MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000031 -- main-final
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220609\20220609112323281485^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\160411_04_3_dko_plus.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220609\20220609112323281485^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\160411_04_3_dko_plus.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.uniprot_mouse_20200318
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.uniprot_mouse_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=20
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.uniprot_mouse_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q61937|NPM_MOUSE	Nucleophosmin OS=Mus musculus (Mouse) OX=10090 GN=Npm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	84.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21,70-UNIMOD:21,138-UNIMOD:35,258-UNIMOD:21,139-UNIMOD:21	0.33	84.0	42	6	0
PRT	tr|Q5SQB0|Q5SQB0_MOUSE	Isoform of Q61937, Nucleophosmin OS=Mus musculus (Mouse) OX=10090 GN=Npm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	83.0	null	104-UNIMOD:4,125-UNIMOD:21,138-UNIMOD:35,65-UNIMOD:35,70-UNIMOD:21,230-UNIMOD:21,75-UNIMOD:21	0.51	83.0	24	8	1
PRT	sp|P63158|HMGB1_MOUSE	High mobility group protein B1 OS=Mus musculus (Mouse) OX=10090 GN=Hmgb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	68.0	null	100-UNIMOD:21,106-UNIMOD:4	0.38	68.0	10	5	2
PRT	sp|Q00PI9|HNRL2_MOUSE	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpul2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	67.0	null	224-UNIMOD:21,226-UNIMOD:21	0.05	67.0	11	1	0
PRT	tr|A0A087WRY3|A0A087WRY3_MOUSE	Isoform of Q80XU3, Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Mus musculus (Mouse) OX=10090 GN=Nucks1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	null	19-UNIMOD:21,180-UNIMOD:21	0.18	64.0	24	5	1
PRT	tr|D3YUQ9|D3YUQ9_MOUSE	Isoform of P57776, EF-1_beta_acid domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Eef1d PE=1 SV=8	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	63.0	null	162-UNIMOD:21,133-UNIMOD:21	0.26	63.0	9	2	0
PRT	sp|O08784|TCOF_MOUSE	Treacle protein OS=Mus musculus (Mouse) OX=10090 GN=Tcof1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	60.0	null	169-UNIMOD:21,165-UNIMOD:21,852-UNIMOD:21,1191-UNIMOD:21,171-UNIMOD:21,853-UNIMOD:21	0.05	60.0	31	6	0
PRT	sp|P30681|HMGB2_MOUSE	High mobility group protein B2 OS=Mus musculus (Mouse) OX=10090 GN=Hmgb2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	60.0	null	100-UNIMOD:21,106-UNIMOD:4	0.30	60.0	17	4	2
PRT	sp|P09405|NUCL_MOUSE	Nucleolin OS=Mus musculus (Mouse) OX=10090 GN=Ncl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	60.0	null	403-UNIMOD:21	0.13	60.0	4	3	2
PRT	sp|Q8VEK3|HNRPU_MOUSE	Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpu PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	59.0	null	247-UNIMOD:21,265-UNIMOD:4,271-UNIMOD:4,2-UNIMOD:1,4-UNIMOD:21	0.12	59.0	43	6	3
PRT	tr|G3X9Q3|G3X9Q3_MOUSE	Isoform of Q3TBD2, Rho GTPase-activating protein 45 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap45 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	null	577-UNIMOD:21,72-UNIMOD:21,568-UNIMOD:21,23-UNIMOD:21,571-UNIMOD:35,563-UNIMOD:21	0.11	58.0	18	5	0
PRT	sp|Q62318|TIF1B_MOUSE	Transcription intermediary factor 1-beta OS=Mus musculus (Mouse) OX=10090 GN=Trim28 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	58.0	null	594-UNIMOD:21,628-UNIMOD:4,600-UNIMOD:21,596-UNIMOD:21,599-UNIMOD:21,601-UNIMOD:21,473-UNIMOD:21,611-UNIMOD:21,752-UNIMOD:21,2-UNIMOD:1,23-UNIMOD:21,471-UNIMOD:21,441-UNIMOD:21	0.17	58.0	25	5	2
PRT	tr|A2AW05|A2AW05_MOUSE	Isoform of Q08943, FACT complex subunit SSRP1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Ssrp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	null	444-UNIMOD:21	0.05	57.0	11	3	0
PRT	sp|Q9R0P4|SMAP_MOUSE	Small acidic protein OS=Mus musculus (Mouse) OX=10090 GN=Smap PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	56.0	null	17-UNIMOD:21,15-UNIMOD:21,25-UNIMOD:21	0.29	56.0	31	5	0
PRT	tr|Q923F1|Q923F1_MOUSE	Isoform of Q61189, Chloride channel, nucleotide-sensitive, 1A OS=Mus musculus (Mouse) OX=10090 GN=Clns1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	54.0	null	100-UNIMOD:21,95-UNIMOD:21	0.12	54.0	5	1	0
PRT	sp|C0HKD9|MFA1B_MOUSE	Microfibrillar-associated protein 1B OS=Mus musculus (Mouse) OX=10090 GN=Mfap1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	null	267-UNIMOD:21	0.06	54.0	4	1	0
PRT	sp|P60710|ACTB_MOUSE	Actin, cytoplasmic 1 OS=Mus musculus (Mouse) OX=10090 GN=Actb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	54.0	null	44-UNIMOD:35,47-UNIMOD:35,285-UNIMOD:4,285-UNIMOD:385	0.27	54.0	32	6	0
PRT	sp|O54879|HMGB3_MOUSE	High mobility group protein B3 OS=Mus musculus (Mouse) OX=10090 GN=Hmgb3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	53.0	null		0.12	53.0	5	1	0
PRT	sp|Q9DBD5|PELP1_MOUSE	Proline-, glutamic acid- and leucine-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pelp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	null	2-UNIMOD:1,13-UNIMOD:21	0.03	53.0	5	1	0
PRT	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	Isoform of Q6PFR5, RRM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Tra2a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null	200-UNIMOD:21,202-UNIMOD:21	0.13	51.0	8	2	0
PRT	sp|Q80XU3|NUCKS_MOUSE	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Mus musculus (Mouse) OX=10090 GN=Nucks1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	51.0	null	19-UNIMOD:21,181-UNIMOD:21	0.18	51.0	4	2	0
PRT	sp|Q9CW46|RAVR1_MOUSE	Ribonucleoprotein PTB-binding 1 OS=Mus musculus (Mouse) OX=10090 GN=Raver1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	51.0	null	2-UNIMOD:1,14-UNIMOD:21,626-UNIMOD:21,625-UNIMOD:35	0.06	51.0	11	2	0
PRT	sp|D3YXK2|SAFB1_MOUSE	Scaffold attachment factor B1 OS=Mus musculus (Mouse) OX=10090 GN=Safb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	48.0	null	264-UNIMOD:4,298-UNIMOD:21,2-UNIMOD:1,24-UNIMOD:21,626-UNIMOD:21,366-UNIMOD:21,12-UNIMOD:21,20-UNIMOD:21	0.12	48.0	10	5	2
PRT	tr|A0A0G2JDF8|A0A0G2JDF8_MOUSE	Isoform of Q99MR6, ARS2 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Srrt PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	null	185-UNIMOD:21	0.07	47.0	3	1	0
PRT	sp|Q64511|TOP2B_MOUSE	DNA topoisomerase 2-beta OS=Mus musculus (Mouse) OX=10090 GN=Top2b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	47.0	null	1568-UNIMOD:21,1363-UNIMOD:21,1453-UNIMOD:21,1400-UNIMOD:21,1562-UNIMOD:21,1600-UNIMOD:21,1390-UNIMOD:21,1448-UNIMOD:21	0.08	47.0	22	5	1
PRT	sp|P18760|COF1_MOUSE	Cofilin-1 OS=Mus musculus (Mouse) OX=10090 GN=Cfl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	2-UNIMOD:1,3-UNIMOD:21,18-UNIMOD:35,8-UNIMOD:21,3-UNIMOD:1	0.13	47.0	64	4	1
PRT	sp|P50580|PA2G4_MOUSE	Proliferation-associated protein 2G4 OS=Mus musculus (Mouse) OX=10090 GN=Pa2g4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	null	2-UNIMOD:1,2-UNIMOD:21,11-UNIMOD:21	0.06	47.0	16	2	0
PRT	sp|Q8VDM6-3|HNRL1-3_MOUSE	Isoform of Q8VDM6, Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpul1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	null	195-UNIMOD:21,219-UNIMOD:4	0.10	46.0	8	2	0
PRT	sp|P43275|H11_MOUSE	Histone H1.1 OS=Mus musculus (Mouse) OX=10090 GN=H1-1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	2-UNIMOD:1,2-UNIMOD:21	0.18	45.0	13	3	0
PRT	tr|F7BYZ4|F7BYZ4_MOUSE	Isoform of Q9JI11, Serine/threonine-protein kinase 4 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Stk4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	null	36-UNIMOD:21	0.15	44.0	3	2	0
PRT	sp|Q61136|PRP4B_MOUSE	Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus (Mouse) OX=10090 GN=Prpf4b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	833-UNIMOD:4,849-UNIMOD:21,852-UNIMOD:21	0.02	43.0	5	1	0
PRT	tr|A2BI12|A2BI12_MOUSE	Isoform of Q99JF8, PWWP domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Psip1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	null	176-UNIMOD:21	0.07	43.0	3	1	0
PRT	sp|P10853|H2B1F_MOUSE	Histone H2B type 1-F/J/L OS=Mus musculus (Mouse) OX=10090 GN=H2bc13 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0	null		0.21	43.0	13	2	0
PRT	sp|Q8CGP2|H2B1P_MOUSE	Histone H2B type 1-P OS=Mus musculus (Mouse) OX=10090 GN=Hist1h2bp PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.47	42.0	13	6	1
PRT	sp|C0HKE4|H2A1E_MOUSE	Histone H2A type 1-E OS=Mus musculus (Mouse) OX=10090 GN=H2ac8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.22	42.0	20	3	0
PRT	sp|Q8R344|CCD12_MOUSE	Coiled-coil domain-containing protein 12 OS=Mus musculus (Mouse) OX=10090 GN=Ccdc12 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	163-UNIMOD:4,165-UNIMOD:21	0.15	42.0	6	1	0
PRT	sp|P31324|KAP3_MOUSE	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Prkar2b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	112-UNIMOD:21,114-UNIMOD:4	0.06	42.0	7	2	0
PRT	tr|E9Q3V6|E9Q3V6_MOUSE	Isoform of P42208, Septin-type G domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Septin2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	null	178-UNIMOD:21	0.10	41.0	4	2	0
PRT	sp|P43277|H13_MOUSE	Histone H1.3 OS=Mus musculus (Mouse) OX=10090 GN=H1-3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,2-UNIMOD:21,37-UNIMOD:21	0.17	41.0	15	3	0
PRT	tr|F6RJ39|F6RJ39_MOUSE	Isoform of Q9JIX8, SAP domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Acin1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	null	425-UNIMOD:21,437-UNIMOD:21,937-UNIMOD:21,656-UNIMOD:21,771-UNIMOD:21	0.08	40.0	37	6	0
PRT	sp|Q64523|H2A2C_MOUSE	Histone H2A type 2-C OS=Mus musculus (Mouse) OX=10090 GN=Hist2h2ac PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null		0.15	40.0	5	1	0
PRT	sp|P26350|PTMA_MOUSE	Prothymosin alpha OS=Mus musculus (Mouse) OX=10090 GN=Ptma PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	null	2-UNIMOD:1,2-UNIMOD:21,8-UNIMOD:21	0.18	40.0	9	2	0
PRT	tr|E9PV44|E9PV44_MOUSE	Isoform of O35143, ATPase inhibitory factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Atpif1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.27	39.0	6	3	0
PRT	tr|A0A494BAZ2|A0A494BAZ2_MOUSE	Isoform of Q8K310, U1-type domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Matr3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	188-UNIMOD:21	0.06	39.0	3	1	0
PRT	sp|Q08024-4|PEBB-4_MOUSE	Isoform of Q08024, Isoform 4 of Core-binding factor subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Cbfb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	null	134-UNIMOD:21	0.14	39.0	3	1	0
PRT	sp|Q3UYC0-2|PPM1H-2_MOUSE	Isoform of Q3UYC0, Isoform 2 of Protein phosphatase 1H OS=Mus musculus (Mouse) OX=10090 GN=Ppm1h PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	210-UNIMOD:21	0.06	38.0	6	2	0
PRT	tr|A0A286YCG3|A0A286YCG3_MOUSE	Isoform of Q922D4, Serine/threonine-protein phosphatase 6 regulatory subunit 3 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Ppp6r3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	93-UNIMOD:21	0.13	38.0	2	2	2
PRT	tr|D3Z4F8|D3Z4F8_MOUSE	Isoform of Q60611, DNA-binding protein SATB1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Satb1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	47-UNIMOD:21,48-UNIMOD:21	0.32	38.0	3	2	1
PRT	sp|Q9ERU9|RBP2_MOUSE	E3 SUMO-protein ligase RanBP2 OS=Mus musculus (Mouse) OX=10090 GN=Ranbp2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	2505-UNIMOD:21	0.01	38.0	4	1	0
PRT	tr|A2AL12|A2AL12_MOUSE	Isoform of Q8BG05, Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	298-UNIMOD:21,295-UNIMOD:21	0.12	38.0	6	3	2
PRT	tr|F6YB25|F6YB25_MOUSE	Isoform of Q9CSU0, CID domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Rprd1b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	null	64-UNIMOD:21,66-UNIMOD:21	0.18	38.0	2	1	0
PRT	sp|P97310|MCM2_MOUSE	DNA replication licensing factor MCM2 OS=Mus musculus (Mouse) OX=10090 GN=Mcm2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	41-UNIMOD:21,139-UNIMOD:21,25-UNIMOD:21,26-UNIMOD:21,21-UNIMOD:21,31-UNIMOD:21,27-UNIMOD:21	0.09	38.0	29	8	1
PRT	sp|P43276|H15_MOUSE	Histone H1.5 OS=Mus musculus (Mouse) OX=10090 GN=H1-5 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	2-UNIMOD:1,2-UNIMOD:21,18-UNIMOD:21	0.17	38.0	8	3	2
PRT	sp|P28574-2|MAX-2_MOUSE	Isoform of P28574, Isoform 2 of Protein max OS=Mus musculus (Mouse) OX=10090 GN=Max PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	null	2-UNIMOD:1,2-UNIMOD:21,11-UNIMOD:21	0.16	38.0	11	1	0
PRT	sp|Q8K352|SASH3_MOUSE	SAM and SH3 domain-containing protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Sash3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	97-UNIMOD:21,116-UNIMOD:4,27-UNIMOD:21,103-UNIMOD:21	0.11	37.0	7	2	0
PRT	tr|D6RG95|D6RG95_MOUSE	Isoform of E9Q5K9, YTH domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ythdc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	419-UNIMOD:21,412-UNIMOD:21,321-UNIMOD:21	0.06	37.0	5	2	1
PRT	tr|A0A0R4J008|A0A0R4J008_MOUSE	Isoform of P70288, Histone deacetylase 2 OS=Mus musculus (Mouse) OX=10090 GN=Hdac2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	null	373-UNIMOD:35,394-UNIMOD:21	0.08	37.0	9	2	0
PRT	sp|O08582|GTPB1_MOUSE	GTP-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Gtpbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	6-UNIMOD:21,24-UNIMOD:21,8-UNIMOD:21	0.04	37.0	5	1	0
PRT	sp|P15864|H12_MOUSE	Histone H1.2 OS=Mus musculus (Mouse) OX=10090 GN=H1-2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null	36-UNIMOD:21	0.07	37.0	16	1	0
PRT	tr|D3Z2H9|D3Z2H9_MOUSE	Tropomyosin 3, related sequence 7 OS=Mus musculus (Mouse) OX=10090 GN=Tpm3-rs7 PE=3 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	null		0.06	37.0	5	1	0
PRT	sp|O35295|PURB_MOUSE	Transcriptional activator protein Pur-beta OS=Mus musculus (Mouse) OX=10090 GN=Purb PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1,6-UNIMOD:21	0.09	37.0	5	1	0
PRT	sp|P81069|GABP2_MOUSE	GA-binding protein subunit beta-2 OS=Mus musculus (Mouse) OX=10090 GN=Gabpb2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	218-UNIMOD:21,221-UNIMOD:21	0.07	36.0	3	1	0
PRT	tr|A2A8V8|A2A8V8_MOUSE	Isoform of Q52KI8, PWI domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Srrm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	878-UNIMOD:21,876-UNIMOD:21,220-UNIMOD:21,429-UNIMOD:21	0.05	36.0	10	4	1
PRT	sp|A2BH40-3|ARI1A-3_MOUSE	Isoform of A2BH40, Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Mus musculus (Mouse) OX=10090 GN=Arid1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	365-UNIMOD:21,1183-UNIMOD:21	0.02	36.0	4	2	1
PRT	sp|P53986|MOT1_MOUSE	Monocarboxylate transporter 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc16a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	null	213-UNIMOD:21	0.05	36.0	1	1	1
PRT	sp|Q3UGC7|EI3JA_MOUSE	Eukaryotic translation initiation factor 3 subunit J-A OS=Mus musculus (Mouse) OX=10090 GN=Eif3j1 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,14-UNIMOD:21	0.11	36.0	4	1	0
PRT	sp|P13864-2|DNMT1-2_MOUSE	Isoform of P13864, Isoform 2 of DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus (Mouse) OX=10090 GN=Dnmt1 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	576-UNIMOD:4,599-UNIMOD:21	0.02	35.0	3	1	0
PRT	tr|D3Z1Z8|D3Z1Z8_MOUSE	Isoform of P54227, Stathmin (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Stmn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	16-UNIMOD:21,25-UNIMOD:21	0.19	35.0	29	3	0
PRT	sp|Q8VDD5|MYH9_MOUSE	Myosin-9 OS=Mus musculus (Mouse) OX=10090 GN=Myh9 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.04	35.0	9	4	1
PRT	tr|B1AZ85|B1AZ85_MOUSE	Isoform of Q8R550, SH3 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Sh3kbp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	171-UNIMOD:21,140-UNIMOD:21,134-UNIMOD:21,124-UNIMOD:21	0.26	35.0	9	3	0
PRT	sp|P19973-2|LSP1-2_MOUSE	Isoform of P19973, Isoform 2 of Lymphocyte-specific protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lsp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	241-UNIMOD:21,247-UNIMOD:35,164-UNIMOD:21,166-UNIMOD:21,203-UNIMOD:21,201-UNIMOD:21	0.20	35.0	36	4	0
PRT	sp|Q80X82|SYMPK_MOUSE	Symplekin OS=Mus musculus (Mouse) OX=10090 GN=Sympk PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	494-UNIMOD:21	0.02	35.0	2	1	0
PRT	sp|Q810A7-2|DDX42-2_MOUSE	Isoform of Q810A7, Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Mus musculus (Mouse) OX=10090 GN=Ddx42 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	null	66-UNIMOD:21,50-UNIMOD:21	0.04	35.0	2	1	0
PRT	tr|Q3UXQ3|Q3UXQ3_MOUSE	Isoform of Q61286, BHLH domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Tcf12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	216-UNIMOD:21,219-UNIMOD:21	0.05	34.0	7	1	0
PRT	sp|P62259|1433E_MOUSE	14-3-3 protein epsilon OS=Mus musculus (Mouse) OX=10090 GN=Ywhae PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	235-UNIMOD:35	0.12	34.0	7	1	0
PRT	sp|P63101|1433Z_MOUSE	14-3-3 protein zeta/delta OS=Mus musculus (Mouse) OX=10090 GN=Ywhaz PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	6	1	0
PRT	sp|Q9CQS8|SC61B_MOUSE	Protein transport protein Sec61 subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Sec61b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	14-UNIMOD:21,13-UNIMOD:21	0.26	34.0	4	1	0
PRT	sp|P60335|PCBP1_MOUSE	Poly(rC)-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Pcbp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	163-UNIMOD:4,173-UNIMOD:21,161-UNIMOD:28,190-UNIMOD:21,194-UNIMOD:4,171-UNIMOD:21,189-UNIMOD:21,186-UNIMOD:35	0.12	34.0	13	2	0
PRT	tr|A0A0U1RQA1|A0A0U1RQA1_MOUSE	Isoform of P42209, Septin-type G domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Septin1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	213-UNIMOD:21,225-UNIMOD:4	0.07	34.0	3	2	1
PRT	sp|Q3UZA1-2|CPZIP-2_MOUSE	Isoform of Q3UZA1, Isoform 2 of CapZ-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=Rcsd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	null	186-UNIMOD:21	0.08	34.0	3	1	0
PRT	sp|Q03267-2|IKZF1-2_MOUSE	Isoform of Q03267, Isoform I of DNA-binding protein Ikaros OS=Mus musculus (Mouse) OX=10090 GN=Ikzf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	211-UNIMOD:21	0.09	33.0	5	2	0
PRT	sp|Q99J77|SIAS_MOUSE	Sialic acid synthase OS=Mus musculus (Mouse) OX=10090 GN=Nans PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	275-UNIMOD:21,283-UNIMOD:4,287-UNIMOD:4,277-UNIMOD:21	0.06	33.0	4	1	0
PRT	sp|Q3UPL0|SC31A_MOUSE	Protein transport protein Sec31A OS=Mus musculus (Mouse) OX=10090 GN=Sec31a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	526-UNIMOD:21,531-UNIMOD:21	0.03	33.0	2	1	0
PRT	tr|A0A087WRN1|A0A087WRN1_MOUSE	Isoform of Q8K019, Bcl-2-associated transcription factor 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Bclaf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	223-UNIMOD:21,108-UNIMOD:21,369-UNIMOD:21	0.08	33.0	29	7	2
PRT	tr|G3V012|G3V012_MOUSE	Isoform of Q6P542, ATP-binding cassette sub-family F member 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Abcf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	12-UNIMOD:21	0.51	33.0	6	2	1
PRT	sp|Q6P5G6|UBXN7_MOUSE	UBX domain-containing protein 7 OS=Mus musculus (Mouse) OX=10090 GN=Ubxn7 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	258-UNIMOD:21,266-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|P11157|RIR2_MOUSE	Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus (Mouse) OX=10090 GN=Rrm2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	null	20-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|Q569Z6|TR150_MOUSE	Thyroid hormone receptor-associated protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Thrap3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	null	248-UNIMOD:21,253-UNIMOD:21,679-UNIMOD:21,507-UNIMOD:21	0.05	33.0	22	5	0
PRT	sp|P26369|U2AF2_MOUSE	Splicing factor U2AF 65 kDa subunit OS=Mus musculus (Mouse) OX=10090 GN=U2af2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1,2-UNIMOD:21,79-UNIMOD:21	0.07	33.0	6	3	0
PRT	sp|Q8C079-2|STRP1-2_MOUSE	Isoform of Q8C079, Isoform 2 of Striatin-interacting protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Strip1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	335-UNIMOD:21	0.04	32.0	5	1	0
PRT	sp|Q9Z277-2|BAZ1B-2_MOUSE	Isoform of Q9Z277, Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Mus musculus (Mouse) OX=10090 GN=Baz1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	1166-UNIMOD:21	0.02	32.0	4	1	0
PRT	sp|P17095-1|HMGA1-1_MOUSE	Isoform of P17095, Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Mus musculus (Mouse) OX=10090 GN=Hmga1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	91-UNIMOD:21	0.21	32.0	5	1	0
PRT	sp|Q9DA19|CIR1_MOUSE	Corepressor interacting with RBPJ 1 OS=Mus musculus (Mouse) OX=10090 GN=Cir1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	202-UNIMOD:21,204-UNIMOD:4,191-UNIMOD:21	0.06	32.0	3	1	0
PRT	sp|Q9JL26-2|FMNL1-2_MOUSE	Isoform of Q9JL26, Isoform 2 of Formin-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fmnl1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	158-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q05D44|IF2P_MOUSE	Eukaryotic translation initiation factor 5B OS=Mus musculus (Mouse) OX=10090 GN=Eif5b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	null	215-UNIMOD:21	0.02	32.0	4	2	1
PRT	sp|Q8CIN4|PAK2_MOUSE	Serine/threonine-protein kinase PAK 2 OS=Mus musculus (Mouse) OX=10090 GN=Pak2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	141-UNIMOD:21,143-UNIMOD:21	0.05	32.0	5	2	1
PRT	sp|P43274|H14_MOUSE	Histone H1.4 OS=Mus musculus (Mouse) OX=10090 GN=H1-4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	36-UNIMOD:21,2-UNIMOD:1,2-UNIMOD:21,35-UNIMOD:21	0.35	31.0	36	8	0
PRT	tr|A0A0A6YVU1|A0A0A6YVU1_MOUSE	Isoform of Q9JKX6, ADP-sugar pyrophosphatase (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Nudt5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	7-UNIMOD:21	0.26	31.0	2	1	0
PRT	sp|Q8R574|KPRB_MOUSE	Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Prpsap2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	227-UNIMOD:21	0.08	31.0	3	1	0
PRT	sp|P68373|TBA1C_MOUSE	Tubulin alpha-1C chain OS=Mus musculus (Mouse) OX=10090 GN=Tuba1c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.08	31.0	4	2	0
