K	I	85	99
PSM	DYTGCSTSESLSPVK	218	sp|O95297|MPZL1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=1.1.3499.2	27.99115	3	1709.691671	1709.685548	R	Q	199	214
PSM	NLDIERPTYTNLNR	219	sp|Q71U36|TBA1A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3672.3	31.49152	3	1717.879271	1717.874747	R	L	216	230
PSM	NQTAEKEEFEHQQK	220	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.2748.2	16.92187	4	1744.804094	1744.801642	K	E	584	598
PSM	DCEECIQLEPTFIK	221	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=1.1.4505.2	45.49278	3	1780.808171	1780.801173	K	G	416	430
PSM	SYELPDGQVITIGNER	222	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4477.2	44.86553	3	1789.890071	1789.884643	K	F	241	257
PSM	FQEQECPPSPEPTRK	223	sp|P62070|RRAS2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=1.1.3140.2	21.00093	3	1908.810371	1908.807729	K	E	178	193
PSM	SGPKPFSAPKPQTSPSPK	224	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:21	ms_run[1]:scan=1.1.3205.3	22.04797	4	1916.941294	1916.939729	R	R	295	313
PSM	SRDEDNDEDEERLEEEEQNEEEEVDN	225	sp|Q9NRF9|DPOE3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3672.4	31.49818	4	3223.246894	3223.230486	K	-	122	148
PSM	DTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIK	226	sp|P43487|RANG_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.4241.2	41.31095	5	3932.724618	3932.709658	K	T	6	40
PSM	DAENHEAQLKNGSLDSPGKQDTEEDEEEDEK	227	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3257.3	22.88663	5	3566.445118	3565.448950	K	D	124	155
PSM	ASGVAVSDGVIK	228	sp|P23528|COF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=1.1.4101.3	38.98955	2	1223.5838	1223.5794	M	V	2	14
PSM	HQTLEVSLSRDSPLK	229	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3580.3	29.72368	3	1788.875771	1788.877129	K	T	358	373
PSM	NGQDLGVAFK	230	sp|Q00839|HNRPU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=1.1.3771.2	33.47295	2	1048.519847	1047.534909	K	I	424	434
PSM	DRVHHEPQLSDK	231	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.2745.2	16.8849	3	1459.716371	1459.716790	K	V	26	38
PSM	AGFAGDDAPR	232	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3100.2	20.3349	2	975.437847	975.441009	K	A	21	31
PSM	NNAYLAQSPQLYK	233	sp|P14868|SYDC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3786.2	33.74443	3	1588.726871	1588.728674	K	Q	242	255
PSM	DANNGNLQLR	234	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3218.2	22.30875	2	1113.553247	1113.552684	K	N	288	298
PSM	DQIYDIFQK	235	sp|P60842|IF4A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4402.2	43.60172	2	1168.579247	1168.576440	K	L	194	203
PSM	NNNTDLMILK	236	sp|Q99460|PSMD1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3834.2	34.57218	2	1174.600447	1174.601608	R	N	345	355
PSM	DIQEESTFSSR	237	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3345.4	24.60942	2	1297.576847	1297.578624	K	K	67	78
PSM	NSLESYAFNMK	238	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4034.2	37.77878	2	1302.591447	1302.591438	K	A	540	551
PSM	NELESYAYSLK	239	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3973.2	36.90002	2	1315.629647	1315.629597	R	N	563	574
PSM	YSQVLANGLDNK	240	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3494.3	27.86312	2	1320.668847	1320.667380	K	L	95	107
PSM	ESVPEFPLSPPKKK	241	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3753.2	33.07705	3	1661.845271	1661.842975	K	D	30	44
PSM	DVQDSLTVSNEAQTAK	242	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.3472.4	27.34133	3	1704.817271	1704.816623	K	E	211	227
PSM	GEAAAERPGEAAVASSPSK	243	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=1.1.2959.3	18.79185	3	1863.838271	1863.836387	K	A	12	31
PSM	KLSSNCSGVEGDVTDEDEGAEMSQR	244	sp|Q9UPR0|PLCL2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=1.1.3450.5	26.938	3	2779.105871	2779.094999	K	M	571	596