PRT	tr|F6ZN61|F6ZN61_MOUSE	Isoform of Q61210, Rho guanine nucleotide exchange factor 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Arhgef1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	111-UNIMOD:21,113-UNIMOD:21	0.04	31.0	5	2	0
PRT	tr|D3YWA4|D3YWA4_MOUSE	Isoform of Q6P8I4, PEST proteolytic signal-containing nuclear protein OS=Mus musculus (Mouse) OX=10090 GN=Pcnp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:21,52-UNIMOD:21	0.23	31.0	4	1	0
PRT	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	Isoform of Q9CW46, Predicted gene, 38431 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Gm38431 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	366-UNIMOD:21	0.03	30.0	13	1	0
PRT	tr|D3Z491|D3Z491_MOUSE	Isoform of Q9DBC3, Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Cmtr1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	27-UNIMOD:21	0.20	30.0	3	1	0
PRT	tr|G3UWD2|G3UWD2_MOUSE	Isoform of Q03347, Runt-related transcription factor OS=Mus musculus (Mouse) OX=10090 GN=Runx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	14-UNIMOD:21,21-UNIMOD:21,17-UNIMOD:21,212-UNIMOD:21,207-UNIMOD:21	0.11	30.0	8	2	0
PRT	sp|E9PVX6-2|KI67-2_MOUSE	Isoform of E9PVX6, Isoform 2 of Proliferation marker protein Ki-67 OS=Mus musculus (Mouse) OX=10090 GN=Mki67 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	337-UNIMOD:21,2739-UNIMOD:21	0.01	30.0	5	3	1
PRT	tr|A0A571BDM4|A0A571BDM4_MOUSE	Isoform of Q3UHJ0, AP2-associated protein kinase 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Aak1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	99-UNIMOD:21	0.08	30.0	5	2	0
PRT	sp|Q3UYV9|NCBP1_MOUSE	Nuclear cap-binding protein subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Ncbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	21-UNIMOD:21,36-UNIMOD:4,22-UNIMOD:21	0.03	30.0	5	2	1
PRT	tr|A0A1W2P750|A0A1W2P750_MOUSE	Isoform of Q9DBR7, PRKG1_interact domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Ppp1r12a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	171-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q8BTI8|SRRM2_MOUSE	Serine/arginine repetitive matrix protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Srrm2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	1097-UNIMOD:21,1036-UNIMOD:21,2404-UNIMOD:21,2535-UNIMOD:21,1037-UNIMOD:21,1151-UNIMOD:21,2082-UNIMOD:4,2084-UNIMOD:21,2386-UNIMOD:35,295-UNIMOD:21,322-UNIMOD:21,300-UNIMOD:21,323-UNIMOD:21,1048-UNIMOD:21,1360-UNIMOD:21,2350-UNIMOD:21,2341-UNIMOD:21	0.08	30.0	45	11	0
PRT	tr|A2APD7|A2APD7_MOUSE	Isoform of Q9D6Z1, Nop domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Nop56 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	252-UNIMOD:21,229-UNIMOD:21	0.15	30.0	4	2	0
PRT	sp|Q9D4J7-2|PHF6-2_MOUSE	Isoform of Q9D4J7, Isoform 2 of PHD finger protein 6 OS=Mus musculus (Mouse) OX=10090 GN=Phf6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	74-UNIMOD:21	0.10	30.0	3	1	0
PRT	tr|A0A2I3BPX9|A0A2I3BPX9_MOUSE	Isoform of Q60775, ETS domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Elf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null	150-UNIMOD:21,296-UNIMOD:21	0.07	30.0	4	2	0
PRT	sp|P20152|VIME_MOUSE	Vimentin OS=Mus musculus (Mouse) OX=10090 GN=Vim PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	13	2	0
PRT	sp|P30987|TA2R_MOUSE	Thromboxane A2 receptor OS=Mus musculus (Mouse) OX=10090 GN=Tbxa2r PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	328-UNIMOD:21	0.07	29.0	3	1	0
PRT	sp|O35381|AN32A_MOUSE	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Mus musculus (Mouse) OX=10090 GN=Anp32a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	15-UNIMOD:21,27-UNIMOD:4	0.11	29.0	6	2	1
PRT	sp|Q8BGU5-2|CCNY-2_MOUSE	Isoform of Q8BGU5, Isoform 2 of Cyclin-Y OS=Mus musculus (Mouse) OX=10090 GN=Ccny PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	null	301-UNIMOD:21,299-UNIMOD:21	0.04	29.0	6	2	0
PRT	sp|P54227|STMN1_MOUSE	Stathmin OS=Mus musculus (Mouse) OX=10090 GN=Stmn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	null	25-UNIMOD:21,16-UNIMOD:21	0.13	29.0	9	2	0
PRT	sp|P43346|DCK_MOUSE	Deoxycytidine kinase OS=Mus musculus (Mouse) OX=10090 GN=Dck PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,9-UNIMOD:4,11-UNIMOD:21,3-UNIMOD:21	0.08	29.0	7	1	0
PRT	tr|S4R1W1|S4R1W1_MOUSE	Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus (Mouse) OX=10090 GN=Gm3839 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.14	28.0	9	3	0
PRT	sp|O35892|SP100_MOUSE	Nuclear autoantigen Sp-100 OS=Mus musculus (Mouse) OX=10090 GN=Sp100 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	314-UNIMOD:21,313-UNIMOD:21,338-UNIMOD:21	0.05	28.0	11	3	1
PRT	sp|Q9R190|MTA2_MOUSE	Metastasis-associated protein MTA2 OS=Mus musculus (Mouse) OX=10090 GN=Mta2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	435-UNIMOD:21	0.03	28.0	1	1	1
PRT	tr|Z4YJT3|Z4YJT3_MOUSE	Isoform of Q6ZQ58, HTH La-type RNA-binding domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Larp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	523-UNIMOD:21	0.02	28.0	2	1	0
PRT	tr|A0A286YDA2|A0A286YDA2_MOUSE	Isoform of E9Q5C9, LisH domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Nolc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	699-UNIMOD:21	0.03	28.0	4	2	1
PRT	tr|Q8QZW8|Q8QZW8_MOUSE	Isoform of Q1HDU4, Rho GTPase-activating protein 9 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	197-UNIMOD:21	0.06	28.0	1	1	0
PRT	sp|Q9DBT5|AMPD2_MOUSE	AMP deaminase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ampd2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	28.0	null	87-UNIMOD:21,85-UNIMOD:28	0.02	28.0	6	1	0
PRT	sp|Q62018-3|CTR9-3_MOUSE	Isoform of Q62018, Isoform 3 of RNA polymerase-associated protein CTR9 homolog OS=Mus musculus (Mouse) OX=10090 GN=Ctr9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	880-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q80TY0-5|FNBP1-5_MOUSE	Isoform of Q80TY0, Isoform 5 of Formin-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fnbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	null	296-UNIMOD:21	0.06	28.0	3	1	0
PRT	sp|Q99L45|IF2B_MOUSE	Eukaryotic translation initiation factor 2 subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Eif2s2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1,2-UNIMOD:21,12-UNIMOD:35	0.05	28.0	9	2	0
PRT	sp|Q61103|REQU_MOUSE	Zinc finger protein ubi-d4 OS=Mus musculus (Mouse) OX=10090 GN=Dpf2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	null	142-UNIMOD:21	0.06	28.0	2	1	0
PRT	tr|F2Z3Z9|F2Z3Z9_MOUSE	Isoform of Q9Z2A0, Protein kinase domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Pdpk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	117-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|Q3UL36-2|ARGL1-2_MOUSE	Isoform of Q3UL36, Isoform 2 of Arginine and glutamate-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Arglu1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	57-UNIMOD:21,56-UNIMOD:21	0.08	27.0	11	2	0
PRT	sp|Q99020|ROAA_MOUSE	Heterogeneous nuclear ribonucleoprotein A/B OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpab PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	3	2	1
PRT	tr|Q8BZN7|Q8BZN7_MOUSE	Isoform of Q569Z6, Thyroid hormone receptor-associated protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Thrap3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	572-UNIMOD:21,679-UNIMOD:21,507-UNIMOD:21	0.10	27.0	34	7	1
PRT	tr|F8WIP7|F8WIP7_MOUSE	Isoform of Q61103, C2H2-type domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Dpf2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	98-UNIMOD:21	0.10	27.0	2	1	0
PRT	sp|Q9CW03|SMC3_MOUSE	Structural maintenance of chromosomes protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Smc3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	1067-UNIMOD:21,1065-UNIMOD:21,1083-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|Q8C3J5|DOCK2_MOUSE	Dedicator of cytokinesis protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Dock2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	1729-UNIMOD:21	0.01	27.0	3	1	0
PRT	tr|A0A0G2JGN6|A0A0G2JGN6_MOUSE	Isoform of Q9CR00, PDZ domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Psmd9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	82-UNIMOD:21	0.09	27.0	3	2	1
PRT	sp|Q9Z1Z0-2|USO1-2_MOUSE	Isoform of Q9Z1Z0, Isoform 2 of General vesicular transport factor p115 OS=Mus musculus (Mouse) OX=10090 GN=Uso1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	878-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q9D892|ITPA_MOUSE	Inosine triphosphate pyrophosphatase OS=Mus musculus (Mouse) OX=10090 GN=Itpa PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.10	27.0	6	2	0
PRT	tr|Q3TE40|Q3TE40_MOUSE	Isoform of Q62193, RPA_C domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Rpa2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	250-UNIMOD:4	0.10	27.0	1	1	0
PRT	sp|Q8C708|CP054_MOUSE	Transmembrane protein C16orf54 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:2141979 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	195-UNIMOD:21	0.06	27.0	2	1	0
PRT	sp|Q99PV8-2|BC11B-2_MOUSE	Isoform of Q99PV8, Isoform 2 of B-cell lymphoma/leukemia 11B OS=Mus musculus (Mouse) OX=10090 GN=Bcl11b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	128-UNIMOD:21,134-UNIMOD:4,344-UNIMOD:21,309-UNIMOD:21	0.10	27.0	6	3	0
PRT	tr|A2AI69|A2AI69_MOUSE	Isoform of Q9DBC7, Cyclic nucleotide-binding domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Prkar1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	83-UNIMOD:21	0.13	27.0	21	2	0
PRT	sp|Q6GYP7-4|RGPA1-4_MOUSE	Isoform of Q6GYP7, Isoform 5 of Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus (Mouse) OX=10090 GN=Ralgapa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	null	772-UNIMOD:21,774-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|O54957|LAT_MOUSE	Linker for activation of T-cells family member 1 OS=Mus musculus (Mouse) OX=10090 GN=Lat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	30-UNIMOD:4,41-UNIMOD:21,42-UNIMOD:21,215-UNIMOD:21	0.23	27.0	3	2	1
PRT	sp|Q56A08|GPKOW_MOUSE	G-patch domain and KOW motifs-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gpkow PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,6-UNIMOD:21	0.05	27.0	3	1	0
PRT	sp|Q60787|LCP2_MOUSE	Lymphocyte cytosolic protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Lcp2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null	410-UNIMOD:21	0.08	27.0	4	1	0
PRT	sp|C0HKE1|H2A1B_MOUSE	Histone H2A type 1-B OS=Mus musculus (Mouse) OX=10090 GN=H2ac4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.15	27.0	3	1	0
PRT	sp|Q61189|ICLN_MOUSE	Methylosome subunit pICln OS=Mus musculus (Mouse) OX=10090 GN=Clns1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	null		0.14	27.0	1	1	1
PRT	tr|A0A1B0GRU3|A0A1B0GRU3_MOUSE	Isoform of Q6ZPZ3, Zinc finger CCCH domain-containing protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Zc3h4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	975-UNIMOD:4,987-UNIMOD:21	0.03	26.0	2	1	0
PRT	tr|F2Z471|F2Z471_MOUSE	Isoform of Q60932, Voltage-dependent anion-selective channel protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Vdac1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	104-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|O89100|GRAP2_MOUSE	GRB2-related adaptor protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Grap2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	254-UNIMOD:21,186-UNIMOD:21,230-UNIMOD:21,238-UNIMOD:4	0.23	26.0	9	3	0
PRT	tr|Q91V89|Q91V89_MOUSE	Isoform of Q7TNL5, Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Ppp2r5d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	565-UNIMOD:21	0.02	26.0	4	1	0
PRT	sp|P26645|MARCS_MOUSE	Myristoylated alanine-rich C-kinase substrate OS=Mus musculus (Mouse) OX=10090 GN=Marcks PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	163-UNIMOD:21,156-UNIMOD:21	0.06	26.0	7	3	1
PRT	tr|Q3TS02|Q3TS02_MOUSE	Isoform of Q91V92, Citrate_bind domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Acly PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	455-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|P35486|ODPA_MOUSE	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Pdha1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	null	293-UNIMOD:21,300-UNIMOD:21	0.06	26.0	5	2	0
PRT	sp|P19973|LSP1_MOUSE	Lymphocyte-specific protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Lsp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	166-UNIMOD:21,168-UNIMOD:21,243-UNIMOD:21,249-UNIMOD:35,205-UNIMOD:21,241-UNIMOD:28	0.20	26.0	20	5	0
PRT	sp|Q3V3V9|CARL2_MOUSE	Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Carmil2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	1134-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q3UDE2|TTL12_MOUSE	Tubulin--tyrosine ligase-like protein 12 OS=Mus musculus (Mouse) OX=10090 GN=Ttll12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	1-UNIMOD:1,11-UNIMOD:21,1-UNIMOD:35	0.03	26.0	11	2	0
PRT	sp|Q01320|TOP2A_MOUSE	DNA topoisomerase 2-alpha OS=Mus musculus (Mouse) OX=10090 GN=Top2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	1105-UNIMOD:21,1521-UNIMOD:21	0.04	26.0	5	2	1
PRT	sp|Q9Z1Z0|USO1_MOUSE	General vesicular transport factor p115 OS=Mus musculus (Mouse) OX=10090 GN=Uso1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	940-UNIMOD:21	0.04	26.0	1	1	0
PRT	sp|O09106|HDAC1_MOUSE	Histone deacetylase 1 OS=Mus musculus (Mouse) OX=10090 GN=Hdac1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	null	372-UNIMOD:35,393-UNIMOD:21	0.07	26.0	7	1	0
PRT	sp|Q9Z1M4|KS6B2_MOUSE	Ribosomal protein S6 kinase beta-2 OS=Mus musculus (Mouse) OX=10090 GN=Rps6kb2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,24-UNIMOD:21,29-UNIMOD:4	0.07	26.0	1	1	1
PRT	tr|A0A494BB21|A0A494BB21_MOUSE	Isoform of Q64697, Protein tyrosine phosphatase receptor type C-associated protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Ptprcap PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	104-UNIMOD:21,100-UNIMOD:21	0.31	25.0	2	1	0
PRT	sp|Q8VBT9-3|ASPC1-3_MOUSE	Isoform of Q8VBT9, Isoform 3 of Tether containing UBX domain for GLUT4 OS=Mus musculus (Mouse) OX=10090 GN=Aspscr1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	396-UNIMOD:21	0.10	25.0	2	1	0
PRT	sp|D0QMC3|MNDAL_MOUSE	Myeloid cell nuclear differentiation antigen-like protein OS=Mus musculus (Mouse) OX=10090 GN=Mndal PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	274-UNIMOD:4,276-UNIMOD:21	0.06	25.0	3	1	0
PRT	sp|Q9CQV8-2|1433B-2_MOUSE	Isoform of Q9CQV8, Isoform Short of 14-3-3 protein beta/alpha OS=Mus musculus (Mouse) OX=10090 GN=Ywhab PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	2	1	0
PRT	sp|O54824-2|IL16-2_MOUSE	Isoform of O54824, Isoform 2 of Pro-interleukin-16 OS=Mus musculus (Mouse) OX=10090 GN=Il16 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	141-UNIMOD:21,232-UNIMOD:21	0.05	25.0	5	2	0
PRT	sp|Q8BUM3|PTN7_MOUSE	Tyrosine-protein phosphatase non-receptor type 7 OS=Mus musculus (Mouse) OX=10090 GN=Ptpn7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	44-UNIMOD:21,62-UNIMOD:4,45-UNIMOD:21	0.08	25.0	4	1	0
PRT	sp|P62806|H4_MOUSE	Histone H4 OS=Mus musculus (Mouse) OX=10090 GN=H4f16 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	48-UNIMOD:21	0.43	25.0	15	5	0
PRT	sp|Q99LI7|CSTF3_MOUSE	Cleavage stimulation factor subunit 3 OS=Mus musculus (Mouse) OX=10090 GN=Cstf3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	691-UNIMOD:21	0.03	25.0	3	1	0
PRT	tr|Q9D3Q7|Q9D3Q7_MOUSE	Isoform of Q8VDI1, Epithelial-stromal interaction protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Epsti1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	39-UNIMOD:21	0.08	25.0	2	1	0
PRT	sp|O88271|CFDP1_MOUSE	Craniofacial development protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Cfdp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	246-UNIMOD:21	0.08	25.0	2	1	0
PRT	sp|P70429-2|EVL-2_MOUSE	Isoform of P70429, Isoform 1 of Ena/VASP-like protein OS=Mus musculus (Mouse) OX=10090 GN=Evl PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	329-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q9CT10|RANB3_MOUSE	Ran-binding protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Ranbp3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	58-UNIMOD:21,56-UNIMOD:21,60-UNIMOD:21	0.04	25.0	5	2	0
PRT	tr|A0A1L1STP6|A0A1L1STP6_MOUSE	Isoform of O35492, Dual-specificity protein kinase CLK3 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Clk3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	null	33-UNIMOD:21	0.16	25.0	3	1	0
PRT	tr|A0A087WR05|A0A087WR05_MOUSE	Isoform of Q03347, Runt-related transcription factor 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Runx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	40-UNIMOD:21	0.49	25.0	2	1	0
PRT	sp|O54824|IL16_MOUSE	Pro-interleukin-16 OS=Mus musculus (Mouse) OX=10090 GN=Il16 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	null	967-UNIMOD:21,968-UNIMOD:4	0.01	25.0	4	1	0
PRT	tr|A0A1L1SST0|A0A1L1SST0_MOUSE	Isoform of P17742, Peptidyl-prolyl cis-trans isomerase OS=Mus musculus (Mouse) OX=10090 GN=Ppia PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	153-UNIMOD:4	0.38	24.0	5	4	3
PRT	sp|Q9CQV4|RETR3_MOUSE	Reticulophagy regulator 3 OS=Mus musculus (Mouse) OX=10090 GN=Retreg3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	26-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P25206|MCM3_MOUSE	DNA replication licensing factor MCM3 OS=Mus musculus (Mouse) OX=10090 GN=Mcm3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	672-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q8C3R1|BRAT1_MOUSE	BRCA1-associated ATM activator 1 OS=Mus musculus (Mouse) OX=10090 GN=Brat1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	685-UNIMOD:21,697-UNIMOD:4	0.02	24.0	3	1	0
PRT	sp|Q78ZA7|NP1L4_MOUSE	Nucleosome assembly protein 1-like 4 OS=Mus musculus (Mouse) OX=10090 GN=Nap1l4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	125-UNIMOD:21,117-UNIMOD:21,121-UNIMOD:21	0.09	24.0	3	2	1
PRT	sp|Q8BLB7-2|LMBL3-2_MOUSE	Isoform of Q8BLB7, Isoform 2 of Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=L3mbtl3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	580-UNIMOD:21,579-UNIMOD:21,576-UNIMOD:21	0.02	24.0	3	1	0
PRT	sp|Q91WK2|EIF3H_MOUSE	Eukaryotic translation initiation factor 3 subunit H OS=Mus musculus (Mouse) OX=10090 GN=Eif3h PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	3	1	0
PRT	sp|Q5SVQ0-4|KAT7-4_MOUSE	Isoform of Q5SVQ0, Isoform 4 of Histone acetyltransferase KAT7 OS=Mus musculus (Mouse) OX=10090 GN=Kat7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	53-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|P26040|EZRI_MOUSE	Ezrin OS=Mus musculus (Mouse) OX=10090 GN=Ezr PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	4	1	0
PRT	sp|O89110|CASP8_MOUSE	Caspase-8 OS=Mus musculus (Mouse) OX=10090 GN=Casp8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	188-UNIMOD:21	0.05	24.0	2	1	0
PRT	tr|A2AP93|A2AP93_MOUSE	Isoform of Q62073, Protein kinase domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Map3k7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	412-UNIMOD:21	0.04	24.0	3	1	0
PRT	tr|E9PXB7|E9PXB7_MOUSE	Isoform of Q8CFI0, E3 ubiquitin-protein ligase OS=Mus musculus (Mouse) OX=10090 GN=Nedd4l PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	308-UNIMOD:21	0.03	24.0	3	1	0
PRT	tr|M0QW74|M0QW74_MOUSE	Isoform of Q8K296, Myotubularin-related protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Mtmr3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	611-UNIMOD:21,621-UNIMOD:4	0.02	24.0	1	1	0
PRT	sp|Q8C147-2|DOCK8-2_MOUSE	Isoform of Q8C147, Isoform 2 of Dedicator of cytokinesis protein 8 OS=Mus musculus (Mouse) OX=10090 GN=Dock8 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	null	538-UNIMOD:21,548-UNIMOD:4,537-UNIMOD:21	0.04	24.0	3	1	0
PRT	sp|Q3TBD2|HMHA1_MOUSE	Rho GTPase-activating protein 45 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap45 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	23-UNIMOD:21,568-UNIMOD:21,577-UNIMOD:21,571-UNIMOD:35	0.09	24.0	12	3	0
PRT	sp|Q61687|ATRX_MOUSE	Transcriptional regulator ATRX OS=Mus musculus (Mouse) OX=10090 GN=Atrx PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	92-UNIMOD:21,619-UNIMOD:4,626-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|Q9R0P5|DEST_MOUSE	Destrin OS=Mus musculus (Mouse) OX=10090 GN=Dstn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,3-UNIMOD:21,12-UNIMOD:4	0.12	24.0	2	2	2
PRT	sp|Q6P542|ABCF1_MOUSE	ATP-binding cassette sub-family F member 1 OS=Mus musculus (Mouse) OX=10090 GN=Abcf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	107-UNIMOD:21,103-UNIMOD:21	0.03	24.0	4	1	0
PRT	sp|Q8K039|K1143_MOUSE	Uncharacterized protein KIAA1143 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1913452 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	50-UNIMOD:21	0.18	24.0	2	1	0
PRT	sp|Q6NZF1|ZC11A_MOUSE	Zinc finger CCCH domain-containing protein 11A OS=Mus musculus (Mouse) OX=10090 GN=Zc3h11a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	null	289-UNIMOD:21	0.02	24.0	4	1	0
PRT	sp|P42669|PURA_MOUSE	Transcriptional activator protein Pur-alpha OS=Mus musculus (Mouse) OX=10090 GN=Pura PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	291-UNIMOD:4	0.11	23.0	2	1	0
PRT	sp|Q8CH02|SUGP1_MOUSE	SURP and G-patch domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Sugp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	483-UNIMOD:21	0.04	23.0	1	1	1
PRT	tr|B7FAV1|B7FAV1_MOUSE	Isoform of Q8BTM8, Filamin, alpha OS=Mus musculus (Mouse) OX=10090 GN=Flna PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1429-UNIMOD:4,1435-UNIMOD:21	0.01	23.0	3	1	0
PRT	sp|Q8K3W3|CASC3_MOUSE	Protein CASC3 OS=Mus musculus (Mouse) OX=10090 GN=Casc3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	263-UNIMOD:21	0.02	23.0	3	1	0
PRT	tr|E9Q7Q3|E9Q7Q3_MOUSE	Isoform of P21107, Tropomyosin alpha-3 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.14	23.0	3	2	1
PRT	sp|O54825|BYST_MOUSE	Bystin OS=Mus musculus (Mouse) OX=10090 GN=Bysl PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	97-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P68404-2|KPCB-2_MOUSE	Isoform of P68404, Isoform Beta-II of Protein kinase C beta type OS=Mus musculus (Mouse) OX=10090 GN=Prkcb PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	660-UNIMOD:21,641-UNIMOD:21	0.07	23.0	4	2	1