PSM	DNLTLWTSDQQDDDGGEGNN	245	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=1.1.4542.2	46.06092	3	2194.880171	2192.873028	R	-	228	248
PSM	KASPPSGLWSPAYASH	246	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	19.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3926.2	36.20112	3	1734.778871	1734.776687	R	-	1872	1888
PSM	DIGFIKLD	247	sp|P62273|RS29_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4785.2	48.27077	2	919.502247	919.501484	K	-	49	57
PSM	VSDQNSPVLPKK	248	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3007.2	19.27813	3	1390.688471	1390.685746	R	S	2042	2054
PSM	EIAEAYLGK	249	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3512.2	28.27903	2	992.515847	992.517862	K	T	129	138
PSM	DGLTDVYNK	250	sp|P24752|THIL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3437.2	26.64243	2	1023.485847	1023.487290	K	I	182	191
PSM	QQEGESRLNLVQR	251	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3309.2	23.79642	3	1555.806971	1555.806667	R	N	100	113
PSM	ALLYLCGGDD	252	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=1.1.4406.2	43.68447	2	1095.490647	1095.490661	K	-	330	340
PSM	MSGFIYQGK	253	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3795.3	33.89175	2	1109.463847	1109.461683	R	I	487	496
PSM	DQLIYNLLK	254	sp|P00338|LDHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4843.2	48.71965	2	1118.635647	1118.633560	K	E	6	15
PSM	MSGFIYQGK	255	sp|Q15052|ARHG6_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,2-UNIMOD:21	ms_run[1]:scan=1.1.3530.4	28.66555	2	1125.459647	1125.456598	R	I	487	496
PSM	NAGVEGSLIVEK	256	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3536.2	28.80598	2	1214.651847	1214.650667	K	I	482	494
PSM	LDIDSPPITAR	257	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4008.3	37.34875	2	1276.611247	1276.606433	R	N	33	44
PSM	SSPNPFVGSPPK	258	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3702.2	31.96975	2	1292.580447	1292.580219	K	G	393	405
PSM	DVLSVAFSSDNR	259	sp|P63244|RACK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4242.2	41.32618	2	1308.632447	1308.630994	K	Q	107	119
PSM	GYSSPEPDIQDSSGSEAQSVKPSTR	260	sp|Q9BZF1|OSBL8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3444.2	26.82133	4	2688.161694	2688.155214	K	R	796	821
PSM	DSSSTNLESMDTS	261	sp|Q86VP6|CAND1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3443.3	26.79575	2	1372.533847	1372.530019	K	-	1218	1231
PSM	SLLDASEEAIKK	262	sp|P18206|VINC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=1.1.3719.2	32.34828	3	1382.664071	1382.669428	K	D	721	733
PSM	AFLAELEQNSPK	263	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=1.1.4212.3	40.7522	2	1425.659247	1425.654112	K	I	4512	4524
PSM	TLRLNQPGTPTR	264	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3265.3	23.04193	3	1432.716971	1432.718778	K	T	386	398
PSM	DNPGVVTCLDEAR	265	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3684.3	31.66973	2	1444.664847	1444.661643	K	H	227	240
PSM	EVDEQMLNVQNK	266	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:35	ms_run[1]:scan=1.1.3207.3	22.07227	3	1461.674771	1461.676959	K	N	325	337
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	267	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3758.3	33.1952	4	3044.165294	3044.151982	K	L	595	622
PSM	DINAYNCEEPTEK	268	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:4	ms_run[1]:scan=1.1.3293.3	23.49713	3	1581.658871	1581.661702	K	L	85	98
PSM	QDENDDDDDWNPCK	269	sp|Q14974|IMB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3394.3	25.77758	3	1764.619271	1764.616937	K	A	333	347
PSM	QLEDGRTLSDYNIQK	270	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3522.2	28.49712	3	1778.883671	1778.879892	K	E	49	64
PSM	HIAEEADRKYEEVAR	271	sp|P06753|TPM3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3221.2	22.38362	4	1814.894894	1814.891125	K	K	154	169