PRT	sp|P09838|TDT_MOUSE	DNA nucleotidylexotransferase OS=Mus musculus (Mouse) OX=10090 GN=Dntt PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	134-UNIMOD:21,132-UNIMOD:21,131-UNIMOD:21	0.05	23.0	19	4	0
PRT	tr|A2AJT3|A2AJT3_MOUSE	Isoform of A2AJT4, Arginine/serine-rich protein PNISR OS=Mus musculus (Mouse) OX=10090 GN=Pnisr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	211-UNIMOD:21	0.06	23.0	1	1	1
PRT	tr|F6ZZB1|F6ZZB1_MOUSE	Isoform of Q6ZQA0, Neurobeachin-like protein 2 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Nbeal2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null	1058-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q9CZ13|QCR1_MOUSE	Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Uqcrc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q9D8C4|IN35_MOUSE	Interferon-induced 35 kDa protein homolog OS=Mus musculus (Mouse) OX=10090 GN=Ifi35 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	34-UNIMOD:21	0.09	23.0	4	2	1
PRT	tr|F8WI35|F8WI35_MOUSE	Isoform of P84244, Histone H3 OS=Mus musculus (Mouse) OX=10090 GN=H3f3a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.29	23.0	9	4	0
PRT	sp|Q8BG05-2|ROA3-2_MOUSE	Isoform of Q8BG05, Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	null	1-UNIMOD:1	0.04	23.0	2	1	0
PRT	sp|Q2NL51|GSK3A_MOUSE	Glycogen synthase kinase-3 alpha OS=Mus musculus (Mouse) OX=10090 GN=Gsk3a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	279-UNIMOD:21,281-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q9CY58|PAIRB_MOUSE	Plasminogen activator inhibitor 1 RNA-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Serbp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null	329-UNIMOD:21	0.05	23.0	3	1	0
PRT	sp|P01942|HBA_MOUSE	Hemoglobin subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Hba PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	2	1	0
PRT	tr|D3Z710|D3Z710_MOUSE	Isoform of Q91W40, TPR_REGION domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Klc3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	467-UNIMOD:21,498-UNIMOD:21	0.05	22.0	2	2	2
PRT	tr|D6RGB4|D6RGB4_MOUSE	Isoform of Q8CB62, Centrobin OS=Mus musculus (Mouse) OX=10090 GN=Cntrob PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:21	0.17	22.0	1	1	1
PRT	tr|A0A087WQ92|A0A087WQ92_MOUSE	Isoform of Q6NZM9, Hist_deacetyl domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Hdac4 PE=1 SV=6	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:21	0.07	22.0	2	1	0
PRT	tr|F7BTZ2|F7BTZ2_MOUSE	Isoform of Q60953, Protein PML (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Pml PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	474-UNIMOD:21	0.04	22.0	1	1	0
PRT	tr|A0A0U1RQ02|A0A0U1RQ02_MOUSE	Isoform of O54957, Linker for activation of T-cells family member 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Lat PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	30-UNIMOD:4,40-UNIMOD:21	0.19	22.0	1	1	0
PRT	sp|P97315|CSRP1_MOUSE	Cysteine and glycine-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Csrp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	192-UNIMOD:21	0.08	22.0	2	1	0
PRT	sp|Q61033-2|LAP2A-2_MOUSE	Isoform of Q61033, Isoform Zeta of Lamina-associated polypeptide 2, isoforms alpha/zeta OS=Mus musculus (Mouse) OX=10090 GN=Tmpo PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:21,157-UNIMOD:21,158-UNIMOD:21,74-UNIMOD:21	0.23	22.0	4	2	0
PRT	sp|Q8VE65|TAF12_MOUSE	Transcription initiation factor TFIID subunit 12 OS=Mus musculus (Mouse) OX=10090 GN=Taf12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	46-UNIMOD:21,51-UNIMOD:21	0.14	22.0	3	1	0
PRT	tr|H3BKQ0|H3BKQ0_MOUSE	Isoform of Q8K4I3, PH domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Arhgef6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	237-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|P68372|TBB4B_MOUSE	Tubulin beta-4B chain OS=Mus musculus (Mouse) OX=10090 GN=Tubb4b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	12-UNIMOD:4,321-UNIMOD:35	0.08	22.0	3	2	1
PRT	tr|D6RIL0|D6RIL0_MOUSE	Isoform of Q8BSQ9, Protein polybromo-1 OS=Mus musculus (Mouse) OX=10090 GN=Pbrm1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	9-UNIMOD:21	0.03	22.0	2	2	1
PRT	sp|Q9WV60|GSK3B_MOUSE	Glycogen synthase kinase-3 beta OS=Mus musculus (Mouse) OX=10090 GN=Gsk3b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	7-UNIMOD:21,14-UNIMOD:4,9-UNIMOD:21	0.05	22.0	3	1	0
PRT	tr|D6RHA7|D6RHA7_MOUSE	Isoform of Q9QXG4, ACAS_N domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Acss2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	null	30-UNIMOD:21	0.10	22.0	3	1	0
PRT	sp|E9Q5K9|YTDC1_MOUSE	YTH domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ythdc1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	425-UNIMOD:21	0.03	22.0	4	1	0
PRT	sp|Q3UYC0|PPM1H_MOUSE	Protein phosphatase 1H OS=Mus musculus (Mouse) OX=10090 GN=Ppm1h PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	210-UNIMOD:21	0.05	22.0	3	2	0
PRT	sp|Q3TKT4|SMCA4_MOUSE	Transcription activator BRG1 OS=Mus musculus (Mouse) OX=10090 GN=Smarca4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	695-UNIMOD:21	0.01	22.0	3	1	0
PRT	sp|Q9D0J8|PTMS_MOUSE	Parathymosin OS=Mus musculus (Mouse) OX=10090 GN=Ptms PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	null		0.46	22.0	7	1	0
PRT	sp|Q8BJ37|TYDP1_MOUSE	Tyrosyl-DNA phosphodiesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tdp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	22.0	null	59-UNIMOD:28,61-UNIMOD:21	0.03	22.0	3	1	0
PRT	sp|Q923E4|SIR1_MOUSE	NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus (Mouse) OX=10090 GN=Sirt1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	null	51-UNIMOD:21,61-UNIMOD:4	0.05	22.0	1	1	0
PRT	sp|Q7TT28|REXO1_MOUSE	RNA exonuclease 1 homolog OS=Mus musculus (Mouse) OX=10090 GN=Rexo1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	514-UNIMOD:21	0.02	22.0	2	1	0
PRT	tr|S4R1F6|S4R1F6_MOUSE	Isoform of Q9WV02, RNA-binding motif protein, X chromosome OS=Mus musculus (Mouse) OX=10090 GN=Rbmx PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	80-UNIMOD:21	0.08	21.0	2	1	0
PRT	tr|A2AGJ9|A2AGJ9_MOUSE	Isoform of Q924N4, Solute carrier family 12 member 6 OS=Mus musculus (Mouse) OX=10090 GN=Slc12a6 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	31-UNIMOD:21	0.03	21.0	1	1	0
PRT	sp|Q61233|PLSL_MOUSE	Plastin-2 OS=Mus musculus (Mouse) OX=10090 GN=Lcp1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,5-UNIMOD:21	0.05	21.0	2	2	2
PRT	tr|A0A571BEU1|A0A571BEU1_MOUSE	Isoform of Q6IRU2, Tropomyosin alpha-4 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	0
PRT	sp|Q8CHI8-5|EP400-5_MOUSE	Isoform of Q8CHI8, Isoform 5 of E1A-binding protein p400 OS=Mus musculus (Mouse) OX=10090 GN=Ep400 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	922-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P14733|LMNB1_MOUSE	Lamin-B1 OS=Mus musculus (Mouse) OX=10090 GN=Lmnb1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	392-UNIMOD:21,394-UNIMOD:21	0.09	21.0	7	3	2
PRT	sp|O55022|PGRC1_MOUSE	Membrane-associated progesterone receptor component 1 OS=Mus musculus (Mouse) OX=10090 GN=Pgrmc1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	181-UNIMOD:21	0.12	21.0	1	1	1
PRT	tr|A2A6U3|A2A6U3_MOUSE	Isoform of Q80UG5, Septin-type G domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Septin9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	67-UNIMOD:21,64-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|P63038|CH60_MOUSE	60 kDa heat shock protein, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Hspd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q76N33-2|STALP-2_MOUSE	Isoform of Q76N33, Isoform 2 of AMSH-like protease OS=Mus musculus (Mouse) OX=10090 GN=Stambpl1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	76-UNIMOD:21	0.09	21.0	1	1	0
PRT	sp|O88569-3|ROA2-3_MOUSE	Isoform of O88569, Isoform 3 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpa2b1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.14	21.0	5	2	0
PRT	tr|S4R1M0|S4R1M0_MOUSE	Isoform of P06800, Receptor-type tyrosine-protein phosphatase C OS=Mus musculus (Mouse) OX=10090 GN=Ptprc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	801-UNIMOD:21	0.01	21.0	4	1	0
PRT	tr|G3UYK8|G3UYK8_MOUSE	Isoform of O89053, Coronin OS=Mus musculus (Mouse) OX=10090 GN=Coro1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	332-UNIMOD:4,345-UNIMOD:4	0.06	21.0	2	2	2
PRT	sp|E9Q394-2|AKP13-2_MOUSE	Isoform of E9Q394, Isoform 2 of A-kinase anchor protein 13 OS=Mus musculus (Mouse) OX=10090 GN=Akap13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	1528-UNIMOD:21,2505-UNIMOD:21	0.01	21.0	3	2	0
PRT	sp|Q9EQN3|T22D4_MOUSE	TSC22 domain family protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Tsc22d4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	165-UNIMOD:21,167-UNIMOD:21	0.04	21.0	2	1	0
PRT	tr|H3BKM2|H3BKM2_MOUSE	Isoform of Q80YV2, C3HC-type domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Zc3hc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	351-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|Q80U16-4|RIPR2-4_MOUSE	Isoform of Q80U16, Isoform 4 of Rho family-interacting cell polarization regulator 2 OS=Mus musculus (Mouse) OX=10090 GN=Ripor2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	46-UNIMOD:21	0.04	21.0	3	2	0
PRT	sp|Q8K124|PKHO2_MOUSE	Pleckstrin homology domain-containing family O member 2 OS=Mus musculus (Mouse) OX=10090 GN=Plekho2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	395-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O35601-2|FYB1-2_MOUSE	Isoform of O35601, Isoform FYB-120 of FYN-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fyb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	561-UNIMOD:21,16-UNIMOD:21	0.06	21.0	5	2	0
PRT	sp|Q6PDM2|SRSF1_MOUSE	Serine/arginine-rich splicing factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Srsf1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	null	199-UNIMOD:21	0.06	21.0	3	1	0
PRT	sp|Q62018|CTR9_MOUSE	RNA polymerase-associated protein CTR9 homolog OS=Mus musculus (Mouse) OX=10090 GN=Ctr9 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	925-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q8C147|DOCK8_MOUSE	Dedicator of cytokinesis protein 8 OS=Mus musculus (Mouse) OX=10090 GN=Dock8 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1246-UNIMOD:21,1241-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q6ZPZ3|ZC3H4_MOUSE	Zinc finger CCCH domain-containing protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Zc3h4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1099-UNIMOD:4,1115-UNIMOD:21,1104-UNIMOD:21,1101-UNIMOD:21	0.02	21.0	4	1	0
PRT	sp|E9Q394|AKP13_MOUSE	A-kinase anchor protein 13 OS=Mus musculus (Mouse) OX=10090 GN=Akap13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	1532-UNIMOD:21,1893-UNIMOD:21,1900-UNIMOD:4	0.01	21.0	2	2	1
PRT	sp|Q91YD3|DCP1A_MOUSE	mRNA-decapping enzyme 1A OS=Mus musculus (Mouse) OX=10090 GN=Dcp1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	164-UNIMOD:21,169-UNIMOD:4	0.04	21.0	3	1	0
PRT	sp|Q6P8I4|PCNP_MOUSE	PEST proteolytic signal-containing nuclear protein OS=Mus musculus (Mouse) OX=10090 GN=Pcnp PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	108-UNIMOD:21,124-UNIMOD:35,119-UNIMOD:21	0.14	21.0	8	1	0
PRT	sp|Q8JZX4|SPF45_MOUSE	Splicing factor 45 OS=Mus musculus (Mouse) OX=10090 GN=Rbm17 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	224-UNIMOD:21,214-UNIMOD:21	0.09	21.0	3	1	0
PRT	sp|Q8VI36|PAXI_MOUSE	Paxillin OS=Mus musculus (Mouse) OX=10090 GN=Pxn PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	83-UNIMOD:21	0.03	21.0	4	1	0
PRT	sp|Q8R550|SH3K1_MOUSE	SH3 domain-containing kinase-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Sh3kbp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	null	274-UNIMOD:21	0.03	21.0	2	1	0
PRT	tr|A0A0A0MQ73|A0A0A0MQ73_MOUSE	Isoform of Q6PDK2, Histone-lysine N-methyltransferase 2D OS=Mus musculus (Mouse) OX=10090 GN=Kmt2d PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	4789-UNIMOD:21	0.00	20.0	2	1	0
PRT	tr|B0R030|B0R030_MOUSE	Isoform of O09044, Synaptosomal-associated protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Snap23 PE=1 SV=8	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	110-UNIMOD:21	0.14	20.0	1	1	0
PRT	tr|D6RE33|D6RE33_MOUSE	Isoform of Q3UJB9, WD_REPEATS_REGION domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Edc4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	822-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O89086|RBM3_MOUSE	RNA-binding protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Rbm3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.16	20.0	1	1	1
PRT	sp|Q9QYB8-3|ADDB-3_MOUSE	Isoform of Q9QYB8, Isoform 3 of Beta-adducin OS=Mus musculus (Mouse) OX=10090 GN=Add2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	464-UNIMOD:21	0.02	20.0	5	1	0
PRT	tr|S4R2F6|S4R2F6_MOUSE	Isoform of O88890, SH2 domain-containing protein 1A (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Sh2d1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	86-UNIMOD:21,89-UNIMOD:4	0.20	20.0	3	2	1
PRT	sp|P70658-2|CXCR4-2_MOUSE	Isoform of P70658, Isoform CXCR4-A of C-X-C chemokine receptor type 4 OS=Mus musculus (Mouse) OX=10090 GN=Cxcr4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	330-UNIMOD:21	0.03	20.0	4	1	0
PRT	tr|E9PZG4|E9PZG4_MOUSE	Isoform of Q8C2B3, Histone deacetylase 7 OS=Mus musculus (Mouse) OX=10090 GN=Hdac7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	178-UNIMOD:21,342-UNIMOD:21	0.06	20.0	8	3	0
PRT	tr|A2AU60|A2AU60_MOUSE	Isoform of Q64012, RRM domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Raly PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	119-UNIMOD:21	0.11	20.0	12	2	0
PRT	sp|Q8VD58|EVI2B_MOUSE	Protein EVI2B OS=Mus musculus (Mouse) OX=10090 GN=Evi2b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	269-UNIMOD:21,272-UNIMOD:21	0.03	20.0	4	1	0
PRT	sp|Q923E4-2|SIR1-2_MOUSE	Isoform of Q923E4, Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus (Mouse) OX=10090 GN=Sirt1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	46-UNIMOD:21,61-UNIMOD:4	0.07	20.0	1	1	0
PRT	tr|E9Q7Y4|E9Q7Y4_MOUSE	Isoform of Q6P9R4, Rho guanine nucleotide exchange factor 18 OS=Mus musculus (Mouse) OX=10090 GN=Arhgef18 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	133-UNIMOD:21,144-UNIMOD:4	0.04	20.0	1	1	0
PRT	tr|E9Q8J8|E9Q8J8_MOUSE	Isoform of P97360, Transcription factor ETV6 OS=Mus musculus (Mouse) OX=10090 GN=Etv6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	126-UNIMOD:21,151-UNIMOD:21,158-UNIMOD:4	0.12	20.0	3	2	1
PRT	tr|F8WJG3|F8WJG3_MOUSE	Isoform of P62996, RRM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Tra2b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	101-UNIMOD:21	0.11	20.0	1	1	0
PRT	tr|A0A286YDC0|A0A286YDC0_MOUSE	Isoform of Q03147, Protein kinase domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Cdk7 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	127-UNIMOD:21,133-UNIMOD:21	0.06	20.0	1	1	1
PRT	tr|Q504P4|Q504P4_MOUSE	Isoform of P63017, Heat shock cognate 71 kDa protein OS=Mus musculus (Mouse) OX=10090 GN=Hspa8 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	3	2	1
PRT	tr|D6RI80|D6RI80_MOUSE	Isoform of Q8BKC8, Phosphatidylinositol 4-kinase beta (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Pi4kb PE=1 SV=9	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	93-UNIMOD:21,103-UNIMOD:4	0.11	20.0	1	1	0
PRT	sp|Q9DCB4-5|ARP21-5_MOUSE	Isoform of Q9DCB4, Isoform 5 of cAMP-regulated phosphoprotein 21 OS=Mus musculus (Mouse) OX=10090 GN=Arpp21 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	null	348-UNIMOD:21,329-UNIMOD:21	0.04	20.0	3	2	1
PRT	sp|Q8K019|BCLF1_MOUSE	Bcl-2-associated transcription factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Bclaf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	656-UNIMOD:21,510-UNIMOD:21,383-UNIMOD:21	0.05	20.0	10	5	1
PRT	sp|O35601|FYB1_MOUSE	FYN-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fyb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	28-UNIMOD:21	0.04	20.0	1	1	0
PRT	sp|G5E870|TRIPC_MOUSE	E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus (Mouse) OX=10090 GN=Trip12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	312-UNIMOD:21,310-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|E9PYH6|SET1A_MOUSE	Histone-lysine N-methyltransferase SETD1A OS=Mus musculus (Mouse) OX=10090 GN=Setd1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	523-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q9CWZ3|RBM8A_MOUSE	RNA-binding protein 8A OS=Mus musculus (Mouse) OX=10090 GN=Rbm8a PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	56-UNIMOD:21	0.11	20.0	2	1	0
PRT	sp|Q9Z1F9|SAE2_MOUSE	SUMO-activating enzyme subunit 2 OS=Mus musculus (Mouse) OX=10090 GN=Uba2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	null	590-UNIMOD:21,601-UNIMOD:4	0.07	20.0	3	1	0
PRT	sp|Q9QYB5|ADDG_MOUSE	Gamma-adducin OS=Mus musculus (Mouse) OX=10090 GN=Add3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	null	2-UNIMOD:1,12-UNIMOD:21	0.03	20.0	1	1	1
PRT	tr|E9Q8F0|E9Q8F0_MOUSE	Isoform of Q8VH51, RNA-binding protein 39 OS=Mus musculus (Mouse) OX=10090 GN=Rbm39 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	136-UNIMOD:21,117-UNIMOD:21,97-UNIMOD:21	0.11	19.0	7	3	0
PRT	sp|Q61165|SL9A1_MOUSE	Sodium/hydrogen exchanger 1 OS=Mus musculus (Mouse) OX=10090 GN=Slc9a1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	697-UNIMOD:21,799-UNIMOD:4,801-UNIMOD:21	0.05	19.0	3	2	1
PRT	tr|E9Q9T6|E9Q9T6_MOUSE	Isoform of Q6ZPL9, RNA helicase OS=Mus musculus (Mouse) OX=10090 GN=Ddx55 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	540-UNIMOD:21	0.04	19.0	1	1	1
PRT	sp|Q501J7-2|PHAR4-2_MOUSE	Isoform of Q501J7, Isoform 2 of Phosphatase and actin regulator 4 OS=Mus musculus (Mouse) OX=10090 GN=Phactr4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	593-UNIMOD:21	0.02	19.0	1	1	1
PRT	tr|A0A0A6YY34|A0A0A6YY34_MOUSE	Isoform of P11352, Glutathione peroxidase OS=Mus musculus (Mouse) OX=10090 GN=Gpx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.14	19.0	1	1	1
PRT	tr|E9Q9Q7|E9Q9Q7_MOUSE	Isoform of Q8K4G5, HP domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ablim1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	89-UNIMOD:21,87-UNIMOD:21	0.07	19.0	3	2	0
PRT	tr|A0A3Q4EGF1|A0A3Q4EGF1_MOUSE	Isoform of P54276, PWWP domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Msh6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	58-UNIMOD:21	0.11	19.0	1	1	0
PRT	tr|A0A498WFS2|A0A498WFS2_MOUSE	Isoform of Q922Y1, UBX domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ubxn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	null	147-UNIMOD:21	0.12	19.0	1	1	0
PRT	sp|Q9JIX8|ACINU_MOUSE	Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus (Mouse) OX=10090 GN=Acin1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	825-UNIMOD:21,1003-UNIMOD:21,477-UNIMOD:21,710-UNIMOD:21	0.07	19.0	6	4	0
PRT	tr|D3Z7R7|D3Z7R7_MOUSE	Isoform of Q3TBD2, Rho GTPase-activating protein 45 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap45 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	83-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|Q99PV8|BC11B_MOUSE	B-cell lymphoma/leukemia 11B OS=Mus musculus (Mouse) OX=10090 GN=Bcl11b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	128-UNIMOD:21,134-UNIMOD:4,416-UNIMOD:21,381-UNIMOD:21,130-UNIMOD:21,376-UNIMOD:21,762-UNIMOD:21	0.12	19.0	12	5	1
PRT	sp|Q9JI11|STK4_MOUSE	Serine/threonine-protein kinase 4 OS=Mus musculus (Mouse) OX=10090 GN=Stk4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	320-UNIMOD:21	0.06	19.0	3	2	1
PRT	sp|Q4VA53|PDS5B_MOUSE	Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus (Mouse) OX=10090 GN=Pds5b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1356-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|E9Q7G0|NUMA1_MOUSE	Nuclear mitotic apparatus protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Numa1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1951-UNIMOD:21,1742-UNIMOD:21,398-UNIMOD:21,1739-UNIMOD:21	0.04	19.0	4	3	2
PRT	sp|Q61286|HTF4_MOUSE	Transcription factor 12 OS=Mus musculus (Mouse) OX=10090 GN=Tcf12 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	98-UNIMOD:21	0.03	19.0	1	1	1
PRT	sp|Q3UHJ0|AAK1_MOUSE	AP2-associated protein kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Aak1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	635-UNIMOD:21	0.02	19.0	2	1	0
PRT	sp|P57776|EF1D_MOUSE	Elongation factor 1-delta OS=Mus musculus (Mouse) OX=10090 GN=Eef1d PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	162-UNIMOD:21	0.11	19.0	2	1	0
PRT	sp|Q9WTU0|PHF2_MOUSE	Lysine-specific demethylase PHF2 OS=Mus musculus (Mouse) OX=10090 GN=Phf2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	531-UNIMOD:4,538-UNIMOD:21,534-UNIMOD:21	0.02	19.0	2	2	2
PRT	tr|Q1HDU4|Q1HDU4_MOUSE	ArhGAP9 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	372-UNIMOD:21	0.04	19.0	1	1	0
PRT	sp|Q9Z277|BAZ1B_MOUSE	Tyrosine-protein kinase BAZ1B OS=Mus musculus (Mouse) OX=10090 GN=Baz1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1464-UNIMOD:21,1468-UNIMOD:21,1338-UNIMOD:21,1344-UNIMOD:4,1466-UNIMOD:21	0.03	19.0	6	2	1
PRT	sp|Q3UIR3|DTX3L_MOUSE	E3 ubiquitin-protein ligase DTX3L OS=Mus musculus (Mouse) OX=10090 GN=Dtx3l PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,9-UNIMOD:21	0.02	19.0	1	1	1
PRT	sp|Q3UCQ1|FOXK2_MOUSE	Forkhead box protein K2 OS=Mus musculus (Mouse) OX=10090 GN=Foxk2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	2-UNIMOD:1,24-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|O88685|PRS6A_MOUSE	26S proteasome regulatory subunit 6A OS=Mus musculus (Mouse) OX=10090 GN=Psmc3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	null	1-UNIMOD:1,12-UNIMOD:21	0.05	19.0	2	1	0
PRT	sp|P97868|RBBP6_MOUSE	E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus (Mouse) OX=10090 GN=Rbbp6 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	null	1179-UNIMOD:21	0.01	19.0	1	1	1
PRT	tr|A0A087WQ61|A0A087WQ61_MOUSE	Isoform of Q9ERD6, Ras-GEF domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ralgps2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	348-UNIMOD:4,350-UNIMOD:21	0.03	18.0	1	1	1
PRT	sp|P61982|1433G_MOUSE	14-3-3 protein gamma OS=Mus musculus (Mouse) OX=10090 GN=Ywhag PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null		0.09	18.0	3	1	0
PRT	tr|A0A2I3BQU5|A0A2I3BQU5_MOUSE	Isoform of E9PZM7, RING-type domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Scaf11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	821-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q61823|PDCD4_MOUSE	Programmed cell death protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Pdcd4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	457-UNIMOD:21	0.03	18.0	2	1	0
PRT	tr|Q80XR5|Q80XR5_MOUSE	Isoform of P26369, U2 snRNP auxiliary factor large subunit OS=Mus musculus (Mouse) OX=10090 GN=U2af2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	79-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q9WTX2|PRKRA_MOUSE	Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Mus musculus (Mouse) OX=10090 GN=Prkra PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	18-UNIMOD:21,20-UNIMOD:21	0.07	18.0	2	1	0
PRT	tr|A0A494BBB2|A0A494BBB2_MOUSE	Isoform of Q05AH6, zf-C2H2_12 domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Spindoc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	195-UNIMOD:21	0.10	18.0	1	1	0
PRT	tr|Q14AA6|Q14AA6_MOUSE	GTP-binding nuclear protein Ran OS=Mus musculus (Mouse) OX=10090 GN=1700009N14Rik PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	2	1	0
PRT	tr|A0A087WSG4|A0A087WSG4_MOUSE	Isoform of G5E870, E3 ubiquitin-protein ligase TRIP12 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Trip12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	19-UNIMOD:21	0.07	18.0	1	1	0
PRT	sp|Q8C2Q3|RBM14_MOUSE	RNA-binding protein 14 OS=Mus musculus (Mouse) OX=10090 GN=Rbm14 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	627-UNIMOD:21,623-UNIMOD:21	0.02	18.0	3	1	0
PRT	tr|V9GWU5|V9GWU5_MOUSE	Isoform of Q9CYZ2, Tumor protein D54 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Tpd52l2 PE=1 SV=8	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	145-UNIMOD:21	0.10	18.0	1	1	1
PRT	tr|B8JJC1|B8JJC1_MOUSE	Isoform of Q8BJ37, Tyrosyl-DNA phosphodiesterase 1 OS=Mus musculus (Mouse) OX=10090 GN=Tdp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	null	61-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|P42230|STA5A_MOUSE	Signal transducer and activator of transcription 5A OS=Mus musculus (Mouse) OX=10090 GN=Stat5a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	773-UNIMOD:21	0.03	18.0	2	1	0
PRT	sp|Q9DB52|F122A_MOUSE	Protein FAM122A OS=Mus musculus (Mouse) OX=10090 GN=Fam122a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	32-UNIMOD:21,34-UNIMOD:21	0.09	18.0	3	1	0
PRT	sp|Q08943|SSRP1_MOUSE	FACT complex subunit SSRP1 OS=Mus musculus (Mouse) OX=10090 GN=Ssrp1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	444-UNIMOD:21	0.04	18.0	2	1	0
PRT	sp|Q9D6Z1|NOP56_MOUSE	Nucleolar protein 56 OS=Mus musculus (Mouse) OX=10090 GN=Nop56 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	513-UNIMOD:21,536-UNIMOD:21	0.08	18.0	5	4	2
PRT	sp|P62996|TRA2B_MOUSE	Transformer-2 protein homolog beta OS=Mus musculus (Mouse) OX=10090 GN=Tra2b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	264-UNIMOD:21,266-UNIMOD:21,203-UNIMOD:21,201-UNIMOD:21	0.11	18.0	7	2	0
PRT	sp|Q03347|RUNX1_MOUSE	Runt-related transcription factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Runx1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	207-UNIMOD:21	0.04	18.0	1	1	0
PRT	sp|P70288|HDAC2_MOUSE	Histone deacetylase 2 OS=Mus musculus (Mouse) OX=10090 GN=Hdac2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	394-UNIMOD:21,373-UNIMOD:35	0.08	18.0	3	2	0
PRT	sp|Q61033|LAP2A_MOUSE	Lamina-associated polypeptide 2, isoforms alpha/zeta OS=Mus musculus (Mouse) OX=10090 GN=Tmpo PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null	67-UNIMOD:21,420-UNIMOD:21,422-UNIMOD:21,157-UNIMOD:21,159-UNIMOD:21	0.11	18.0	6	3	0
PRT	sp|Q05AH6|SPNDC_MOUSE	Spindlin interactor and repressor of chromatin-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Spindoc PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	249-UNIMOD:21	0.07	18.0	1	1	0
PRT	sp|P61979|HNRPK_MOUSE	Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	116-UNIMOD:21,132-UNIMOD:4,145-UNIMOD:4	0.10	18.0	3	1	0
PRT	sp|Q8R1G6|PDLI2_MOUSE	PDZ and LIM domain protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Pdlim2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	205-UNIMOD:21	0.08	18.0	1	1	1
PRT	sp|Q64012|RALY_MOUSE	RNA-binding protein Raly OS=Mus musculus (Mouse) OX=10090 GN=Raly PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	135-UNIMOD:21	0.04	18.0	4	1	0
PRT	sp|Q8K296|MTMR3_MOUSE	Myotubularin-related protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Mtmr3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	613-UNIMOD:21,621-UNIMOD:4	0.02	18.0	1	1	0
PRT	sp|Q99JT2|STK26_MOUSE	Serine/threonine-protein kinase 26 OS=Mus musculus (Mouse) OX=10090 GN=Stk26 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1,4-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q504N7|IFIXL_MOUSE	Pyrin and HIN domain-containing protein 1-like OS=Mus musculus (Mouse) OX=10090 GN=MGI:3584522 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	154-UNIMOD:21	0.05	18.0	1	1	1
PRT	sp|Q3UI43|BABA1_MOUSE	BRISC and BRCA1-A complex member 1 OS=Mus musculus (Mouse) OX=10090 GN=Babam1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	null	1-UNIMOD:1,8-UNIMOD:21	0.10	18.0	2	1	0
PRT	tr|E9Q6E5|E9Q6E5_MOUSE	RRM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Srsf11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	18.0	null	2-UNIMOD:1,3-UNIMOD:21,510-UNIMOD:21	0.10	18.0	3	2	1
PRT	sp|Q80X41|VRK1_MOUSE	Serine/threonine-protein kinase VRK1 OS=Mus musculus (Mouse) OX=10090 GN=Vrk1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	368-UNIMOD:4,375-UNIMOD:4,378-UNIMOD:21	0.07	18.0	1	1	1
PRT	sp|Q60974|NCOR1_MOUSE	Nuclear receptor corepressor 1 OS=Mus musculus (Mouse) OX=10090 GN=Ncor1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1481-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|A2AR02|PPIG_MOUSE	Peptidyl-prolyl cis-trans isomerase G OS=Mus musculus (Mouse) OX=10090 GN=Ppig PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	356-UNIMOD:21	0.02	18.0	1	1	1
PRT	sp|Q80X50|UBP2L_MOUSE	Ubiquitin-associated protein 2-like OS=Mus musculus (Mouse) OX=10090 GN=Ubap2l PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	628-UNIMOD:21,629-UNIMOD:21	0.02	18.0	2	1	0
PRT	sp|Q69ZA1|CDK13_MOUSE	Cyclin-dependent kinase 13 OS=Mus musculus (Mouse) OX=10090 GN=Cdk13 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	1245-UNIMOD:21	0.01	18.0	1	1	1
PRT	sp|Q9Z1D1|EIF3G_MOUSE	Eukaryotic translation initiation factor 3 subunit G OS=Mus musculus (Mouse) OX=10090 GN=Eif3g PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	null	42-UNIMOD:21	0.11	18.0	2	1	0
PRT	sp|P70441|NHRF1_MOUSE	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Mus musculus (Mouse) OX=10090 GN=Slc9a3r1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null	273-UNIMOD:21,288-UNIMOD:21,275-UNIMOD:21	0.18	17.0	4	2	1
PRT	sp|Q9D824-3|FIP1-3_MOUSE	Isoform of Q9D824, Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Mus musculus (Mouse) OX=10090 GN=Fip1l1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	434-UNIMOD:21	0.04	17.0	1	1	1
PRT	sp|Q9CXG3|PPIL4_MOUSE	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus (Mouse) OX=10090 GN=Ppil4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	392-UNIMOD:4,393-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|P47911|RL6_MOUSE	60S ribosomal protein L6 OS=Mus musculus (Mouse) OX=10090 GN=Rpl6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	2	1	0
PRT	sp|Q8K3X4|I2BPL_MOUSE	Probable E3 ubiquitin-protein ligase IRF2BPL OS=Mus musculus (Mouse) OX=10090 GN=Irf2bpl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	526-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q0VBL3-2|RBM15-2_MOUSE	Isoform of Q0VBL3, Isoform 2 of RNA-binding protein 15 OS=Mus musculus (Mouse) OX=10090 GN=Rbm15 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	700-UNIMOD:21,293-UNIMOD:21	0.03	17.0	6	3	0
PRT	tr|A2AD32|A2AD32_MOUSE	Isoform of P48193, FERM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Epb41 PE=1 SV=9	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	87-UNIMOD:21	0.01	17.0	2	1	0
PRT	sp|P28667|MRP_MOUSE	MARCKS-related protein OS=Mus musculus (Mouse) OX=10090 GN=Marcksl1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	104-UNIMOD:21	0.05	17.0	4	1	0
PRT	tr|Q9DCC5|Q9DCC5_MOUSE	Isoform of P23198, Cbx3 protein OS=Mus musculus (Mouse) OX=10090 GN=Cbx3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	177-UNIMOD:4	0.07	17.0	2	1	0
PRT	tr|A0A087WR39|A0A087WR39_MOUSE	Isoform of Q7TT18, Activating transcription factor 7-interacting protein 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Atf7ip PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	112-UNIMOD:21,117-UNIMOD:4	0.04	17.0	1	1	0
PRT	tr|A0A0U1RPR0|A0A0U1RPR0_MOUSE	Isoform of Q8R1B4, eIF-3c_N domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Eif3c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	39-UNIMOD:21	0.27	17.0	1	1	1
PRT	sp|Q9EST5|AN32B_MOUSE	Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Mus musculus (Mouse) OX=10090 GN=Anp32b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	123-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P43024|CX6A1_MOUSE	Cytochrome c oxidase subunit 6A1, mitochondrial OS=Mus musculus (Mouse) OX=10090 GN=Cox6a1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.17	17.0	1	1	1
PRT	tr|E9Q996|E9Q996_MOUSE	Isoform of Q8R1G6, PDZ domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Pdlim2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	204-UNIMOD:21	0.06	17.0	2	1	0
PRT	sp|Q8C2K1-2|DEFI6-2_MOUSE	Isoform of Q8C2K1, Isoform 2 of Differentially expressed in FDCP 6 OS=Mus musculus (Mouse) OX=10090 GN=Def6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	null	217-UNIMOD:21	0.07	17.0	1	1	1
PRT	sp|Q52KI8|SRRM1_MOUSE	Serine/arginine repetitive matrix protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Srrm1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	616-UNIMOD:21,915-UNIMOD:21	0.03	17.0	7	2	0
PRT	sp|E9PVX6|KI67_MOUSE	Proliferation marker protein Ki-67 OS=Mus musculus (Mouse) OX=10090 GN=Mki67 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	2980-UNIMOD:21,337-UNIMOD:21	0.01	17.0	2	2	0
PRT	sp|Q8K4G5|ABLM1_MOUSE	Actin-binding LIM protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ablim1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	789-UNIMOD:21,475-UNIMOD:21	0.05	17.0	2	2	1
PRT	sp|A2BH40|ARI1A_MOUSE	AT-rich interactive domain-containing protein 1A OS=Mus musculus (Mouse) OX=10090 GN=Arid1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	365-UNIMOD:21	0.01	17.0	1	1	0
PRT	sp|Q3UJB9|EDC4_MOUSE	Enhancer of mRNA-decapping protein 4 OS=Mus musculus (Mouse) OX=10090 GN=Edc4 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	884-UNIMOD:21	0.02	17.0	1	1	1
PRT	sp|Q9CSU0|RPR1B_MOUSE	Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Mus musculus (Mouse) OX=10090 GN=Rprd1b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	165-UNIMOD:21,166-UNIMOD:21	0.11	17.0	3	1	0
PRT	sp|Q64697|PTCA_MOUSE	Protein tyrosine phosphatase receptor type C-associated protein OS=Mus musculus (Mouse) OX=10090 GN=Ptprcap PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	99-UNIMOD:21	0.21	17.0	2	1	0
PRT	sp|Q8C2K5|RASL3_MOUSE	RAS protein activator like-3 OS=Mus musculus (Mouse) OX=10090 GN=Rasal3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	813-UNIMOD:21,816-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|Q62193|RFA2_MOUSE	Replication protein A 32 kDa subunit OS=Mus musculus (Mouse) OX=10090 GN=Rpa2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	250-UNIMOD:4	0.10	17.0	1	1	0
PRT	sp|Q60953|PML_MOUSE	Protein PML OS=Mus musculus (Mouse) OX=10090 GN=Pml PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	528-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|Q8K4L3|SVIL_MOUSE	Supervillin OS=Mus musculus (Mouse) OX=10090 GN=Svil PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	1011-UNIMOD:21	0.01	17.0	2	1	0
PRT	sp|Q8BYZ1|ABI3_MOUSE	ABI gene family member 3 OS=Mus musculus (Mouse) OX=10090 GN=Abi3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	343-UNIMOD:21,347-UNIMOD:4,367-UNIMOD:4	0.08	17.0	2	1	0
PRT	tr|E9Q616|E9Q616_MOUSE	PDZ domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Ahnak PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	94-UNIMOD:21	0.00	17.0	2	1	0
PRT	sp|Q9WU00|NRF1_MOUSE	Nuclear respiratory factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Nrf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	134-UNIMOD:4,136-UNIMOD:21	0.04	17.0	1	1	0
PRT	sp|Q8BLB7|LMBL3_MOUSE	Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus (Mouse) OX=10090 GN=L3mbtl3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	604-UNIMOD:21	0.02	17.0	2	1	0
PRT	sp|B2RY56|RBM25_MOUSE	RNA-binding protein 25 OS=Mus musculus (Mouse) OX=10090 GN=Rbm25 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	672-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q5NCR9|NSRP1_MOUSE	Nuclear speckle splicing regulatory protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Nsrp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	33-UNIMOD:21	0.05	17.0	1	1	1
PRT	sp|Q9DBS5|KLC4_MOUSE	Kinesin light chain 4 OS=Mus musculus (Mouse) OX=10090 GN=Klc4 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	590-UNIMOD:21	0.03	17.0	1	1	1
PRT	sp|Q9D0L7|ARM10_MOUSE	Armadillo repeat-containing protein 10 OS=Mus musculus (Mouse) OX=10090 GN=Armc10 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	43-UNIMOD:21	0.07	17.0	2	1	0
PRT	sp|Q8BZR9|NCBP3_MOUSE	Nuclear cap-binding protein subunit 3 OS=Mus musculus (Mouse) OX=10090 GN=Ncbp3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	495-UNIMOD:21	0.03	17.0	3	1	0
PRT	sp|Q8BJS4|SUN2_MOUSE	SUN domain-containing protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Sun2 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	null	277-UNIMOD:21	0.03	17.0	1	1	1
PRT	tr|D3Z4C3|D3Z4C3_MOUSE	Isoform of O88939, Zinc finger and BTB domain-containing protein 7A OS=Mus musculus (Mouse) OX=10090 GN=Zbtb7a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	331-UNIMOD:21	0.05	16.0	1	1	1
PRT	tr|E0CXA0|E0CXA0_MOUSE	Isoform of P51859, Hepatoma-derived growth factor (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Hdgf PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	133-UNIMOD:21	0.07	16.0	1	1	1
PRT	tr|Q5SX49|Q5SX49_MOUSE	Isoform of P62962, Profilin OS=Mus musculus (Mouse) OX=10090 GN=Pfn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	71-UNIMOD:4	0.18	16.0	1	1	1
PRT	tr|D3Z2T9|D3Z2T9_MOUSE	Isoform of P11440, Protein kinase domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Cdk1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	15-UNIMOD:21	0.07	16.0	1	1	1
PRT	tr|A0A1L1STF9|A0A1L1STF9_MOUSE	Isoform of Q8CH25, SAFB-like transcription modulator OS=Mus musculus (Mouse) OX=10090 GN=Sltm PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	550-UNIMOD:21	0.03	16.0	1	1	1
PRT	tr|E9PUI4|E9PUI4_MOUSE	Isoform of Q8VDP3, [F-actin]-monooxygenase MICAL1 OS=Mus musculus (Mouse) OX=10090 GN=Mical1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	794-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q6KCD5-2|NIPBL-2_MOUSE	Isoform of Q6KCD5, Isoform 2 of Nipped-B-like protein OS=Mus musculus (Mouse) OX=10090 GN=Nipbl PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	2652-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q9DBR1-2|XRN2-2_MOUSE	Isoform of Q9DBR1, Isoform 2 of 5'-3' exoribonuclease 2 OS=Mus musculus (Mouse) OX=10090 GN=Xrn2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	471-UNIMOD:21,470-UNIMOD:21	0.03	16.0	2	1	0
PRT	tr|B7ZC24|B7ZC24_MOUSE	Isoform of Q91W39, Nuclear receptor coactivator 5 OS=Mus musculus (Mouse) OX=10090 GN=Ncoa5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	126-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q91VY6|CYTIP_MOUSE	Cytohesin-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=Cytip PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null	64-UNIMOD:21	0.04	16.0	1	1	1
PRT	sp|Q9CY57-5|CHTOP-5_MOUSE	Isoform of Q9CY57, Isoform 5 of Chromatin target of PRMT1 protein OS=Mus musculus (Mouse) OX=10090 GN=Chtop PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.13	16.0	1	1	1
PRT	sp|P13864|DNMT1_MOUSE	DNA (cytosine-5)-methyltransferase 1 OS=Mus musculus (Mouse) OX=10090 GN=Dnmt1 PE=1 SV=5	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	694-UNIMOD:4,717-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q8C2B3|HDAC7_MOUSE	Histone deacetylase 7 OS=Mus musculus (Mouse) OX=10090 GN=Hdac7 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	344-UNIMOD:21,178-UNIMOD:21	0.04	16.0	3	3	0
PRT	sp|Q8C2K1|DEFI6_MOUSE	Differentially expressed in FDCP 6 OS=Mus musculus (Mouse) OX=10090 GN=Def6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	564-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q99K48|NONO_MOUSE	Non-POU domain-containing octamer-binding protein OS=Mus musculus (Mouse) OX=10090 GN=Nono PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.10	16.0	3	2	1
PRT	sp|Q9JM73|SRF_MOUSE	Serum response factor OS=Mus musculus (Mouse) OX=10090 GN=Srf PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	214-UNIMOD:4,220-UNIMOD:21	0.05	16.0	1	1	1
PRT	sp|Q8R1B4|EIF3C_MOUSE	Eukaryotic translation initiation factor 3 subunit C OS=Mus musculus (Mouse) OX=10090 GN=Eif3c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|O09044|SNP23_MOUSE	Synaptosomal-associated protein 23 OS=Mus musculus (Mouse) OX=10090 GN=Snap23 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	110-UNIMOD:21	0.10	16.0	1	1	0
PRT	sp|E9Q784|ZC3HD_MOUSE	Zinc finger CCCH domain-containing protein 13 OS=Mus musculus (Mouse) OX=10090 GN=Zc3h13 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	16.0	null	242-UNIMOD:21,953-UNIMOD:21	0.02	16.0	4	2	0
PRT	sp|P70227|ITPR3_MOUSE	Inositol 1,4,5-trisphosphate receptor type 3 OS=Mus musculus (Mouse) OX=10090 GN=Itpr3 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	934-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|Q62511|ZFP91_MOUSE	E3 ubiquitin-protein ligase ZFP91 OS=Mus musculus (Mouse) OX=10090 GN=Zfp91 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	10-UNIMOD:21	0.09	16.0	1	1	1
PRT	sp|Q922Y1|UBXN1_MOUSE	UBX domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Ubxn1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	182-UNIMOD:21	0.11	16.0	1	1	0
PRT	sp|Q924N4|S12A6_MOUSE	Solute carrier family 12 member 6 OS=Mus musculus (Mouse) OX=10090 GN=Slc12a6 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	32-UNIMOD:21	0.02	16.0	1	1	0
PRT	sp|Q7TT18|MCAF1_MOUSE	Activating transcription factor 7-interacting protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Atf7ip PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	112-UNIMOD:21,117-UNIMOD:4	0.02	16.0	1	1	0
PRT	sp|O08547|SC22B_MOUSE	Vesicle-trafficking protein SEC22b OS=Mus musculus (Mouse) OX=10090 GN=Sec22b PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	137-UNIMOD:21	0.07	16.0	1	1	1
PRT	sp|Q91X84|CRTC3_MOUSE	CREB-regulated transcription coactivator 3 OS=Mus musculus (Mouse) OX=10090 GN=Crtc3 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	62-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|Q9CZW5|TOM70_MOUSE	Mitochondrial import receptor subunit TOM70 OS=Mus musculus (Mouse) OX=10090 GN=Tomm70 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	94-UNIMOD:21	0.05	16.0	2	1	0
PRT	sp|F6ZDS4|TPR_MOUSE	Nucleoprotein TPR OS=Mus musculus (Mouse) OX=10090 GN=Tpr PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	453-UNIMOD:21	0.01	16.0	1	1	1
PRT	sp|P83741|WNK1_MOUSE	Serine/threonine-protein kinase WNK1 OS=Mus musculus (Mouse) OX=10090 GN=Wnk1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	2265-UNIMOD:21,373-UNIMOD:21	0.01	16.0	3	2	1
PRT	sp|Q6PDG5|SMRC2_MOUSE	SWI/SNF complex subunit SMARCC2 OS=Mus musculus (Mouse) OX=10090 GN=Smarcc2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	347-UNIMOD:21	0.03	16.0	1	1	1
PRT	sp|P97855|G3BP1_MOUSE	Ras GTPase-activating protein-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=G3bp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	231-UNIMOD:21	0.06	16.0	1	1	1
PRT	sp|P28574|MAX_MOUSE	Protein max OS=Mus musculus (Mouse) OX=10090 GN=Max PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	null	2-UNIMOD:1,2-UNIMOD:21,11-UNIMOD:21	0.16	16.0	1	1	1
PRT	sp|Q66JV4|R12BB_MOUSE	RNA-binding protein 12B-B OS=Mus musculus (Mouse) OX=10090 GN=Rbm12b2 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	279-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q8K327|CHAP1_MOUSE	Chromosome alignment-maintaining phosphoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Champ1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	603-UNIMOD:21	0.02	16.0	1	1	1
PRT	sp|Q61216|MRE11_MOUSE	Double-strand break repair protein MRE11 OS=Mus musculus (Mouse) OX=10090 GN=Mre11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	null	686-UNIMOD:21,700-UNIMOD:4	0.03	16.0	1	1	0
PRT	sp|A2AB59-2|RHG27-2_MOUSE	Isoform of A2AB59, Isoform 2 of Rho GTPase-activating protein 27 OS=Mus musculus (Mouse) OX=10090 GN=Arhgap27 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	15.0	null	28-UNIMOD:21	0.03	15.0	2	1	0
PRT	sp|Q8BVK9|SP110_MOUSE	Sp110 nuclear body protein OS=Mus musculus (Mouse) OX=10090 GN=Sp110 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null	175-UNIMOD:21	0.04	15.0	1	1	1
PRT	sp|A2A7Y5|MIIP_MOUSE	Migration and invasion-inhibitory protein OS=Mus musculus (Mouse) OX=10090 GN=Miip PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null	307-UNIMOD:21	0.04	15.0	2	1	0
PRT	tr|H3BJH7|H3BJH7_MOUSE	Isoform of Q80WT5, Clathrin_bdg domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Aftph PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null	151-UNIMOD:21	0.02	15.0	1	1	1
PRT	tr|D3YV66|D3YV66_MOUSE	Isoform of Q9WU00, Nrf1_DNA-bind domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Nrf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	null	146-UNIMOD:4,148-UNIMOD:21	0.13	15.0	1	1	0
PRT	sp|Q9DBC7|KAP0_MOUSE	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus (Mouse) OX=10090 GN=Prkar1a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	83-UNIMOD:21	0.06	15.0	2	2	0