PSM	AASPPASASDLIEQQQK	272	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3770.4	33.45092	3	1819.837871	1819.835324	R	R	333	350
PSM	FLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQK	273	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.4699.2	47.64345	4	3756.474094	3756.438824	K	A	469	503
PSM	SLDSDESEDEEDDYQQK	274	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3220.3	22.36202	3	2110.745171	2110.737580	K	R	57	74
PSM	IVRGDQPAASGDSDDDEPPPLPR	275	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=1.1.3558.2	29.24042	3	2483.103971	2483.096577	K	L	45	68
PSM	DSGSDEDFLMEDDDDSDYGSSKK	276	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3846.2	34.76728	3	2555.967971	2555.960582	K	K	129	152
PSM	LAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	277	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3599.3	30.09842	3	3722.219171	3722.195067	K	A	158	190
PSM	NGRVEIIANDQGNR	278	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=1.1.3342.2	24.53423	3	1555.769771	1554.786266	K	I	47	61
PSM	NGSLDSPGKQDTEEDEEEDEK	279	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3087.2	20.18622	3	2430.914171	2429.923149	K	D	134	155
PSM	MLAESDESGDEESVSQTDKTELQNTLR	280	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35,5-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=1.1.4047.2	38.04505	4	3187.294494	3187.278911	K	T	186	213
PSM	RRSPSPYYSR	281	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2849.2	17.71203	3	1347.608171	1347.608499	R	Y	258	268
PSM	DFDTALK	282	sp|P31948|STIP1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3460.2	27.1177	2	808.394447	808.396684	K	H	240	247
PSM	NSLLSLSDT	283	sp|Q7L2H7|EIF3M_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4212.2	40.7422	2	948.476447	948.476391	K	-	366	375
PSM	KLSFDFQ	284	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.4311.2	42.34552	2	963.410047	963.410300	R	-	465	472
PSM	DVNVNFEK	285	sp|Q15185|TEBP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3410.2	26.17398	2	963.465647	963.466161	K	S	26	34
PSM	DATLTALDR	286	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3517.2	28.3876	2	974.501047	974.503275	K	G	391	400
PSM	DLTDYLMK	287	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:35	ms_run[1]:scan=1.1.4024.2	37.58957	2	1013.473847	1013.473949	R	I	186	194
PSM	DGGFCEVCK	288	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=1.1.3224.3	22.46218	2	1070.414047	1070.416116	K	K	405	414
PSM	DLSLEEIQK	289	sp|P16949|STMN1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3803.2	34.07697	2	1073.561447	1073.560455	K	K	44	53
PSM	TLSDYNIQK	290	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3328.2	24.1792	2	1080.544047	1080.545139	R	E	55	64
PSM	DLNSYLEDK	291	sp|O43324|MCA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3802.2	34.05085	2	1095.509647	1095.508420	K	V	97	106
PSM	RQAQQERDELADEIANSSGK	292	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3457.3	27.06075	4	2244.076094	2244.073066	K	G	1697	1717
PSM	LGIHEDSTNR	293	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2914.2	18.26757	3	1140.554471	1140.552350	K	R	439	449
PSM	DTQLQQIVDK	294	sp|P63098|CANB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3646.2	31.0093	2	1186.617247	1186.619367	K	T	126	136
PSM	DAGTIAGLNVLR	295	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4312.3	42.36397	2	1198.669447	1198.666986	K	I	160	172
PSM	DITSDTSGDFR	296	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3446.5	26.87275	2	1212.526647	1212.525861	K	N	167	178
PSM	DLFDPIIEDR	297	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4917.2	49.50203	2	1231.610647	1231.608468	K	H	87	97
PSM	VDSPTVTTTLK	298	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3433.4	26.55902	2	1240.596847	1240.595200	K	N	458	469
PSM	NSNPALNDNLEK	299	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3244.3	22.77767	2	1327.639247	1327.636808	K	G	120	132