PRT	sp|C0HKD8|MFA1A_MOUSE	Microfibrillar-associated protein 1A OS=Mus musculus (Mouse) OX=10090 GN=Mfap1a PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	267-UNIMOD:21	0.06	15.0	1	1	0
PRT	sp|Q9DBC3|CMTR1_MOUSE	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 OS=Mus musculus (Mouse) OX=10090 GN=Cmtr1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	29-UNIMOD:21	0.02	15.0	1	1	0
PRT	sp|Q8K310|MATR3_MOUSE	Matrin-3 OS=Mus musculus (Mouse) OX=10090 GN=Matr3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	188-UNIMOD:21	0.03	15.0	1	1	0
PRT	sp|Q8C503|SIT1_MOUSE	Signaling threshold-regulating transmembrane adapter 1 OS=Mus musculus (Mouse) OX=10090 GN=Sit1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	166-UNIMOD:21	0.11	15.0	3	1	0
PRT	sp|Q9ESZ8|GTF2I_MOUSE	General transcription factor II-I OS=Mus musculus (Mouse) OX=10090 GN=Gtf2i PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	674-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q8BKC8|PI4KB_MOUSE	Phosphatidylinositol 4-kinase beta OS=Mus musculus (Mouse) OX=10090 GN=Pi4kb PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	428-UNIMOD:21,435-UNIMOD:4	0.02	15.0	1	1	0
PRT	sp|Q8BIH0|SP130_MOUSE	Histone deacetylase complex subunit SAP130 OS=Mus musculus (Mouse) OX=10090 GN=Sap130 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	862-UNIMOD:21,864-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|Q80UG5|SEPT9_MOUSE	Septin-9 OS=Mus musculus (Mouse) OX=10090 GN=Septin9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	82-UNIMOD:21	0.03	15.0	1	1	0
PRT	sp|P18608|HMGN1_MOUSE	Non-histone chromosomal protein HMG-14 OS=Mus musculus (Mouse) OX=10090 GN=Hmgn1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	87-UNIMOD:21	0.38	15.0	1	1	1
PRT	sp|Q91YE5|BAZ2A_MOUSE	Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus (Mouse) OX=10090 GN=Baz2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	1042-UNIMOD:21	0.01	15.0	1	1	1
PRT	sp|Q8CEC0|NUP88_MOUSE	Nuclear pore complex protein Nup88 OS=Mus musculus (Mouse) OX=10090 GN=Nup88 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	710-UNIMOD:21	0.02	15.0	1	1	0
PRT	sp|O54785|LIMK2_MOUSE	LIM domain kinase 2 OS=Mus musculus (Mouse) OX=10090 GN=Limk2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	null	289-UNIMOD:21	0.03	15.0	1	1	1
PRT	sp|P63254|CRIP1_MOUSE	Cysteine-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Crip1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	7-UNIMOD:4	0.14	14.0	1	1	1
PRT	sp|P68510|1433F_MOUSE	14-3-3 protein eta OS=Mus musculus (Mouse) OX=10090 GN=Ywhah PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.08	14.0	1	1	1
PRT	sp|P26041|MOES_MOUSE	Moesin OS=Mus musculus (Mouse) OX=10090 GN=Msn PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.03	14.0	1	1	1
PRT	sp|Q9WTQ5-2|AKA12-2_MOUSE	Isoform of Q9WTQ5, Isoform 2 of A-kinase anchor protein 12 OS=Mus musculus (Mouse) OX=10090 GN=Akap12 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	493-UNIMOD:21	0.01	14.0	1	1	1
PRT	tr|A0A0B4J1E2|A0A0B4J1E2_MOUSE	Isoform of Q9CSN1, SKIP_SNW domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Snw1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	224-UNIMOD:21	0.03	14.0	1	1	0
PRT	sp|P05132-2|KAPCA-2_MOUSE	Isoform of P05132, Isoform 2 of cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Prkaca PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	188-UNIMOD:21,192-UNIMOD:4	0.06	14.0	1	1	1
PRT	sp|A6H619-2|PHRF1-2_MOUSE	Isoform of A6H619, Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Phrf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	755-UNIMOD:21	0.02	14.0	1	1	1
PRT	tr|A2AER8|A2AER8_MOUSE	Isoform of Q91VJ5, WW domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Pqbp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.06	14.0	2	1	0
PRT	sp|Q8BVL9|JKIP1_MOUSE	Janus kinase and microtubule-interacting protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Jakmip1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	14.0	null	382-UNIMOD:21	0.03	14.0	3	1	0
PRT	tr|H3BLP7|H3BLP7_MOUSE	Isoform of P61979, Heterogeneous nuclear ribonucleoprotein K (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpk PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	13-UNIMOD:21	0.07	14.0	1	1	1
PRT	tr|E9Q449|E9Q449_MOUSE	Isoform of A6H8H2, DENN domain-containing protein 4C OS=Mus musculus (Mouse) OX=10090 GN=Dennd4c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	1106-UNIMOD:21	0.01	14.0	1	1	1
PRT	tr|A0A0N5E9G7|A0A0N5E9G7_MOUSE	Isoform of P35601, Replication factor C subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Rfc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	155-UNIMOD:21	0.02	14.0	1	1	1
PRT	tr|F6SLJ2|F6SLJ2_MOUSE	Isoform of Q9JLQ2, ARF GTPase-activating protein GIT2 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Git2 PE=1 SV=8	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	78-UNIMOD:21	0.09	14.0	1	1	0
PRT	sp|E9Q7F2|RN169_MOUSE	E3 ubiquitin-protein ligase RNF169 OS=Mus musculus (Mouse) OX=10090 GN=Rnf169 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	679-UNIMOD:21,390-UNIMOD:21	0.03	14.0	2	2	2
PRT	sp|Q9CZ44-2|NSF1C-2_MOUSE	Isoform of Q9CZ44, Isoform 2 of NSFL1 cofactor p47 OS=Mus musculus (Mouse) OX=10090 GN=Nsfl1c PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	178-UNIMOD:21	0.05	14.0	1	1	1
PRT	tr|A3KGH5|A3KGH5_MOUSE	Isoform of Q3UJU9, Regulator of microtubule dynamics protein 3 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Rmdn3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	46-UNIMOD:21	0.28	14.0	1	1	1
PRT	sp|P40201|CHD1_MOUSE	Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Chd1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null	1688-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|P16381|DDX3L_MOUSE	Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus (Mouse) OX=10090 GN=D1Pas1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.02	14.0	1	1	1
PRT	sp|Q9R1T2-2|SAE1-2_MOUSE	Isoform of Q9R1T2, Isoform 2 of SUMO-activating enzyme subunit 1 OS=Mus musculus (Mouse) OX=10090 GN=Sae1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	null		0.08	14.0	1	1	1
PRT	sp|Q8BSQ9|PB1_MOUSE	Protein polybromo-1 OS=Mus musculus (Mouse) OX=10090 GN=Pbrm1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	12-UNIMOD:21	0.02	14.0	1	1	0
PRT	sp|Q8CHI8|EP400_MOUSE	E1A-binding protein p400 OS=Mus musculus (Mouse) OX=10090 GN=Ep400 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	922-UNIMOD:21	0.01	14.0	1	1	0
PRT	sp|Q80YV2|NIPA_MOUSE	Nuclear-interacting partner of ALK OS=Mus musculus (Mouse) OX=10090 GN=Zc3hc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	334-UNIMOD:21	0.05	14.0	1	1	1
PRT	sp|P59997|KDM2A_MOUSE	Lysine-specific demethylase 2A OS=Mus musculus (Mouse) OX=10090 GN=Kdm2a PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	840-UNIMOD:4,868-UNIMOD:21	0.04	14.0	1	1	1
PRT	sp|Q3UL36|ARGL1_MOUSE	Arginine and glutamate-rich protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Arglu1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	75-UNIMOD:21	0.06	14.0	2	2	0
PRT	sp|P06800|PTPRC_MOUSE	Receptor-type tyrosine-protein phosphatase C OS=Mus musculus (Mouse) OX=10090 GN=Ptprc PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	964-UNIMOD:21	0.01	14.0	1	1	0
PRT	sp|P70333|HNRH2_MOUSE	Heterogeneous nuclear ribonucleoprotein H2 OS=Mus musculus (Mouse) OX=10090 GN=Hnrnph2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	90-UNIMOD:21	0.06	14.0	1	1	1
PRT	sp|Q08024|PEBB_MOUSE	Core-binding factor subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Cbfb PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	173-UNIMOD:21	0.11	14.0	1	1	0
PRT	sp|Q9Z2A0|PDPK1_MOUSE	3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus (Mouse) OX=10090 GN=Pdpk1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	244-UNIMOD:21	0.04	14.0	1	1	0
PRT	sp|Q6P9R4|ARHGI_MOUSE	Rho guanine nucleotide exchange factor 18 OS=Mus musculus (Mouse) OX=10090 GN=Arhgef18 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	133-UNIMOD:21,144-UNIMOD:4	0.01	14.0	1	1	0
PRT	sp|P53564|CUX1_MOUSE	Homeobox protein cut-like 1 OS=Mus musculus (Mouse) OX=10090 GN=Cux1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	1328-UNIMOD:21,1333-UNIMOD:4	0.02	14.0	1	1	1
PRT	sp|Q9WVA4|TAGL2_MOUSE	Transgelin-2 OS=Mus musculus (Mouse) OX=10090 GN=Tagln2 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.12	14.0	1	1	1
PRT	sp|Q8K1I7|WIPF1_MOUSE	WAS/WASL-interacting protein family member 1 OS=Mus musculus (Mouse) OX=10090 GN=Wipf1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	330-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q8BJ71|NUP93_MOUSE	Nuclear pore complex protein Nup93 OS=Mus musculus (Mouse) OX=10090 GN=Nup93 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	55-UNIMOD:21	0.03	14.0	1	1	1
PRT	tr|Q3UHC1|Q3UHC1_MOUSE	Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus (Mouse) OX=10090 GN=Rapgef1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	311-UNIMOD:21	0.01	14.0	1	1	1
PRT	sp|Q9D0E1|HNRPM_MOUSE	Heterogeneous nuclear ribonucleoprotein M OS=Mus musculus (Mouse) OX=10090 GN=Hnrnpm PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	524-UNIMOD:35,527-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q76N33|STALP_MOUSE	AMSH-like protease OS=Mus musculus (Mouse) OX=10090 GN=Stambpl1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	242-UNIMOD:21	0.06	14.0	1	1	0
PRT	sp|P97452|BOP1_MOUSE	Ribosome biogenesis protein BOP1 OS=Mus musculus (Mouse) OX=10090 GN=Bop1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null	2-UNIMOD:1,5-UNIMOD:4,11-UNIMOD:21	0.03	14.0	1	1	1
PRT	tr|A0A140T8T4|A0A140T8T4_MOUSE	Ribosomal protein L9, pseudogene 6 OS=Mus musculus (Mouse) OX=10090 GN=Rpl9-ps6 PE=4 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.10	14.0	1	1	0
PRT	sp|Q62445|SP4_MOUSE	Transcription factor Sp4 OS=Mus musculus (Mouse) OX=10090 GN=Sp4 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	768-UNIMOD:21	0.03	14.0	1	1	1
PRT	sp|Q80X32|CE024_MOUSE	UPF0461 protein C5orf24 homolog OS=Mus musculus (Mouse) OX=10090 GN=MGI:1925771 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	187-UNIMOD:21	0.10	14.0	1	1	1
PRT	sp|Q8C5T4|MORN3_MOUSE	MORN repeat-containing protein 3 OS=Mus musculus (Mouse) OX=10090 GN=Morn3 PE=2 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	null		0.05	14.0	1	1	1
PRT	sp|P84104|SRSF3_MOUSE	Serine/arginine-rich splicing factor 3 OS=Mus musculus (Mouse) OX=10090 GN=Srsf3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null		0.11	14.0	1	1	1
PRT	sp|E9Q5C9|NOLC1_MOUSE	Nucleolar and coiled-body phosphoprotein 1 OS=Mus musculus (Mouse) OX=10090 GN=Nolc1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	null	701-UNIMOD:21	0.03	14.0	1	1	0
PRT	sp|Q7TNC4-2|LC7L2-2_MOUSE	Isoform of Q7TNC4, Isoform 2 of Putative RNA-binding protein Luc7-like 2 OS=Mus musculus (Mouse) OX=10090 GN=Luc7l2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	17-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|P10126|EF1A1_MOUSE	Elongation factor 1-alpha 1 OS=Mus musculus (Mouse) OX=10090 GN=Eef1a1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null		0.03	13.0	1	1	1
PRT	sp|Q60737|CSK21_MOUSE	Casein kinase II subunit alpha OS=Mus musculus (Mouse) OX=10090 GN=Csnk2a1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null		0.04	13.0	1	1	1
PRT	sp|Q4VA53-2|PDS5B-2_MOUSE	Isoform of Q4VA53, Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus (Mouse) OX=10090 GN=Pds5b PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	647-UNIMOD:21	0.04	13.0	1	1	1
PRT	sp|Q61216-2|MRE11-2_MOUSE	Isoform of Q61216, Isoform 2 of Double-strand break repair protein MRE11 OS=Mus musculus (Mouse) OX=10090 GN=Mre11 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	659-UNIMOD:21,673-UNIMOD:4	0.04	13.0	1	1	0
PRT	tr|A0A0G2JES3|A0A0G2JES3_MOUSE	Isoform of P51410, 60S ribosomal protein L9 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Rpl9 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null		0.10	13.0	1	1	0
PRT	sp|Q99M28-2|RNPS1-2_MOUSE	Isoform of Q99M28, Isoform 2 of RNA-binding protein with serine-rich domain 1 OS=Mus musculus (Mouse) OX=10090 GN=Rnps1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	243-UNIMOD:21	0.05	13.0	1	1	1
PRT	tr|A0A1L1SUX8|A0A1L1SUX8_MOUSE	Isoform of P01831, Ig-like domain-containing protein (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Thy1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null		0.14	13.0	1	1	1
PRT	sp|Q9ESX5|DKC1_MOUSE	H/ACA ribonucleoprotein complex subunit DKC1 OS=Mus musculus (Mouse) OX=10090 GN=Dkc1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	508-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q8CEC0-3|NUP88-3_MOUSE	Isoform of Q8CEC0, Isoform 3 of Nuclear pore complex protein Nup88 OS=Mus musculus (Mouse) OX=10090 GN=Nup88 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	null	699-UNIMOD:21	0.02	13.0	1	1	0
PRT	sp|Q03267|IKZF1_MOUSE	DNA-binding protein Ikaros OS=Mus musculus (Mouse) OX=10090 GN=Ikzf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	440-UNIMOD:21	0.05	13.0	1	1	0
PRT	sp|Q60611|SATB1_MOUSE	DNA-binding protein SATB1 OS=Mus musculus (Mouse) OX=10090 GN=Satb1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	284-UNIMOD:21	0.07	13.0	1	1	1
PRT	sp|Q3UZA1|CPZIP_MOUSE	CapZ-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=Rcsd1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	120-UNIMOD:21	0.05	13.0	1	1	1
PRT	sp|Q99JF8|PSIP1_MOUSE	PC4 and SFRS1-interacting protein OS=Mus musculus (Mouse) OX=10090 GN=Psip1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	176-UNIMOD:21	0.05	13.0	2	1	0
PRT	sp|Q9DCB4|ARP21_MOUSE	cAMP-regulated phosphoprotein 21 OS=Mus musculus (Mouse) OX=10090 GN=Arpp21 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	381-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q0VBL3|RBM15_MOUSE	RNA-binding protein 15 OS=Mus musculus (Mouse) OX=10090 GN=Rbm15 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	293-UNIMOD:21	0.02	13.0	1	1	0
PRT	sp|Q80U16|RIPR2_MOUSE	Rho family-interacting cell polarization regulator 2 OS=Mus musculus (Mouse) OX=10090 GN=Ripor2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	46-UNIMOD:21	0.01	13.0	1	1	0
PRT	sp|Q8C079|STRP1_MOUSE	Striatin-interacting protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Strip1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	335-UNIMOD:21	0.02	13.0	1	1	0
PRT	sp|Q9D4J7|PHF6_MOUSE	PHD finger protein 6 OS=Mus musculus (Mouse) OX=10090 GN=Phf6 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	154-UNIMOD:21	0.07	13.0	1	1	0
PRT	sp|Q9CSN1|SNW1_MOUSE	SNW domain-containing protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Snw1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	224-UNIMOD:21	0.03	13.0	2	1	0
PRT	sp|P54276|MSH6_MOUSE	DNA mismatch repair protein Msh6 OS=Mus musculus (Mouse) OX=10090 GN=Msh6 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	137-UNIMOD:21	0.01	13.0	1	1	0
PRT	sp|Q6IRU2|TPM4_MOUSE	Tropomyosin alpha-4 chain OS=Mus musculus (Mouse) OX=10090 GN=Tpm4 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.06	13.0	1	1	0
PRT	sp|Q68FF6|GIT1_MOUSE	ARF GTPase-activating protein GIT1 OS=Mus musculus (Mouse) OX=10090 GN=Git1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	419-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q9JL26|FMNL1_MOUSE	Formin-like protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Fmnl1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	184-UNIMOD:21	0.02	13.0	1	1	0
PRT	sp|Q91V92|ACLY_MOUSE	ATP-citrate synthase OS=Mus musculus (Mouse) OX=10090 GN=Acly PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	455-UNIMOD:21	0.02	13.0	1	1	0
PRT	tr|A0A0G2JE55|A0A0G2JE55_MOUSE	Isoform of Q91WJ8, Far upstream element-binding protein 1 (Fragment) OS=Mus musculus (Mouse) OX=10090 GN=Fubp1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	128-UNIMOD:21	0.18	13.0	1	1	1
PRT	tr|E9PVA6|E9PVA6_MOUSE	Isoform of Q9JLQ2, ARF GTPase-activating protein GIT2 OS=Mus musculus (Mouse) OX=10090 GN=Git2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	421-UNIMOD:21	0.03	13.0	1	1	0
PRT	sp|P97492|RGS14_MOUSE	Regulator of G-protein signaling 14 OS=Mus musculus (Mouse) OX=10090 GN=Rgs14 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	183-UNIMOD:4,203-UNIMOD:21	0.06	13.0	1	1	1
PRT	sp|Q7TN58|TMC8_MOUSE	Transmembrane channel-like protein 8 OS=Mus musculus (Mouse) OX=10090 GN=Tmc8 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	700-UNIMOD:21,701-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q62187|TTF1_MOUSE	Transcription termination factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Ttf1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	451-UNIMOD:21,457-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q60520|SIN3A_MOUSE	Paired amphipathic helix protein Sin3a OS=Mus musculus (Mouse) OX=10090 GN=Sin3a PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	1111-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q91VM5|RMXL1_MOUSE	RNA binding motif protein, X-linked-like-1 OS=Mus musculus (Mouse) OX=10090 GN=Rbmxl1 PE=2 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	205-UNIMOD:21	0.05	13.0	1	1	0
PRT	sp|Q80U70|SUZ12_MOUSE	Polycomb protein Suz12 OS=Mus musculus (Mouse) OX=10090 GN=Suz12 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	548-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|P70399|TP53B_MOUSE	TP53-binding protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Tp53bp1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	267-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q920Q8|NS1BP_MOUSE	Influenza virus NS1A-binding protein homolog OS=Mus musculus (Mouse) OX=10090 GN=Ivns1abp PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	338-UNIMOD:21	0.04	13.0	1	1	1
PRT	tr|Q8BG13|Q8BG13_MOUSE	Isoform of O89086, RRM domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Rbm3 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null		0.13	13.0	1	1	1
PRT	sp|Q61206|PA1B2_MOUSE	Platelet-activating factor acetylhydrolase IB subunit beta OS=Mus musculus (Mouse) OX=10090 GN=Pafah1b2 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,2-UNIMOD:21	0.13	13.0	1	1	1
PRT	sp|Q6PHZ5|RB15B_MOUSE	Putative RNA-binding protein 15B OS=Mus musculus (Mouse) OX=10090 GN=Rbm15b PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	263-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q9JIK5|DDX21_MOUSE	Nucleolar RNA helicase 2 OS=Mus musculus (Mouse) OX=10090 GN=Ddx21 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	118-UNIMOD:21	0.03	13.0	1	1	1
PRT	sp|Q91W39|NCOA5_MOUSE	Nuclear receptor coactivator 5 OS=Mus musculus (Mouse) OX=10090 GN=Ncoa5 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	126-UNIMOD:21,137-UNIMOD:4	0.03	13.0	1	1	1
PRT	sp|P51163|HEM4_MOUSE	Uroporphyrinogen-III synthase OS=Mus musculus (Mouse) OX=10090 GN=Uros PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	164-UNIMOD:21	0.10	13.0	1	1	1
PRT	sp|Q8K4P0|WDR33_MOUSE	pre-mRNA 3' end processing protein WDR33 OS=Mus musculus (Mouse) OX=10090 GN=Wdr33 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	null	2-UNIMOD:1,7-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|Q6A0D4|RFTN1_MOUSE	Raftlin OS=Mus musculus (Mouse) OX=10090 GN=Rftn1 PE=1 SV=4	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	174-UNIMOD:21	0.04	13.0	1	1	1
PRT	tr|E9PUF7|E9PUF7_MOUSE	Isoform of Q61210, Rho guanine nucleotide exchange factor 1 OS=Mus musculus (Mouse) OX=10090 GN=Arhgef1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	383-UNIMOD:21	0.01	13.0	1	1	1
PRT	sp|O88307|SORL_MOUSE	Sortilin-related receptor OS=Mus musculus (Mouse) OX=10090 GN=Sorl1 PE=1 SV=3	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	992-UNIMOD:21,1005-UNIMOD:35	0.01	13.0	1	1	1
PRT	sp|Q80X19|COEA1_MOUSE	Collagen alpha-1(XIV) chain OS=Mus musculus (Mouse) OX=10090 GN=Col14a1 PE=1 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	849-UNIMOD:21,854-UNIMOD:21	0.01	13.0	1	1	1
PRT	tr|A0A140LHH9|A0A140LHH9_MOUSE	WD_REPEATS_REGION domain-containing protein OS=Mus musculus (Mouse) OX=10090 GN=Gm35339 PE=4 SV=2	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	792-UNIMOD:21,798-UNIMOD:21	0.02	13.0	1	1	1
PRT	sp|Q8BIZ6|SNIP1_MOUSE	Smad nuclear-interacting protein 1 OS=Mus musculus (Mouse) OX=10090 GN=Snip1 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	383-UNIMOD:21	0.08	13.0	1	1	1
PRT	sp|E9Q1P8|I2BP2_MOUSE	Interferon regulatory factor 2-binding protein 2 OS=Mus musculus (Mouse) OX=10090 GN=Irf2bp2 PE=1 SV=1	null	null	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	null	169-UNIMOD:21	0.08	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	84.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20678	65.128572	4	4270.8681	4270.8667	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	2	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	83.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=18310	58.079	4	4287.8937	4287.8937	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	3	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	79.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=18244	57.908	4	4287.8937	4287.8937	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	4	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	78.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=19673	62.192	4	4131.7926	4131.7926	K	R	104	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	5	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	78.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20614	64.951238	4	4270.8681	4270.8667	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	6	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	73.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=19740	62.365	4	4131.7926	4131.7926	K	R	104	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	7	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	71.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22320	70.241001	4	4114.7674	4114.7655	K	R	104	142
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	8	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	68.0	25-UNIMOD:21	ms_run[1]:scan=26410	84.825333	4	3734.886353	3734.884195	R	M	46	81
PSM	KKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	9	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	68.0		ms_run[1]:scan=10315	35.33578	3	4005.326148	4005.321784	K	-	184	216