PSM	GEPNVSYICSR	300	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3489.4	27.76405	2	1360.551247	1360.548267	R	Y	273	284
PSM	ESVPEFPLSPPK	301	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=1.1.4465.2	44.69935	2	1405.659247	1405.653049	K	K	30	42
PSM	TPELNLDQFHDK	302	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3770.3	33.44758	3	1455.700271	1455.699408	K	T	171	183
PSM	LTFDSSFSPNTGK	303	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4052.2	38.17188	2	1479.631647	1479.628291	K	K	97	110
PSM	ESLTEAEVATEKEGEDGDQPTTPPKPLK	304	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	22-UNIMOD:21	ms_run[1]:scan=1.1.3708.3	32.08588	4	3075.425694	3075.417302	K	T	162	190
PSM	ALSRQLSSGVSEIR	305	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3784.2	33.69348	3	1661.754671	1661.753917	R	H	76	90
PSM	DAGDKDKEQELSEEDK	306	sp|Q13200|PSMD2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.2824.2	17.46323	3	1834.809371	1834.806846	R	Q	35	51
PSM	QLVRGEPNVSYICSR	307	sp|P49840|GSK3A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=1.1.3627.3	30.65575	3	1856.862671	1856.860433	K	Y	269	284
PSM	DSSTCPGDYVLSVSENSR	308	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=1.1.4337.2	42.66328	3	2051.819771	2051.814331	R	V	40	58
PSM	DYEEVGADSADGEDEGEEY	309	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.3769.2	33.43212	3	2077.744871	2077.739614	K	-	431	450
PSM	DNLTLWTSDQQDDDGGEGNN	310	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4555.2	46.29847	3	2192.881871	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	311	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=1.1.4689.2	47.56045	3	2192.883371	2192.873028	R	-	228	248
PSM	KLEKEEEEGISQESSEEEQ	312	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:21	ms_run[1]:scan=1.1.3099.2	20.31983	3	2315.961371	2315.952992	K	-	89	108
PSM	DSGSDEDFLMEDDDDSDYGSSK	313	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3858.3	35.0601	3	2443.868771	2443.860534	K	K	129	151
PSM	GSAPHSESDLPEQEEEILGSDDDEQEDPNDYCK	314	sp|Q96SB4|SRPK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	17.0	20-UNIMOD:21,32-UNIMOD:4	ms_run[1]:scan=1.1.4067.2	38.40722	4	3813.476494	3813.463279	R	G	32	65
PSM	LDIKLDSEDK	315	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3465.2	27.24505	3	1174.609871	1174.608134	K	D	319	329
PSM	DSLIDSLT	316	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4655.2	47.28528	2	862.427247	862.428378	R	-	238	246
PSM	ADEGISFR	317	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3396.2	25.83565	2	893.422247	893.424296	K	G	121	129
PSM	DCLNVLNK	318	sp|Q99471|PFD5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3495.2	27.8888	2	974.482247	974.485516	K	S	48	56
PSM	DVFQELEK	319	sp|Q16719|KYNU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4044.2	37.9689	2	1006.497447	1006.497127	K	R	413	421
PSM	DWDDDQND	320	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3182.3	21.63075	2	1021.323847	1021.326098	K	-	541	549
PSM	EIIDLVLDR	321	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.4862.2	48.89757	2	1084.613047	1084.612825	K	I	113	122
PSM	SIYYITGESK	322	sp|Q58FF8|H90B2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3561.2	29.32048	2	1159.576647	1159.576105	K	E	258	268
PSM	NQDNLQGWNK	323	sp|P30085|KCY_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3311.4	23.85048	2	1215.565247	1215.563249	R	T	97	107
PSM	MEEFKDQLPADECNK	324	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:4	ms_run[1]:scan=1.1.3483.4	27.60447	3	1852.800671	1852.797150	K	L	596	611
PSM	DNSTMGYMMAK	325	sp|Q58FF7|H90B3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:35	ms_run[1]:scan=1.1.3353.2	24.78588	2	1263.495247	1263.493380	R	K	486	497
PSM	LGMLSPEGTCK	326	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=1.1.3711.2	32.15282	2	1271.529847	1271.529111	R	A	203	214
PSM	ISVYYNEATGGK	327	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3458.4	27.08605	2	1300.635247	1300.629932	R	Y	47	59
PSM	GEPNVSYICSR	328	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3481.3	27.56	2	1360.551247	1360.548267	R	Y	273	284
PSM	NNSGEEFDCAFR	329	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:4	ms_run[1]:scan=1.1.3628.3	30.68803	2	1444.572247	1444.567742	R	L	591	603
PSM	DNPGVVTCLDEAR	330	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4	ms_run[1]:scan=1.1.3685.3	31.70208	2	1444.664847	1444.661643	K	H	227	240
PSM	LTFDTTFSPNTGK	331	sp|P45880|VDAC2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=1.1.4209.2	40.66248	2	1507.665047	1507.659591	K	K	108	121
PSM	ESLKEEDESDDDNM	332	sp|P25788|PSA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3135.2	20.88623	3	1654.617671	1654.615206	K	-	242	256
PSM	ESVPEFPLSPPKKK	333	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3743.2	32.87558	3	1661.845271	1661.842975	K	D	30	44
PSM	STTPPPAEPVSLPQEPPKPR	334	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:21	ms_run[1]:scan=1.1.3693.2	31.83265	3	2204.094671	2204.087850	K	V	225	245
PSM	LVQDVANNTNEEAGDGTTTATVLAR	335	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3755.3	33.1281	3	2559.245471	2559.241253	K	S	97	122
PSM	DSGSDEDFLMEDDDDSDYGSSKK	336	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:35	ms_run[1]:scan=1.1.3645.2	30.99395	3	2571.968171	2571.955497	K	K	129	152
PSM	LSSNCSGVEGDVTDEDEGAEMSQR	337	sp|Q9UPR0|PLCL2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=1.1.3559.3	29.27268	3	2651.010371	2651.000036	K	M	572	596
PSM	EALSNLTALTSDSDTDSSSDSDSDTSEGK	338	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	13-UNIMOD:21	ms_run[1]:scan=1.1.4303.3	42.1617	3	3014.204171	3014.188484	K	-	661	690
PSM	ATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEK	339	sp|Q9ULX6|AKP8L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	6-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=1.1.3505.3	28.15505	4	3668.4272	3668.4062	K	G	291	325
PSM	NGSEADIDEGLYSR	340	sp|P22314|UBA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3740.4	32.8191	2	1525.659047	1524.669230	K	Q	44	58
PSM	STIGVMVTASHNPEEDNGVK	341	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=1.1.3497.2	27.94	3	2179.953071	2179.945679	K	L	55	75
PSM	DANNGNLQLR	342	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1.1.3226.3	22.50927	2	1114.536647	1113.552684	K	N	288	298
PSM	GILAADESTGSIAK	343	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3735.2	32.70537	2	1411.659847	1411.659591	K	R	29	43
PSM	NFDEILR	344	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3809.2	34.18267	2	905.460847	905.460681	R	V	156	163
PSM	DLSLDDFK	345	sp|P30048|PRDX3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4194.2	40.36587	2	951.455047	951.454927	K	G	84	92
PSM	DLSTIEPLK	346	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3873.2	35.36768	2	1014.559447	1014.559727	K	K	102	111
PSM	DVNAAIATIK	347	sp|Q71U36|TBA1A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3684.2	31.66307	2	1014.569247	1014.570960	K	T	327	337
PSM	DWDDDQND	348	sp|P50990|TCPQ_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3171.2	21.4099	2	1021.323847	1021.326098	K	-	541	549
PSM	DILIQYDR	349	sp|P62249|RS16_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3806.2	34.1164	2	1034.539047	1034.539660	K	T	110	118
PSM	SGKYDLDFK	350	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3439.2	26.68012	3	1071.523271	1071.523676	R	S	254	263
PSM	DLEGSDIDTR	351	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3239.2	22.68677	2	1119.504047	1119.504397	R	R	373	383
PSM	SCAHDWVYE	352	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3529.2	28.63997	2	1165.451847	1165.449859	K	-	129	138