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	10	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	67.0	1-UNIMOD:21	ms_run[2]:scan=22856	72.204	4	4195.8998	4195.8998	R	D	224	260
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	11	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	67.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20729	65.297657	4	4270.8681	4270.8667	K	S	104	143
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	12	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	11-UNIMOD:21	ms_run[2]:scan=12609	41.783	3	3097.2826	3097.2826	R	K	9	36
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	13	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	64.0	3-UNIMOD:21	ms_run[2]:scan=22905	72.379	4	4195.8998	4195.8998	R	D	224	260
PSM	KKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	14	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	64.0		ms_run[1]:scan=10384	35.509847	3	4005.326148	4005.321784	K	-	184	216
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	15	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	63.0	18-UNIMOD:21	ms_run[2]:scan=16191	52.27	3	3275.3151	3275.3151	K	L	145	174
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	16	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	63.0	25-UNIMOD:21	ms_run[1]:scan=26460	84.996819	4	3734.886353	3734.884195	R	M	46	81
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	17	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	62.0	11-UNIMOD:21	ms_run[2]:scan=12548	41.612	3	3097.2826	3097.2826	R	K	9	36
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	18	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	61.0	25-UNIMOD:21	ms_run[1]:scan=26513	85.167023	4	3734.886353	3734.884195	R	M	46	81
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	19	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	13-UNIMOD:21	ms_run[2]:scan=17589	56.125	3	3005.4231	3005.4231	K	S	157	186
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	20	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	60.0	13-UNIMOD:21	ms_run[2]:scan=17660	56.298	3	3005.4231	3005.4231	K	S	157	186
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	21	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	60.0		ms_run[1]:scan=10343	35.410915	3	3526.258953	3526.255817	K	-	183	211
PSM	SVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKR	22	sp|P09405|NUCL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	60.0		ms_run[1]:scan=11398	38.335657	4	5255.9161	5255.9104	K	K	238	283
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	23	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	59.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22275	70.07303	4	4114.7674	4114.7655	K	R	104	142
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	24	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	59.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21296	67.048998	4	3913.649000	3913.648853	R	I	245	277
PSM	SVAEEEDDEEEDEDDEDEDDEEEDDEDDDEEEEEEEPVKAAPGKR	25	sp|P09405|NUCL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	59.0		ms_run[1]:scan=11342	38.163352	4	5255.9161	5255.9104	K	K	238	283
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	26	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	3-UNIMOD:21	ms_run[2]:scan=7922	28.432	4	3400.4593	3400.4593	R	G	575	609
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	27	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	3-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=25998	83.504	3	3763.7863	3763.7863	R	V	592	630
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	28	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	9-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=26051	83.675	3	3763.7863	3763.7863	R	V	592	630
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	29	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	58.0	1-UNIMOD:21	ms_run[2]:scan=22806	72.033	4	4195.8998	4195.8998	R	D	224	260
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	30	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	58.0		ms_run[1]:scan=10122	34.887199	3	3526.258953	3526.255817	K	-	183	211
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	31	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	58.0		ms_run[1]:scan=10413	35.584899	3	3526.258953	3526.255817	K	-	183	211
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	32	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	58.0		ms_run[1]:scan=10475	35.754917	3	3526.258953	3526.255817	K	-	183	211
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	33	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	16-UNIMOD:21	ms_run[2]:scan=15388	50.236	3	3164.2884	3164.2884	R	M	429	456
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	34	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	57.0	3-UNIMOD:21	ms_run[2]:scan=7860	28.261	4	3400.4593	3400.4593	R	G	575	609
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	35	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	57.0		ms_run[1]:scan=10199	35.063315	3	3526.258953	3526.255817	K	-	183	211
PSM	SASPDDDLGSSNWEAADLGNEERKQK	36	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	3-UNIMOD:21	ms_run[2]:scan=14579	47.909	3	2898.2305	2898.2305	R	F	15	41
PSM	SASPDDDLGSSNWEAADLGNEERKQK	37	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	56.0	3-UNIMOD:21	ms_run[2]:scan=14639	48.077	3	2898.2305	2898.2305	R	F	15	41
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	38	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	56.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21165	66.704736	4	3913.649000	3913.648853	R	I	245	277
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	39	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	56.0		ms_run[1]:scan=10274	35.237272	3	3526.258953	3526.255817	K	-	183	211
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	40	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	56.0		ms_run[1]:scan=10055	34.712246	3	3526.258953	3526.255817	K	-	183	211
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	41	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=19802	62.536	4	4131.7926	4131.7926	K	R	104	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	42	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=18372	58.252	4	4287.8937	4287.8937	K	S	104	143
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	43	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	55.0	16-UNIMOD:21	ms_run[2]:scan=15395	50.252	4	3164.2884	3164.2884	R	M	429	456
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	44	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	55.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20781	65.470556	4	4270.8681	4270.8667	K	S	104	143
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	45	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	18-UNIMOD:21	ms_run[2]:scan=16134	52.129	4	3275.3151	3275.3151	K	L	145	174
PSM	LGEESKEPLSDEDEEDNDDVEPISEFR	46	tr|Q923F1|Q923F1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	10-UNIMOD:21	ms_run[2]:scan=19537	61.829	3	3201.3035	3201.3035	K	F	91	118
PSM	SLAALDALNTDDENDEEEYEAWKVR	47	sp|C0HKD9|MFA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	54.0	10-UNIMOD:21	ms_run[2]:scan=23145	73.2	3	2975.271	2975.2710	R	E	258	283
PSM	HQGVMVGMGQKDSYVGDEAQSKR	48	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	54.0		ms_run[1]:scan=6531	24.700428	4	2506.169141	2506.169291	R	G	40	63
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	49	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	13-UNIMOD:21	ms_run[2]:scan=17529	55.953	3	3005.4231	3005.4231	K	S	157	186
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	50	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	11-UNIMOD:21	ms_run[2]:scan=12665	41.952	3	3097.2826	3097.2826	R	K	9	36
PSM	LGEESKEPLSDEDEEDNDDVEPISEFR	51	tr|Q923F1|Q923F1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	53.0	10-UNIMOD:21	ms_run[2]:scan=19472	61.652	3	3201.3035	3201.3035	K	F	91	118
PSM	HQGVMVGMGQKDSYVGDEAQSKR	52	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	53.0		ms_run[1]:scan=6594	24.8729	4	2506.169141	2506.169291	R	G	40	63
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	53	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	53.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21374	67.222918	4	3913.649000	3913.648853	R	I	245	277
PSM	KKVEEEEEEEEEEEEEEEEEEDE	54	sp|O54879|HMGB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	53.0		ms_run[1]:scan=9811	33.880757	3	2940.107046	2940.105117	R	-	178	201
PSM	AAAVLSGASAGSPAGAPGGPGGLSAVGSGPR	55	sp|Q9DBD5|PELP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	53.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=24106	76.458697	3	2625.2554	2625.2543	M	L	2	33
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	56	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	16-UNIMOD:21	ms_run[2]:scan=15463	50.421	4	3164.2884	3164.2884	R	M	429	456
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	57	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	52.0	10-UNIMOD:21	ms_run[2]:scan=12268	40.914	3	3097.2826	3097.2826	K	I	10	37
PSM	KKVEEEEEEEEEEEEEEEEEEDE	58	sp|O54879|HMGB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=9861	34.052152	3	2940.107046	2940.105117	R	-	178	201
PSM	KKVEEEEEEEEEEEEEEEEEEDE	59	sp|O54879|HMGB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=9764	33.71075	3	2940.107046	2940.105117	R	-	178	201
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	60	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:21	ms_run[2]:scan=5204	20.479	4	2984.2846	2984.2846	R	R	198	233
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	61	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	18-UNIMOD:21	ms_run[2]:scan=16204	52.302	4	3275.3151	3275.3151	K	L	145	174
PSM	RAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	62	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	4-UNIMOD:21	ms_run[2]:scan=3681	15.864	4	3140.3857	3140.3857	K	R	197	233
PSM	SASPDDDLGSSNWEAADLGNEERKQK	63	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	3-UNIMOD:21	ms_run[2]:scan=14514	47.738	3	2898.2305	2898.2305	R	F	15	41
PSM	SLAALDALNTDDENDEEEYEAWKVR	64	sp|C0HKD9|MFA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	10-UNIMOD:21	ms_run[2]:scan=23088	73.028	3	2975.271	2975.2710	R	E	258	283
PSM	VVDYSQFQESDDADEDYGRDSGPPAK	65	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	51.0	10-UNIMOD:21	ms_run[2]:scan=14537	47.793	3	2969.1876	2969.1876	K	K	10	36
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	66	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20837	65.645169	4	4270.8681	4270.8667	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	67	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,35-UNIMOD:35	ms_run[1]:scan=19528	61.809822	4	4286.8630	4286.8616	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	68	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22368	70.415577	4	4114.7674	4114.7655	K	R	104	142
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	69	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	51.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21227	66.875428	4	3913.649000	3913.648853	R	I	245	277
PSM	VVDYSQFQESDDADEDYGRDSGPPAK	70	sp|Q80XU3|NUCKS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	51.0	10-UNIMOD:21	ms_run[1]:scan=14602	47.965171	3	2969.188944	2969.187637	K	K	10	36
PSM	AADVSVTHRPPLSPEAEAEAETPETVDR	71	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	51.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=17452	55.729105	3	3095.4095	3095.4079	M	R	2	30
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	72	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	3-UNIMOD:21	ms_run[2]:scan=5135	20.304	4	2984.2846	2984.2846	R	R	198	233
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	73	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	18-UNIMOD:21	ms_run[2]:scan=16119	52.094	3	3275.3151	3275.3151	K	L	145	174
PSM	HQGVMVGMGQKDSYVGDEAQSKR	74	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	5-UNIMOD:35	ms_run[2]:scan=5272	20.69	4	2522.1642	2522.1642	R	G	40	63
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	75	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	50.0	11-UNIMOD:21	ms_run[2]:scan=12594	41.744	4	3097.2826	3097.2826	R	K	9	36
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	76	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	50.0	25-UNIMOD:21	ms_run[1]:scan=26360	84.655369	4	3734.886353	3734.884195	R	M	46	81
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	77	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	11-UNIMOD:21	ms_run[2]:scan=12532	41.57	4	3097.2826	3097.2826	R	K	9	36
PSM	NLSFNITEDELKEVFEDAMEIR	78	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21	ms_run[2]:scan=36299	105.55	3	2721.2245	2721.2245	K	L	401	423
PSM	NRGLKEGINPGYDDYADSDEDQHDAYLER	79	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	18-UNIMOD:21	ms_run[2]:scan=13509	44.642	4	3434.4325	3434.4325	K	M	427	456
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	80	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:21	ms_run[2]:scan=22949	72.547	4	4195.8998	4195.8998	R	D	224	260
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	81	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20551	64.774939	4	4270.8681	4270.8667	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	82	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	49.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20492	64.600378	4	4270.8698	4270.8667	K	S	104	143
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	83	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	49.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20955	66.020279	4	3913.649129	3913.648853	R	I	245	277
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	84	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	49.0		ms_run[1]:scan=10540	35.923266	3	3526.258953	3526.255817	K	-	183	211
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	85	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	48.0	16-UNIMOD:21	ms_run[2]:scan=15460	50.414	3	3164.2884	3164.2884	R	M	429	456
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	86	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	48.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21453	67.400046	4	3913.649000	3913.648853	R	I	245	277
PSM	LAEEEDLFESCGHPEEEEEEEEEDQEEEQEEEGDLALASSSKSESPSTR	87	sp|D3YXK2|SAFB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	11-UNIMOD:4,45-UNIMOD:21	ms_run[1]:scan=21272	66.990127	4	5692.2540	5692.2482	K	C	254	303
PSM	AADVSVTHRPPLSPEAEAEAETPETVDR	88	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	48.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=17511	55.903387	3	3095.4095	3095.4079	M	R	2	30
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	89	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	3-UNIMOD:21	ms_run[2]:scan=7792	28.087	4	3400.4593	3400.4593	R	G	575	609
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	90	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	11-UNIMOD:21	ms_run[2]:scan=12654	41.918	4	3097.2826	3097.2826	R	K	9	36
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	91	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	11-UNIMOD:21	ms_run[2]:scan=12482	41.436	3	3097.2826	3097.2826	R	K	9	36
PSM	LIHTLDDRTQLWASEPGTPPVPTSLPSQNPILK	92	tr|A0A0G2JDF8|A0A0G2JDF8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	18-UNIMOD:21	ms_run[2]:scan=22748	71.829	4	3700.8866	3700.8866	K	N	168	201
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	93	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	10-UNIMOD:21	ms_run[2]:scan=12192	40.716	4	3097.2826	3097.2826	K	I	10	37
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	94	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	10-UNIMOD:21	ms_run[2]:scan=12399	41.228	4	3097.2826	3097.2826	K	I	10	37
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	95	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	47.0	10-UNIMOD:21	ms_run[2]:scan=12200	40.738	3	3097.2826	3097.2826	K	I	10	37
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	96	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47.0	25-UNIMOD:21	ms_run[1]:scan=26567	85.338696	4	3734.886353	3734.884195	R	M	46	81
PSM	HQGVMVGMGQKDSYVGDEAQSKR	97	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3645	15.739789	4	2538.158206	2538.159121	R	G	40	63
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	98	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21111	66.532326	4	3913.649000	3913.648853	R	I	245	277
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	99	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47.0	8-UNIMOD:21	ms_run[1]:scan=24650	78.535961	3	2990.324089	2990.322280	K	T	1561	1587
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	100	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	47.0	8-UNIMOD:21	ms_run[1]:scan=24564	78.196709	3	2990.324089	2990.322280	K	T	1561	1587
PSM	ASGVAVSDGVIKVFNDMKVR	101	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26272	84.391	3	2213.0915	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	102	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29261	91.766711	2	1957.9219	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	103	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29192	91.597048	2	1957.9219	1957.9215	M	V	2	20
PSM	SGEDEQQEQTIAEDLVVTKYK	104	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23405	73.868848	3	2531.1323	2531.1311	M	M	2	23
PSM	SGEDEQQEQTIAEDLVVTKYK	105	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	47.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23342	73.695039	3	2531.1323	2531.1311	M	M	2	23
PSM	RGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	106	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=23557	74.412	4	3944.6837	3944.6837	R	V	192	225
PSM	RGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	107	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=23600	74.584	4	3944.6837	3944.6837	R	V	192	225
PSM	VVDYSQFQESDDADEDYGRDSGPPAK	108	sp|Q80XU3|NUCKS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	46.0	10-UNIMOD:21	ms_run[1]:scan=14466	47.615775	3	2969.188944	2969.187637	K	K	10	36
PSM	KKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	109	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	46.0		ms_run[1]:scan=10449	35.681111	3	4005.326148	4005.321784	K	-	184	216
PSM	ASGVAVSDGVIKVFNDMK	110	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29127	91.422622	2	1957.9219	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMKVR	111	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26237	84.282161	2	2213.0926	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	112	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26215	84.221516	3	2213.0915	2213.0910	M	K	2	22
PSM	SGEDEQQEQTIAEDLVVTKYK	113	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23271	73.520944	3	2531.1323	2531.1311	M	M	2	23
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	114	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	9-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=26101	83.844	3	3763.7863	3763.7863	R	V	592	630
PSM	LGEESKEPLSDEDEEDNDDVEPISEFR	115	tr|Q923F1|Q923F1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=19600	62.003	3	3201.3035	3201.3035	K	F	91	118
PSM	SAEPLANTVLASETEEEGNAQALGPTAK	116	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:21	ms_run[2]:scan=20253	63.857	3	2877.3281	2877.3281	K	S	158	186
PSM	SASPDDDLGSSNWEAADLGNEER	117	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	3-UNIMOD:21	ms_run[2]:scan=20297	63.978	2	2513.982	2513.9820	R	K	15	38
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	118	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=12256	40.886	4	3097.2826	3097.2826	K	I	10	37
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	119	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	45.0	10-UNIMOD:21	ms_run[2]:scan=12328	41.053	4	3097.2826	3097.2826	K	I	10	37
PSM	SETAPVAQAASTATEKPAAAKK	120	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10590	36.040617	3	2249.0943	2249.0935	M	T	2	24
PSM	SETAPVAQAASTATEKPAAAKK	121	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10516	35.868866	3	2249.0943	2249.0935	M	T	2	24
PSM	ASGVAVSDGVIKVFNDMKVR	122	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26159	84.048302	3	2213.0915	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	123	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24334	77.305606	3	2213.0913	2213.0910	M	K	2	22
PSM	SGEDEQQEQTIAEDLVVTKYK	124	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	45.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23361	73.737588	2	2531.1324	2531.1311	M	M	2	23
PSM	RQEAQQREVDQDDEENSEEDEMDSGTMVR	125	tr|F7BYZ4|F7BYZ4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	17-UNIMOD:21	ms_run[2]:scan=10224	35.117	4	3534.3784	3534.3784	K	A	20	49
PSM	SLAALDALNTDDENDEEEYEAWKVR	126	sp|C0HKD9|MFA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	44.0	10-UNIMOD:21	ms_run[2]:scan=23210	73.373	3	2975.271	2975.2710	R	E	258	283
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	127	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20440	64.432037	4	4270.8698	4270.8667	K	S	104	143
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	128	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44.0	8-UNIMOD:21	ms_run[1]:scan=24606	78.366047	3	2990.324089	2990.322280	K	T	1561	1587
PSM	SGEDEQQEQTIAEDLVVTKYK	129	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	44.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23457	74.040684	3	2531.1323	2531.1311	M	M	2	23
PSM	KKVEEEEEEEEEEEEEEEEEEDE	130	sp|O54879|HMGB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=9911	34.22403	3	2940.107046	2940.105117	R	-	178	201
PSM	HQGVMVGMGQKDSYVGDEAQSKR	131	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	5-UNIMOD:35	ms_run[2]:scan=5328	20.864	4	2522.1642	2522.1642	R	G	40	63
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	132	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=26054	83.682	4	3763.7863	3763.7863	R	V	592	630
PSM	LCDFGSASHVADNDITPYLVSR	133	sp|Q61136|PRP4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	2-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=19972	63.029	3	2516.1043	2516.1043	K	F	832	854
PSM	QVDTEEAGMVTAATASNVKASPK	134	tr|A2BI12|A2BI12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	21-UNIMOD:21	ms_run[2]:scan=13552	44.824	3	2384.0931	2384.0931	K	R	156	179