PSM	IDIIPNPQER	353	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3798.2	33.95805	2	1193.642647	1193.640437	K	T	73	83
PSM	DIDISSPEFK	354	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.4072.2	38.48892	2	1229.524447	1229.521701	K	I	172	182
PSM	AGSSTPGDAPPAVAEVQGR	355	sp|Q7Z6Z7|HUWE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=1.1.3548.4	29.08317	3	1845.831671	1845.825822	R	S	2885	2904
PSM	DNWEELYNR	356	sp|P55786|PSA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3930.3	36.27807	2	1237.534847	1237.536366	K	Y	833	842
PSM	DQHSFELDEK	357	sp|Q6DD88|ATLA3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3319.2	24.01033	3	1246.546271	1246.546596	K	A	35	45
PSM	LMIEMDGTENK	358	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3671.2	31.45927	2	1279.580447	1279.578824	K	S	93	104
PSM	DISTNYYASQK	359	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3346.5	24.63155	2	1288.592647	1288.593546	K	K	672	683
PSM	SSPNPFVGSPPK	360	sp|P98082|DAB2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=1.1.3712.2	32.17845	2	1292.580447	1292.580219	K	G	393	405
PSM	SENGLEFTSSGSANTETTK	361	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3442.3	26.77008	3	1958.875571	1958.870509	K	V	35	54
PSM	GSSPTRVLDEGK	362	sp|Q5JRA6|TGO1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3230.2	22.60142	3	1324.601171	1324.602411	R	V	1743	1755
PSM	TLNMTTSPEEK	363	sp|P49915|GUAA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3300.3	23.62917	2	1329.554447	1329.552349	K	R	326	337
PSM	DIISDTSGDFRK	364	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3674.2	31.51723	3	1352.657771	1352.657209	K	L	158	170
PSM	GEPNVSYICSR	365	sp|P49840|GSK3A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=1.1.3472.5	27.348	2	1360.551247	1360.548267	R	Y	273	284
PSM	DLLHPSPEEEK	366	sp|P42677|RS27_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3513.2	28.30447	3	1372.591271	1372.591177	K	R	6	17
PSM	GILAADESTGSIAK	367	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:21	ms_run[1]:scan=1.1.3663.2	31.33525	2	1411.661447	1411.659591	K	R	29	43
PSM	DNFGFIETANHDK	368	sp|O75534|CSDE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3796.2	33.90717	3	1506.673871	1506.673922	K	E	528	541
PSM	EGLELPEDEEEKK	369	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3445.3	26.84708	3	1543.727171	1543.725348	K	K	412	425
PSM	DFTVSAMHGDMDQK	370	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	11-UNIMOD:35	ms_run[1]:scan=1.1.3416.3	26.29088	3	1596.654971	1596.654843	R	E	296	310
PSM	NHSGSRTPPVALNSSR	371	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3055.2	19.77713	3	1758.818471	1758.816260	R	M	2098	2114
PSM	AASPPASASDLIEQQQK	372	sp|Q5VSL9|STRP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=1.1.3760.2	33.2435	3	1819.837871	1819.835324	R	R	333	350
PSM	NHSGSRTPPVALNSSR	373	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3141.2	21.03583	3	1838.781371	1838.782591	R	M	2098	2114
PSM	MKDTDSEEEIREAFR	374	sp|P0DP23|CALM1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3632.3	30.78058	4	1854.840494	1854.841792	K	V	77	92
PSM	DNLTLWTSDTQGDEAEAGEGGEN	375	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.4588.2	46.70167	3	2408.000171	2407.988786	R	-	223	246
PSM	DGNGYISAAELR	376	sp|P0DP23|CALM1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=1.1.3830.2	34.4933	2	1265.590847	1264.604780	K	H	96	108
PSM	NGSLDSPGKQDTEEDEEEDEK	377	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=1.1.3046.2	19.702	3	2430.914171	2429.923149	K	D	134	155
PSM	QLSSGVSEIR	378	sp|P04792|HSPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=1.1.4151.2	39.79813	2	1137.5067	1137.5062	R	H	80	90
PSM	KASPPSGLWSPAYASH	379	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3944.3	36.4669	3	1734.778871	1734.776687	R	-	1872	1888
PSM	RRSPSPYYSR	380	sp|Q13595|TRA2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1.1.2861.2	17.82342	3	1427.578871	1427.574830	R	Y	258	268
PSM	LISPYK	381	sp|O14929|HAT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3395.2	25.79983	2	799.387447	799.388108	R	K	359	365
PSM	TEWLDGK	382	sp|Q9Y536|PAL4A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3411.2	26.20003	2	847.406247	847.407583	K	H	119	126
PSM	LSDGVAVLK	383	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3477.2	27.44783	2	900.525847	900.528033	K	V	397	406
PSM	DCVGPEVEK	384	sp|P00558|PGK1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4	ms_run[1]:scan=1.1.3025.2	19.49712	2	1031.459647	1031.459361	K	A	98	107
PSM	EIKCSPSESPLMEK	385	sp|Q8WUM9|S20A1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:4,5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=1.1.3452.3	26.97893	3	1793.703971	1793.701806	R	K	261	275
PSM	DIIACGFDINK	386	sp|P23381|SYWC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4	ms_run[1]:scan=1.1.4255.2	41.50348	2	1264.614847	1264.612173	K	T	221	232
PSM	LNQPGTPTRTAV	387	sp|P36507|MP2K2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3264.3	23.02625	2	1333.640047	1333.639131	R	-	389	401
PSM	KGDECELLGHSK	388	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4	ms_run[1]:scan=1.1.3041.2	19.65175	3	1371.646871	1371.645264	K	N	286	298
PSM	NQDECVIALHDCNGDVNR	389	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=1.1.3480.2	27.52445	3	2127.912671	2127.906200	K	A	64	82
PSM	TTPSYVAFTDTER	390	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3751.2	33.01598	2	1486.695447	1486.693989	R	L	37	50
PSM	LAVDEEENADNNTK	391	sp|P02786|TFR1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3071.4	19.98422	3	1560.689771	1560.690360	K	A	40	54
PSM	DIEREDIEFICK	392	sp|P50991|TCPD_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3962.2	36.67385	3	1565.742071	1565.739559	K	T	327	339
PSM	HGSYEDAVHSGALND	393	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3318.2	23.9882	3	1570.663871	1570.664814	K	-	542	557
PSM	NSGQNLEEDMGQSEQK	394	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3294.2	23.50892	3	1792.755071	1792.753371	K	A	35	51
PSM	HVPDSGATATAYLCGVK	395	sp|P05187|PPB1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=1.1.3837.2	34.63502	3	1825.809071	1825.807001	K	G	110	127
PSM	TAENATSGETLEENEAGD	396	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3298.2	23.58452	2	1836.758447	1836.749725	K	-	377	395
PSM	KEESEESDDDMGFGLFD	397	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4928.3	49.64773	2	1948.763247	1948.752033	K	-	98	115
PSM	SQSLPNSLDYTQTSDPGR	398	sp|Q96TC7|RMD3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3826.2	34.39097	3	2044.877471	2044.873894	R	H	44	62
PSM	DNLTLWTSDQQDEEAGEGN	399	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4477.3	44.8722	3	2120.884571	2120.877051	R	-	228	247
PSM	EADDDEEVDDNIPEMPSPKK	400	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=1.1.3777.2	33.56223	3	2351.939771	2351.935234	K	M	698	718
PSM	ETWDTAEEDSGTDSEYDESGK	401	sp|Q96K76|UBP47_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3560.4	29.30488	3	2429.878871	2429.854400	K	S	1004	1025
PSM	DNLTLWTADNAGEEGGEAPQEPQS	402	sp|P31947|1433S_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.4573.2	46.5369	3	2528.107271	2528.093920	R	-	225	249
PSM	NAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDK	403	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=1.1.3432.3	26.53357	4	3365.462894	3365.451593	K	K	799	833
PSM	NGSLDSPGKQDTEEDEEEDEKDK	404	sp|Q9Y266|NUDC_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	12-UNIMOD:21	ms_run[1]:scan=1.1.2959.4	18.79852	4	2674.038894	2673.045055	K	G	134	157
PSM	SFGSPNRAYTHQVVTR	405	sp|P50613|CDK7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=1.1.3343.3	24.55245	3	1898.883071	1898.878860	K	W	161	177