PSM	RAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	135	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	4-UNIMOD:21	ms_run[2]:scan=3632	15.692	4	3140.3857	3140.3857	K	R	197	233
PSM	SASPDDDLGSSNWEAADLGNEER	136	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	43.0	3-UNIMOD:21	ms_run[2]:scan=20353	64.144	2	2513.982	2513.9820	R	K	15	38
PSM	HAVSEGTKAVTKYTSSK	137	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=3131	13.877694	4	1792.931512	1792.931927	K	-	110	127
PSM	HAVSEGTKAVTKYTSSK	138	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=3177	14.046187	4	1792.931512	1792.931927	K	-	110	127
PSM	KKVEEEEEEEEEEEEEEEEEEDE	139	sp|O54879|HMGB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=9718	33.540366	3	2940.107046	2940.105117	R	-	178	201
PSM	HAVSEGTKAVTKYTSSK	140	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=3171	14.028	3	1792.9319	1792.9319	K	-	110	127
PSM	HAVSEGTKAVTKYTSSK	141	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=3220	14.201	3	1792.9319	1792.9319	K	-	110	127
PSM	HLQLAIRNDEELNKLLGR	142	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17061	54.57	3	2131.1862	2131.1862	R	V	83	101
PSM	LKGQEDSLASAVDATTGQEACDSD	143	sp|Q8R344|CCD12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=18781	59.554	2	2547.032	2547.0320	R	-	143	167
PSM	NRGLKEGINPGYDDYADSDEDQHDAYLER	144	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	18-UNIMOD:21	ms_run[2]:scan=13469	44.468	4	3434.4325	3434.4325	K	M	427	456
PSM	RASVCAEAYNPDEEEDDAESRIIHPK	145	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=13806	45.705	4	3080.3183	3080.3183	R	T	110	136
PSM	RGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	146	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=23512	74.243	4	3944.6837	3944.6837	R	V	192	225
PSM	SASPDDDLGSSNWEAADLGNEERKQK	147	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:21	ms_run[2]:scan=14542	47.804	4	2898.2305	2898.2305	R	F	15	41
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	148	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21007	66.189164	4	3913.649129	3913.648853	R	I	245	277
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	149	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	42.0	8-UNIMOD:21	ms_run[1]:scan=24695	78.706081	3	2990.324089	2990.322280	K	T	1561	1587
PSM	ASGVAVSDGVIKVFNDMKVR	150	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	42.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26330	84.567024	3	2213.0915	2213.0910	M	K	2	22
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	151	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=20562	64.804	4	3913.6489	3913.6489	R	I	245	277
PSM	ILDEIEEHSIKIYHLPDAESDEDEDFKEQTR	152	tr|E9Q3V6|E9Q3V6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	20-UNIMOD:21	ms_run[2]:scan=19266	61.081	4	3822.7149	3822.7149	R	L	159	190
PSM	QVDTEEAGMVTAATASNVKASPK	153	tr|A2BI12|A2BI12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21	ms_run[2]:scan=13473	44.485	3	2384.0931	2384.0931	K	R	156	179
PSM	QVDTEEAGMVTAATASNVKASPK	154	tr|A2BI12|A2BI12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	21-UNIMOD:21	ms_run[2]:scan=13512	44.652	3	2384.0931	2384.0931	K	R	156	179
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	155	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:21	ms_run[2]:scan=12341	41.087	3	3097.2826	3097.2826	K	I	10	37
PSM	SETAPAAPAAPAPVEKTPVKK	156	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=8973	31.346916	3	2181.1088	2181.1077	M	K	2	23
PSM	SETAPAAPAAPAPVEKTPVKK	157	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9047	31.521153	3	2181.1088	2181.1077	M	K	2	23
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	158	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21059	66.35974	4	3913.649000	3913.648853	R	I	245	277
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	159	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20901	65.846495	4	3913.649129	3913.648853	R	I	245	277
PSM	HAVSEGTKAVTKYTSSK	160	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=3225	14.214396	4	1792.931512	1792.931927	K	-	110	127
PSM	ASGVAVSDGVIKVFNDMKVR	161	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=21963	68.972622	3	2229.0859	2229.0859	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	162	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29187	91.586917	3	1957.9225	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMKVR	163	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24880	79.393908	3	2213.0912	2213.0910	M	K	2	22
PSM	SGEDEQQEQTIAEDLVVTKYK	164	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23291	73.563623	2	2531.1324	2531.1311	M	M	2	23
PSM	AADVSVTHRPPLSPEAEAEAETPETVDR	165	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	41.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=17391	55.554691	3	3095.4095	3095.4079	M	R	2	30
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	166	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=21342	67.152	3	3913.6489	3913.6489	R	I	245	277
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	167	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=18427	58.423	4	4287.8937	4287.8937	K	S	104	143
PSM	EGINPGYDDYADSDEDQHDAYLER	168	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=16776	53.843	3	2866.0879	2866.0879	K	M	432	456
PSM	HAVSEGTKAVTKYTSSK	169	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=3123	13.856	3	1792.9319	1792.9319	K	-	110	127
PSM	HLQLAIRNDEELNKLLGR	170	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=17001	54.397	3	2131.1862	2131.1862	R	V	83	101
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	171	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	13-UNIMOD:21	ms_run[2]:scan=17721	56.466	3	3005.4231	3005.4231	K	S	157	186
PSM	RASVCAEAYNPDEEEDDAESRIIHPK	172	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=13744	45.536	4	3080.3183	3080.3183	R	T	110	136
PSM	SASPDDDLGSSNWEAADLGNEER	173	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:21	ms_run[2]:scan=20265	63.896	2	2513.982	2513.9820	R	K	15	38
PSM	SASPDDDLGSSNWEAADLGNEERK	174	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=17259	55.178	3	2642.077	2642.0770	R	Q	15	39
PSM	SASPDDDLGSSNWEAADLGNEERKQK	175	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=14605	47.976	4	2898.2305	2898.2305	R	F	15	41
PSM	SLSPLSGTTDTKAESPAGR	176	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21	ms_run[2]:scan=10151	34.954	3	1953.9045	1953.9045	R	V	423	442
PSM	SLSPLSGTTDTKAESPAGRVSDESVLPLAQK	177	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	40.0	3-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=19603	62.01	3	3300.5528	3300.5528	R	S	423	454
PSM	SETAPVAQAASTATEKPAAAKK	178	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10657	36.217168	3	2249.0943	2249.0935	M	T	2	24
PSM	ASGVAVSDGVIKVFNDMK	179	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26822	86.19276	2	1957.9228	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMKVR	180	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24379	77.47708	3	2213.0913	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	181	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26381	84.735811	3	2213.0915	2213.0910	M	K	2	22
PSM	HLQLAIRNDEELNKLLGK	182	sp|Q64523|H2A2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=16456	52.97339	4	2103.180394	2103.180037	R	V	83	101
PSM	SDAAVDTSSEITTKDLK	183	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=15573	50.710156	2	1901.8509	1901.8502	M	E	2	19
PSM	AAAVLSGASAGSPAGAPGGPGGLSAVGSGPR	184	sp|Q9DBD5|PELP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	40.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=24062	76.287652	3	2625.2554	2625.2543	M	L	2	33
PSM	HLQLAIRNDEELNKLLGR	185	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16984	54.35	4	2131.1862	2131.1862	R	V	83	101
PSM	HQGVMVGMGQKDSYVGDEAQSK	186	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=7911	28.403	4	2350.0682	2350.0682	R	R	40	62
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	187	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=7980	28.607	4	3400.4593	3400.4593	R	G	575	609
PSM	KHHEDEIDHHSKEIER	188	tr|E9PV44|E9PV44_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=1258	6.1358	4	2037.9617	2037.9617	R	L	40	56
PSM	LDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKK	189	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13250	43.637	4	4304.5692	4304.5692	K	G	158	194
PSM	RDSFDDRGPSLNPVLDYDHGSR	190	tr|A0A494BAZ2|A0A494BAZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=14878	48.789	4	2597.1296	2597.1296	R	S	186	208
PSM	RDSFDDRGPSLNPVLDYDHGSR	191	tr|A0A494BAZ2|A0A494BAZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=14937	48.962	4	2597.1296	2597.1296	R	S	186	208
PSM	RQQDPSPGSNLGGGDDLKLR	192	sp|Q08024-4|PEBB-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	6-UNIMOD:21	ms_run[2]:scan=10152	34.955	3	2189.0226	2189.0226	R	-	129	149
PSM	SAEPLANTVLASETEEEGNAQALGPTAK	193	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:21	ms_run[2]:scan=20189	63.685	3	2877.3281	2877.3281	K	S	158	186
PSM	SASPDDDLGSSNWEAADLGNEER	194	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=20301	63.989	3	2513.982	2513.9820	R	K	15	38
PSM	SASPDDDLGSSNWEAADLGNEER	195	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:21	ms_run[2]:scan=20358	64.159	3	2513.982	2513.9820	R	K	15	38
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISR	196	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21151	66.664946	4	4269.866215	4269.866056	R	D	245	280
PSM	SETAPVAQAASTATEKPAAAKK	197	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10454	35.694146	3	2249.0943	2249.0935	M	T	2	24
PSM	ASGVAVSDGVIKVFNDMKVR	198	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26273	84.392192	3	2213.0915	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	199	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29256	91.756095	3	1957.9225	1957.9215	M	V	2	20
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	200	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=10612	36.100548	3	3526.258953	3526.255817	K	-	183	211
PSM	SGEDEQQEQTIAEDLVVTK	201	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25473	81.606034	3	2239.9738	2239.9728	M	Y	2	21
PSM	SGEDEQQEQTIAEDLVVTK	202	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25496	81.684927	2	2239.9742	2239.9728	M	Y	2	21
PSM	SGEDEQQEQTIAEDLVVTK	203	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	39.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25547	81.862378	2	2239.9742	2239.9728	M	Y	2	21
PSM	AASLRGGVGAPGSPSTPPTRFFTEK	204	sp|Q3UYC0-2|PPM1H-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=15098	49.456	3	2567.2534	2567.2534	R	K	208	233
PSM	IQQFDDGGSDEEDIWEEKHIAFTPESQRR	205	tr|A0A286YCG3|A0A286YCG3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:21	ms_run[2]:scan=18176	57.721	4	3541.5423	3541.5423	R	S	85	114
PSM	LCDFGSASHVADNDITPYLVSR	206	sp|Q61136|PRP4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	2-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=20031	63.205	3	2516.1043	2516.1043	K	F	832	854
PSM	LGSTGGKMQGVPLKHSGHLMK	207	tr|D3Z4F8|D3Z4F8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=6206	23.743	4	2242.1116	2242.1116	R	T	45	66
PSM	LGSTGGKMQGVPLKHSGHLMK	208	tr|D3Z4F8|D3Z4F8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=6262	23.921	4	2242.1116	2242.1116	R	T	45	66
PSM	NRPGYVSEEEEDDEDYEMAVK	209	sp|Q9ERU9|RBP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	7-UNIMOD:21	ms_run[2]:scan=15341	50.109	3	2582.9996	2582.9996	K	K	2499	2520
PSM	SLSPLSGTTDTKAESPAGR	210	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	3-UNIMOD:21	ms_run[2]:scan=10230	35.129	3	1953.9045	1953.9045	R	V	423	442
PSM	SSGSPYGGGYGSGGGSGGYGSR	211	tr|A2AL12|A2AL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:21	ms_run[2]:scan=9059	31.544	2	1989.749	1989.7490	R	R	295	317
PSM	TFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIK	212	tr|F6YB25|F6YB25_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	38.0	16-UNIMOD:21	ms_run[2]:scan=27677	88.606	3	3918.7248	3918.7248	R	A	49	83
PSM	RADALTSSPGRDLPPFEDESEGLLGTEGPMEEEEDGEELIGDGMER	213	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	8-UNIMOD:21	ms_run[1]:scan=26645	85.586032	4	5041.1683	5041.1637	R	D	34	80
PSM	ASGVAVSDGVIKVFNDMKVR	214	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26295	84.452835	2	2213.0926	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	215	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29122	91.412453	3	1957.9225	1957.9215	M	V	2	20
PSM	SETAPAETAAPAPVEKSPAK	216	sp|P43276|H15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9785	33.785283	2	2072.9672	2072.9662	M	K	2	22
PSM	HLQLAIRNDEELNKLLGK	217	sp|Q64523|H2A2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=16394	52.803962	4	2103.180394	2103.180037	R	V	83	101
PSM	SDNDDIEVESDADKRAHHNALER	218	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9102	31.639158	4	2757.1627	2757.1622	M	K	2	25
PSM	ALSEEMGDTLEEGSASPTSPDCSLDSPGPEK	219	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=20917	65.896	3	3272.3262	3272.3262	K	M	95	126
PSM	CDVDIRKDLYANTVLSGGTTMYPGIADR	220	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4	ms_run[2]:scan=21326	67.118	4	3100.4958	3100.4958	K	M	285	313
PSM	HASAAGFPLSGTATWTLGR	221	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21	ms_run[2]:scan=21714	68.149	3	1979.9255	1979.9255	R	G	70	89
PSM	HLQLAIRNDEELNKLLGR	222	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17044	54.52	4	2131.1862	2131.1862	R	V	83	101
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	223	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	5-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=25948	83.332	3	3763.7863	3763.7863	R	V	592	630
PSM	LSSESHHGGSPIHWVLPAGMSAK	224	tr|D6RG95|D6RG95_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=14751	48.396	4	2464.1359	2464.1359	R	M	410	433
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKR	225	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=14841	48.667	4	3680.5396	3680.5396	R	I	373	406
PSM	NRPGYVSEEEEDDEDYEMAVK	226	sp|Q9ERU9|RBP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:21	ms_run[2]:scan=15274	49.941	3	2582.9996	2582.9996	K	K	2499	2520
PSM	RASVCAEAYNPDEEEDDAESR	227	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10381	35.502	3	2491.9435	2491.9435	R	I	110	131
PSM	SRSPVDSPVPASMFAPEPSSPGAAR	228	sp|O08582|GTPB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=20130	63.514	3	2656.1394	2656.1394	R	A	6	31
PSM	VVDYSQFQESDDADEDYGRDSGPPAK	229	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	37.0	10-UNIMOD:21	ms_run[2]:scan=14663	48.141	3	2969.1876	2969.1876	K	K	10	36
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	230	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,35-UNIMOD:35	ms_run[1]:scan=19594	61.991681	4	4286.8630	4286.8616	K	S	104	143
PSM	KASGPPVSELITK	231	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=11522	38.674265	2	1405.722657	1405.721798	R	A	34	47
PSM	ASGVAVSDGVIKVFNDMKVR	232	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24838	79.222892	3	2213.0912	2213.0910	M	K	2	22
PSM	SGEDEQQEQTIAEDLVVTK	233	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25447	81.514178	2	2239.9742	2239.9728	M	Y	2	21
PSM	HIAEEADRKYEEVAR	234	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=4621	18.933905	4	1814.891057	1814.891125	K	K	117	132
PSM	SDAAVDTSSEITTKDLK	235	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=15643	50.879932	2	1901.8509	1901.8502	M	E	2	19
PSM	SDAAVDTSSEITTKDLK	236	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=15507	50.540187	2	1901.8509	1901.8502	M	E	2	19
PSM	ADGDSGSERGGGGGGGGGPGGFQPAPR	237	sp|O35295|PURB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=10800	36.604049	3	2434.9888	2434.9882	M	G	2	29
PSM	ATSAHLEEMEEGNSLDSSTQQVVGSGGQR	238	sp|P81069|GABP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:21	ms_run[2]:scan=14665	48.145	3	3083.3139	3083.3139	K	V	205	234
PSM	HLQLAIRNDEELNKLLGR	239	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17096	54.69	4	2131.1862	2131.1862	R	V	83	101
PSM	HLQLAIRNDEELNKLLGR	240	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17147	54.859	4	2131.1862	2131.1862	R	V	83	101
PSM	HLQLAIRNDEELNKLLGR	241	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17206	55.031	4	2131.1862	2131.1862	R	V	83	101
PSM	HQGVMVGMGQKDSYVGDEAQSKR	242	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:35	ms_run[2]:scan=4408	18.238	4	2522.1642	2522.1642	R	G	40	63
PSM	KETESEAEDDNLDDLER	243	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:21	ms_run[2]:scan=12005	40.219	3	2086.8216	2086.8216	R	H	874	891
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKR	244	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	22-UNIMOD:21	ms_run[2]:scan=15459	50.412	4	3664.5447	3664.5447	R	I	373	406
PSM	SHHAPMSPGSSGGGGQPLAR	245	sp|A2BH40-3|ARI1A-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:21	ms_run[2]:scan=4536	18.652	3	1966.8469	1966.8469	R	T	359	379
PSM	SKESLQEAGKSDANTDLIGGSPK	246	sp|P53986|MOT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=9216	31.928	3	2411.1217	2411.1217	K	G	210	233
PSM	SSGSPYGGGYGSGGGSGGYGSR	247	tr|A2AL12|A2AL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:21	ms_run[2]:scan=8982	31.366	2	1989.749	1989.7490	R	R	295	317
PSM	KASGPPVSELITK	248	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21	ms_run[1]:scan=11461	38.504158	2	1405.722657	1405.721798	R	A	34	47
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	249	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20849	65.673856	4	3913.649129	3913.648853	R	I	245	277
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	250	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=24789	79.049429	3	2990.324089	2990.322280	K	T	1561	1587
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	251	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=24740	78.879317	3	2990.324089	2990.322280	K	T	1561	1587
PSM	HAVSEGTKAVTKYTSSK	252	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=3082	13.707372	4	1792.931512	1792.931927	K	-	110	127
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	253	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0	13-UNIMOD:21	ms_run[1]:scan=17783	56.63996	3	3006.427775	3005.423056	K	S	157	186
PSM	ASGVAVSDGVIKVFNDMK	254	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24094	76.417159	2	1973.9170	1973.9164	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	255	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29049	91.242835	2	1957.9219	1957.9215	M	V	2	20
PSM	HIAEEADRKYEEVAR	256	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=4671	19.1037	4	1814.891057	1814.891125	K	K	117	132
PSM	AAAAAAAAAAGDSDSWDADTFSMEDPVRK	257	sp|Q3UGC7|EI3JA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=25734	82.542028	3	2989.2420	2989.2432	M	V	2	31
PSM	AASLRGGVGAPGSPSTPPTRFFTEK	258	sp|Q3UYC0-2|PPM1H-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=15039	49.281	3	2567.2534	2567.2534	R	K	208	233
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	259	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=5259	20.651	4	2984.2846	2984.2846	R	R	198	233
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	260	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=20623	64.974	4	3913.6489	3913.6489	R	I	245	277
PSM	CPNLAVKEADDDEEADDDVSEMPSPK	261	sp|P13864-2|DNMT1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=14549	47.821	3	2955.1675	2955.1675	R	K	576	602
PSM	ELEKRASGQAFELILSPR	262	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=17923	57	3	2123.0776	2123.0776	K	S	10	28
PSM	ELEKRASGQAFELILSPR	263	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:21	ms_run[2]:scan=17985	57.173	3	2123.0776	2123.0776	K	S	10	28
PSM	GRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	264	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=25443	81.496	4	3788.5825	3788.5825	R	V	193	225
PSM	IAQLEEELEEEQGNTELINDR	265	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20874	65.756	3	2471.1664	2471.1664	R	L	1731	1752
PSM	LIHTLDDRTQLWASEPGTPPVPTSLPSQNPILK	266	tr|A0A0G2JDF8|A0A0G2JDF8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:21	ms_run[2]:scan=22796	71.999	4	3700.8866	3700.8866	K	N	168	201
PSM	LKGQEDSLASAVDATTGQEACDSD	267	sp|Q8R344|CCD12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=18732	59.387	2	2547.032	2547.0320	R	-	143	167
PSM	LKGQEDSLASAVDATTGQEACDSD	268	sp|Q8R344|CCD12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=18753	59.459	3	2547.032	2547.0320	R	-	143	167
PSM	LRPRSIEVENDFLPVEK	269	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	5-UNIMOD:21	ms_run[2]:scan=16985	54.352	3	2120.0667	2120.0667	K	T	167	184
PSM	LSRQPSIELPSMAVASTK	270	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=17582	56.105	3	1993.9908	1993.9908	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	271	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=18037	57.319	3	1993.9908	1993.9908	K	T	236	254
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	272	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	24-UNIMOD:21	ms_run[2]:scan=22657	71.521	4	3491.5606	3491.5606	R	T	545	573
PSM	RLSVQGQAISVVGSQSTMSPLEEEVPQAK	273	sp|Q80X82|SYMPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	3-UNIMOD:21	ms_run[2]:scan=21109	66.527	3	3134.5319	3134.5319	R	R	492	521
PSM	RQQDPSPGSNLGGGDDLKLR	274	sp|Q08024-4|PEBB-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=10231	35.13	3	2189.0226	2189.0226	R	-	129	149
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	275	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	10-UNIMOD:21	ms_run[2]:scan=12412	41.262	3	3097.2826	3097.2826	K	I	10	37
PSM	YMAENPTAGVVQEEEEDNLEYDSDGNPIAPSKK	276	sp|Q810A7-2|DDX42-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	23-UNIMOD:21	ms_run[2]:scan=19821	62.582	3	3718.587	3718.5870	R	I	44	77
PSM	YTFDFSEEEDDDAAAADDSNDLEELKVK	277	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:21	ms_run[2]:scan=23263	73.503	3	3260.3082	3260.3082	K	A	1358	1386
PSM	KASGPPVSELITK	278	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:21	ms_run[1]:scan=11397	38.334113	2	1405.722657	1405.721798	R	A	34	47
PSM	HQGVMVGMGQKDSYVGDEAQSKR	279	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=3694	15.90888	4	2538.158206	2538.159121	R	G	40	63
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	280	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21	ms_run[1]:scan=24523	78.027691	3	2990.324089	2990.322280	K	T	1561	1587