PSM	EGLELLK	406	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3770.2	33.44425	2	800.462047	800.464370	K	T	222	229
PSM	VGVNGFGR	407	sp|P04406|G3P_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3307.2	23.77382	2	804.426047	804.424236	K	I	6	14
PSM	EILDAFDK	408	sp|P07602|SAP_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3936.2	36.38187	2	949.473647	949.475663	K	M	337	345
PSM	KLPEMDID	409	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3708.2	32.07588	2	959.463447	959.463384	K	-	833	841
PSM	DLTDYLMK	410	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4454.2	44.48735	2	997.476847	997.479034	R	I	186	194
PSM	DLPNALDEK	411	sp|Q9NVJ2|ARL8B_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3504.3	28.12283	2	1013.503447	1013.502940	R	Q	133	142
PSM	DVIEEYFK	412	sp|P25398|RS12_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4307.2	42.2344	2	1041.502047	1041.501878	K	C	122	130
PSM	DLFPYEESK	413	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3902.2	35.81702	2	1126.519047	1126.518256	K	E	62	71
PSM	EITALAPSTMK	414	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3599.2	30.08842	2	1160.613447	1160.611110	K	I	318	329
PSM	DHGGALGPEEFK	415	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3398.2	25.87355	3	1255.584371	1255.583316	K	A	780	792
PSM	LKDDEVAQLKK	416	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3071.2	19.97755	3	1285.723571	1285.724166	K	S	309	320
PSM	IDDIRKPGESEE	417	sp|P48643|TCPE_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.2996.2	19.19118	3	1386.661271	1386.662688	K	-	530	542
PSM	EVDEQMLNVQNK	418	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3514.2	28.31663	3	1445.682371	1445.682044	K	N	325	337
PSM	EDQTEYLEERR	419	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3215.2	22.2621	3	1466.664371	1466.663751	K	V	166	177
PSM	DLNHVCVISETGK	420	sp|P00492|HPRT_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:4	ms_run[1]:scan=1.1.3489.2	27.75072	3	1470.713471	1470.713678	R	A	201	214
PSM	GCRLSPRDTYSDR	421	sp|P17812|PYRG1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=1.1.3111.2	20.53527	3	1661.697371	1661.698119	K	S	558	571
PSM	NQYDNDVTVWSPQGR	422	sp|P25786|PSA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3851.3	34.88637	3	1777.806371	1777.801976	R	I	4	19
PSM	EGEDGDQPTTPPKPLK	423	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=1.1.3221.3	22.39362	3	1787.800871	1787.797876	K	T	174	190
PSM	DNLTLWTSDQQDDDGGEGNN	424	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4615.2	46.95227	3	2192.882171	2192.873028	R	-	228	248
PSM	DNLTLWTSDQQDDDGGEGNN	425	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4530.2	45.85577	3	2192.882471	2192.873028	R	-	228	248
PSM	VKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEK	426	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3651.3	31.09092	4	3949.378894	3949.358444	K	A	156	190
PSM	KPATPAEDDEDDDIDLFGSDNEEEDK	427	sp|P29692|EF1D_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	19-UNIMOD:21	ms_run[1]:scan=1.1.4133.2	39.49692	3	2988.166871	2988.155727	K	E	144	170
PSM	DKDDDGGEDDDANCNLICGDEYGPETR	428	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=1.1.3761.4	33.28233	3	3044.168171	3044.151982	K	L	595	622
PSM	MLAESDESGDEESVSQTDKTELQNTLR	429	sp|P22059|OSBP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=1.1.4007.2	37.31342	4	3091.332894	3091.317665	K	T	186	213
PSM	NGRVEIIANDQGNR	430	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.3213.2	22.20177	3	1555.767371	1554.786266	K	I	47	61
PSM	DNLTLWTSDTQGDEAEAGEGGEN	431	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=1.1.4638.2	47.13862	3	2408.992571	2407.988786	R	-	223	246
PSM	ILGSLDALPMEEEEEEDK	432	sp|Q9BWT1|CDCA7_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=1.1.3008.2	19.303	4	2046.9392	2045.9342	R	Y	187	205