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	281	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0	8-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=26149	84.013594	3	3764.790515	3763.786332	R	V	592	630
PSM	ASGVAVSDGVIKVFNDMKVR	282	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24282	77.128063	3	2213.0913	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	283	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=21918	68.799775	3	2229.0859	2229.0859	M	K	2	22
PSM	SGEDEQQEQTIAEDLVVTK	284	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25523	81.778514	3	2239.9738	2239.9728	M	Y	2	21
PSM	HIAEEADRKYEEVAR	285	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=4718	19.271847	4	1814.891057	1814.891125	K	K	117	132
PSM	SDNDDIEVESDADKRAHHNALER	286	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	35.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9173	31.812382	4	2757.1627	2757.1622	M	K	2	25
PSM	AGGQAPSSPSYENSLHSLQSR	287	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	8-UNIMOD:21	ms_run[2]:scan=12819	42.38	3	2251.9859	2251.9859	R	M	209	230
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	288	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23720	75.04	3	3450.4641	3450.4641	R	-	226	256
PSM	DNLTLWTSDTQGDEAEAGEGGEN	289	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21850	68.586	2	2407.9888	2407.9888	R	-	223	246
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	290	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	16-UNIMOD:21	ms_run[2]:scan=15330	50.084	4	3164.2884	3164.2884	R	M	429	456
PSM	LGEESKEPLSDEDEEDNDDVEPISEFR	291	tr|Q923F1|Q923F1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:21	ms_run[2]:scan=19404	61.478	3	3201.3035	3201.3035	K	F	91	118
PSM	LSRQPSIELPSMAVASTK	292	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=17666	56.315	2	1993.9908	1993.9908	K	T	236	254
PSM	PGPTPSGTNVGSSGRSPSKAVAAR	293	sp|Q9CQS8|SC61B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:21	ms_run[2]:scan=4883	19.754	3	2317.1176	2317.1176	M	A	2	26
PSM	QICLVMLETLSQSPQGR	294	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=25663	82.292	2	2038.9581	2038.9581	K	V	161	178
PSM	RYSWGTVEVENPHHCDFLNLRR	295	tr|A0A0U1RQA1|A0A0U1RQA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=16596	53.35	4	2864.2966	2864.2966	R	M	211	233
PSM	SKDPGSPQLNQEAMADGVEGTPWSAEKPR	296	sp|Q3UZA1-2|CPZIP-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:21	ms_run[2]:scan=16560	53.256	4	3161.4125	3161.4125	K	R	181	210
PSM	SRSPVDSPVPASMFAPEPSSPGAAR	297	sp|O08582|GTPB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=20193	63.693	3	2656.1394	2656.1394	R	A	6	31
PSM	VVDYSQFQESDDADEDYGRDSGPPAKK	298	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:21	ms_run[2]:scan=12119	40.543	4	3097.2826	3097.2826	K	I	10	37
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISR	299	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21214	66.841712	4	4269.866215	4269.866056	R	D	245	280
PSM	HAVSEGTKAVTKYTSSK	300	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=2424	11.101459	4	1792.929604	1792.931927	K	-	110	127
PSM	SETAPVAQAASTATEKPAAAK	301	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=13396	44.189305	3	2120.9994	2120.9986	M	K	2	23
PSM	ASGVAVSDGVIKVFNDMK	302	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24050	76.245698	2	1973.9170	1973.9164	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	303	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=25842	82.942986	2	1957.9222	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	304	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=25889	83.113898	2	1957.9222	1957.9215	M	V	2	20
PSM	SGEDEQQEQTIAEDLVVTKYK	305	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23431	73.949679	2	2531.1324	2531.1311	M	M	2	23
PSM	AASENSQDAFRVVSTSGEQLKVYK	306	sp|Q03267-2|IKZF1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=16358	52.705	4	2693.2698	2693.2698	R	C	206	230
PSM	ALGSPTKQLLPCEMACNEKLGK	307	sp|Q99J77|SIAS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=15381	50.22	3	2524.1889	2524.1889	R	S	272	294
PSM	CPNLAVKEADDDEEADDDVSEMPSPK	308	sp|P13864-2|DNMT1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=14613	47.998	3	2955.1675	2955.1675	R	K	576	602
PSM	IALALNKVDGPDVALKDSDQVAQSDGEESPAAEEQLLGER	309	sp|Q3UPL0|SC31A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	24-UNIMOD:21	ms_run[2]:scan=21896	68.735	4	4257.0326	4257.0326	K	I	503	543
PSM	KETESEAEDDNLDDLERHLR	310	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	5-UNIMOD:21	ms_run[2]:scan=15512	50.558	4	2493.0657	2493.0657	R	E	874	894
PSM	LKELFDYSPPLHK	311	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=16414	52.852	3	1665.8168	1665.8168	K	S	216	229
PSM	LKELFDYSPPLHK	312	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=16475	53.026	3	1665.8168	1665.8168	K	S	216	229
PSM	LKELFDYSPPLHK	313	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=16539	53.195	3	1665.8168	1665.8168	K	S	216	229
PSM	LKELFDYSPPLHK	314	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	8-UNIMOD:21	ms_run[2]:scan=16601	53.364	3	1665.8168	1665.8168	K	S	216	229
PSM	LKGQEDSLASAVDATTGQEACDSD	315	sp|Q8R344|CCD12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=18804	59.631	3	2547.032	2547.0320	R	-	143	167
PSM	LKQLSVPASDEEDEVPAPIPR	316	tr|G3V012|G3V012_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:21	ms_run[2]:scan=17474	55.791	3	2369.1516	2369.1516	R	G	4	25
PSM	LSRQPSIELPSMAVASTK	317	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:21	ms_run[2]:scan=17650	56.273	3	1993.9908	1993.9908	K	T	236	254
PSM	QEAQQREVDQDDEENSEEDEMDSGTMVR	318	tr|F7BYZ4|F7BYZ4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:21	ms_run[2]:scan=12143	40.607	3	3378.2773	3378.2773	R	A	21	49
PSM	QICLVMLETLSQSPQGR	319	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=25619	82.132	3	2038.9581	2038.9581	K	V	161	178
PSM	QICLVMLETLSQSPQGR	320	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=25667	82.3	3	2038.9581	2038.9581	K	V	161	178
PSM	SASPDDDLGSSNWEAADLGNEERKQK	321	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=14762	48.422	3	2898.2305	2898.2305	R	F	15	41
PSM	SESLIDASEDSQLEAAIR	322	sp|Q6P5G6|UBXN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:21	ms_run[2]:scan=22279	70.087	2	2012.894	2012.8940	R	A	256	274
PSM	SGVSITIDDPVRTAQVPSPPRGK	323	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	18-UNIMOD:21	ms_run[2]:scan=15690	50.995	3	2456.2425	2456.2425	K	I	920	943
PSM	TPLATIADQQQLQLSPLKR	324	sp|P11157|RIR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:21	ms_run[2]:scan=19487	61.696	3	2200.1617	2200.1617	R	L	6	25
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	325	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20889	65.813764	4	4270.8681	4270.8667	K	S	104	143
PSM	ERSPALKSPLQSVVVR	326	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	3-UNIMOD:21	ms_run[1]:scan=12754	42.214379	3	1844.988460	1844.987348	R	R	246	262
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	327	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	33.0	8-UNIMOD:21	ms_run[1]:scan=24878	79.388335	3	2990.324089	2990.322280	K	T	1561	1587
PSM	ASGVAVSDGVIKVFNDMK	328	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26873	86.361971	2	1957.9228	1957.9215	M	V	2	20
PSM	SDFDEFERQLNENKQER	329	sp|P26369|U2AF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=20093	63.393795	3	2304.9647	2304.9643	M	D	2	19
PSM	AAAVLSGASAGSPAGAPGGPGGLSAVGSGPR	330	sp|Q9DBD5|PELP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=24150	76.627533	3	2625.2554	2625.2543	M	L	2	33
PSM	AASPPASASDLIEQQQKR	331	sp|Q8C079-2|STRP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=12295	40.974	3	1975.9364	1975.9364	R	G	333	351
PSM	AASPPASASDLIEQQQKR	332	sp|Q8C079-2|STRP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=12366	41.149	3	1975.9364	1975.9364	R	G	333	351
PSM	AGGQAPSSPSYENSLHSLQSR	333	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=12751	42.207	3	2251.9859	2251.9859	R	M	209	230
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	334	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=23672	74.864	3	3450.4641	3450.4641	R	-	226	256
PSM	ELEKRASGQAFELILSPR	335	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=17853	56.827	3	2123.0776	2123.0776	K	S	10	28
PSM	ELEKRASGQAFELILSPR	336	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=19559	61.898	3	2203.0439	2203.0440	K	S	10	28
PSM	GRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	337	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=25491	81.67	4	3788.5825	3788.5825	R	V	193	225
PSM	KETESEAEDDNLDDLERHLR	338	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:21	ms_run[2]:scan=15447	50.386	4	2493.0657	2493.0657	R	E	874	894
PSM	KFPDRLADDEGDSDSESVGQSR	339	sp|Q9Z277-2|BAZ1B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:21	ms_run[2]:scan=10117	34.877	3	2489.0344	2489.0344	R	G	1154	1176
PSM	KLEKEEEEGISQESSEEEQ	340	sp|P17095-1|HMGA1-1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5773	22.2	3	2235.9867	2235.9867	K	-	78	97
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	341	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:21	ms_run[2]:scan=12709	42.09	4	3097.2826	3097.2826	R	K	9	36
PSM	LKGQEDSLASAVDATTGQEACDSD	342	sp|Q8R344|CCD12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=18834	59.723	2	2547.032	2547.0320	R	-	143	167
PSM	LSRQPSIELPSMAVASTK	343	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=13853	45.838	3	2009.9857	2009.9857	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	344	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=17520	55.929	3	1993.9908	1993.9908	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	345	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=17714	56.45	3	1993.9908	1993.9908	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	346	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=17774	56.619	3	1993.9908	1993.9908	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	347	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=17909	56.971	3	1993.9908	1993.9908	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	348	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:21	ms_run[2]:scan=17975	57.143	3	1993.9908	1993.9908	K	T	236	254
PSM	NLTANDPSQDYVASDCEEDPEVEFLK	349	sp|Q9DA19|CIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=23524	74.287	3	3064.2533	3064.2533	R	S	189	215
PSM	NRPGYVSEEEEDDEDYEMAVK	350	sp|Q9ERU9|RBP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=15405	50.28	3	2582.9996	2582.9996	K	K	2499	2520
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	351	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	24-UNIMOD:21	ms_run[2]:scan=22709	71.689	4	3491.5606	3491.5606	R	T	545	573
PSM	RASVCAEAYNPDEEEDDAESRIIHPK	352	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=13870	45.877	4	3080.3183	3080.3183	R	T	110	136
PSM	RYSWGTVEVENPHHCDFLNLR	353	tr|A0A0U1RQA1|A0A0U1RQA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=18786	59.569	4	2708.1955	2708.1955	R	R	211	232
PSM	SAEPLANTVLASETEEEGNAQALGPTAK	354	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	8-UNIMOD:21	ms_run[2]:scan=20312	64.025	3	2877.3281	2877.3281	K	S	158	186
PSM	SEDDSAKFDSNEEDTASVFAPSFGLK	355	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:21	ms_run[2]:scan=23328	73.663	3	2872.1964	2872.1964	K	Q	1444	1470
PSM	SKPLDQSVEDLSKAPPSSVPK	356	sp|Q9JL26-2|FMNL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=12089	40.467	3	2288.1301	2288.1301	K	S	152	173
PSM	SVPTVDSGNEDDDSSFKIK	357	sp|Q05D44|IF2P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:21	ms_run[2]:scan=13294	43.793	3	2118.8994	2118.8994	K	T	209	228
PSM	YLSFTPPEKDGFPSGTPALNTK	358	sp|Q8CIN4|PAK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:21	ms_run[2]:scan=20998	66.163	3	2446.1458	2446.1458	K	G	139	161
PSM	ERSPALKSPLQSVVVR	359	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21	ms_run[1]:scan=12943	42.72677	3	1844.988460	1844.987348	R	R	246	262
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	360	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21519	67.576443	4	3913.649000	3913.648853	R	I	245	277
PSM	SETAPAETAAPAPVEKSPAK	361	sp|P43276|H15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9884	34.123775	2	2072.9672	2072.9662	M	K	2	22
PSM	SETAPAETAAPAPVEKSPAK	362	sp|P43276|H15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9833	33.955488	2	2072.9672	2072.9662	M	K	2	22
PSM	SGEDEQQEQTIAEDLVVTK	363	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25572	81.955213	3	2239.9738	2239.9728	M	Y	2	21
PSM	QICLVMLETLSQSPQGR	364	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28,3-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=36346	105.63839	2	2021.9329	2021.9310	K	V	161	178
PSM	ALAAAGYDVEKNNSR	365	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5553	21.545	3	1577.7798	1577.7798	K	I	65	80
PSM	ALAAAGYDVEKNNSR	366	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5609	21.717	3	1577.7798	1577.7798	K	I	65	80
PSM	ALAAAGYDVEKNNSR	367	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5670	21.892	3	1577.7798	1577.7798	K	I	65	80
PSM	ESTESSPGKHLVTSEELISEGK	368	tr|A0A0A6YVU1|A0A0A6YVU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=13024	42.952	3	2423.1105	2423.1105	R	W	5	27
PSM	HASAAGFPLSGTATWTLGR	369	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=21769	68.32	3	1979.9255	1979.9255	R	G	70	89
PSM	HHEDEIDHHSKEIER	370	tr|E9PV44|E9PV44_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1488	7.2143	4	1909.8667	1909.8667	K	L	41	56
PSM	HQGVMVGMGQKDSYVGDEAQSK	371	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=4417	18.269	4	2382.058	2382.0580	R	R	40	62
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	372	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=21762	68.291	3	3059.4618	3059.4618	R	L	160	187
PSM	KVVDYSQFQESDDADEDYGR	373	tr|A0A087WRY3|A0A087WRY3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:21	ms_run[2]:scan=14039	46.326	3	2444.9646	2444.9646	R	D	9	29
PSM	LGIAVIHGEAQDAESDLVDGRHSPPMVR	374	sp|Q8R574|KPRB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	23-UNIMOD:21	ms_run[2]:scan=18357	58.195	4	3048.4488	3048.4488	R	S	205	233
PSM	LSRQPSIELPSMAVASTK	375	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=17842	56.795	3	1993.9908	1993.9908	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	376	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:21	ms_run[2]:scan=17752	56.553	2	1993.9908	1993.9908	K	T	236	254
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKR	377	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	22-UNIMOD:21	ms_run[2]:scan=15524	50.586	4	3664.5447	3664.5447	R	I	373	406
PSM	NLDIERPTYTNLNR	378	sp|P68373|TBA1C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12340	41.085	3	1717.8747	1717.8747	R	L	216	230
PSM	RGLLYDSSEEDEERPAR	379	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=9530	32.889	3	2100.9113	2100.9113	R	K	133	150
PSM	SHHAPMSPGSSGGGGQPLAR	380	sp|A2BH40-3|ARI1A-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:21	ms_run[2]:scan=4484	18.48	3	1966.8469	1966.8469	R	T	359	379
PSM	SLSPLSGTTDTKAESPAGR	381	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=10080	34.778	3	1953.9045	1953.9045	R	V	423	442
PSM	SNSVKKSQPTLPISTIDER	382	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=11317	38.083	3	2179.0886	2179.0886	K	L	201	220
PSM	SRSDVDMDPGSATAVLGPTR	383	tr|F6ZN61|F6ZN61_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:21	ms_run[2]:scan=15151	49.603	3	2110.9354	2110.9354	R	R	111	131
PSM	SRSPVDSPVPASMFAPEPSSPGAAR	384	sp|O08582|GTPB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21,19-UNIMOD:21	ms_run[2]:scan=20074	63.343	3	2656.1394	2656.1394	R	A	6	31
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	385	tr|D3YWA4|D3YWA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	31.0	3-UNIMOD:21	ms_run[2]:scan=21455	67.403	3	2685.1041	2685.1041	K	M	39	63
PSM	SETAPAAPAAPAPVEKTPVK	386	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12148	40.617356	3	2053.0141	2053.0128	M	K	2	22
PSM	SETAPAAPAAPAPVEKTPVK	387	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12101	40.494065	2	2053.0145	2053.0128	M	K	2	22
PSM	ASPITNDGEDEFVPSDGLDKDEYAFSSGK	388	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	15-UNIMOD:21	ms_run[1]:scan=21549	67.663288	3	3169.338083	3169.328881	K	S	1386	1415
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	389	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=18132	57.587191	3	3006.409343	3005.423056	K	S	157	186
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	390	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	13-UNIMOD:21	ms_run[1]:scan=18071	57.410686	3	3006.409343	3005.423056	K	S	157	186
PSM	SETAPVAQAASTATEKPAAAK	391	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=13387	44.154867	2	2121.0004	2120.9986	M	K	2	23
PSM	NRPGYVSEEEEDDEDYEMAVK	392	sp|Q9ERU9|RBP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	31.0	7-UNIMOD:21	ms_run[1]:scan=15253	49.886878	3	2582.998930	2582.999625	K	K	2499	2520
PSM	SDFDEFERQLNENKQER	393	sp|P26369|U2AF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=20057	63.283933	3	2304.9647	2304.9643	M	D	2	19
PSM	AAAVLSGASAGSPAGAPGGPGGLSAVGSGPR	394	sp|Q9DBD5|PELP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	31.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=24018	76.119119	3	2625.2554	2625.2543	M	L	2	33
PSM	ATSAHLEEMEEGNSLDSSTQQVVGSGGQR	395	sp|P81069|GABP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	14-UNIMOD:21	ms_run[2]:scan=14725	48.318	3	3083.3139	3083.3139	K	V	205	234
PSM	EDHGRGYFEYIEENKYSR	396	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12486	41.445	4	2291.0243	2291.0243	R	A	227	245
PSM	ELEKRASGQAFELILSPR	397	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=19625	62.068	3	2203.0439	2203.0440	K	S	10	28
PSM	GLLYDSSEEDEERPAR	398	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:21	ms_run[2]:scan=12431	41.314	2	1944.8102	1944.8102	R	K	134	150
PSM	HKMSPPPSSFNEPR	399	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=5894	22.592	3	1689.7334	1689.7334	R	S	363	377
PSM	HLSSTSDDEPLSSVNHAAK	400	tr|D3Z491|D3Z491_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=7188	26.429	3	2073.9004	2073.9004	R	A	25	44
PSM	KALAAAGYDVEKNNSR	401	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=3637	15.711	3	1705.8747	1705.8747	K	I	64	80
PSM	KFPDRLADDEGDSDSESVGQSR	402	sp|Q9Z277-2|BAZ1B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21	ms_run[2]:scan=10050	34.699	3	2489.0344	2489.0344	R	G	1154	1176
PSM	KLEKEEEEGISQESSEEEQ	403	sp|P17095-1|HMGA1-1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5827	22.373	3	2235.9867	2235.9867	K	-	78	97
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	404	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=26104	83.852	4	3763.7863	3763.7863	R	V	592	630
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEDEEDVK	405	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=14089	46.462	4	3686.5931	3686.5931	R	L	102	135
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	406	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=18531	58.737	4	4372.9716	4372.9716	R	R	102	142
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	407	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=23130	73.16	4	3254.5448	3254.5448	R	L	12	44
PSM	RHSVNLDEGESAQAVHK	408	sp|E9PVX6-2|KI67-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=3938	16.744	4	1955.8851	1955.8851	R	T	335	352
PSM	RILSDVTHSAVFGVPASK	409	tr|A0A571BDM4|A0A571BDM4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=18606	58.975	3	1962.9928	1962.9928	R	S	96	114
PSM	RKASGPPVSELITK	410	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=8034	28.764	3	1561.8229	1561.8229	K	A	34	48
PSM	RKTSDANETEDHLESLICK	411	sp|Q3UYV9|NCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=13282	43.746	4	2325.0308	2325.0308	R	V	19	38
PSM	RSTQGVTLTDLQEAEKTIGR	412	tr|A0A1W2P750|A0A1W2P750_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21	ms_run[2]:scan=18614	59.005	3	2282.1268	2282.1268	R	S	169	189
PSM	SGMSPEQSKTKPDSSIYPLVDSK	413	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:21	ms_run[2]:scan=12447	41.353	3	2560.1768	2560.1768	K	S	1094	1117
PSM	SLSPLSGTTDTKAESPAGRVSDESVLPLAQK	414	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=19599	62.002	4	3300.5528	3300.5528	R	S	423	454
PSM	SSPKEEVASEPEEAASPTTPK	415	tr|A2APD7|A2APD7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	9-UNIMOD:21	ms_run[2]:scan=7588	27.498	3	2249.9941	2249.9941	K	K	244	265
PSM	TAHNSEADLEESFNEHELEPSSPKTK	416	sp|Q9D4J7-2|PHF6-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	21-UNIMOD:21	ms_run[2]:scan=13109	43.194	4	3005.2928	3005.2928	K	K	54	80
PSM	TGEEDKKINEELESQYQQSMDSK	417	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13772	45.621	4	2715.2181	2715.2181	R	L	69	92
PSM	TKPPRPDSPTTTPNISVK	418	tr|A0A2I3BPX9|A0A2I3BPX9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:21	ms_run[2]:scan=7111	26.217	3	2015.0089	2015.0089	K	K	143	161
PSM	TVETRDGQVINETSQHHDDLE	419	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7303	26.73	4	2422.0997	2422.0997	K	-	446	467
PSM	VMTIPYQPMPASSPVICAGGQDR	420	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=21704	68.112	3	2554.142	2554.1420	R	C	178	201
PSM	SETAPAAPAAPAPVEKTPVK	421	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12170	40.665107	2	2053.0145	2053.0128	M	K	2	22
PSM	SASPDDDLGSSNWEAADLGNEER	422	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:21	ms_run[1]:scan=20268	63.903148	2	2513.984460	2513.982001	R	K	15	38
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	423	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:21	ms_run[1]:scan=24836	79.217319	3	2990.324089	2990.322280	K	T	1561	1587
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	424	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=26216	84.223059	3	3764.790515	3763.786332	R	V	592	630
PSM	SETAPVAQAASTATEKPAAAK	425	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=13356	44.023114	3	2120.9994	2120.9986	M	K	2	23
PSM	DLGEELEALKTELEDTLDSTAAQQELR	426	sp|Q8VDD5|MYH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=36298	105.54777	3	3017.474377	3016.472435	R	S	1136	1163
PSM	ASGVAVSDGVIKVFNDMKVR	427	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26431	84.904576	3	2213.0915	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	428	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24928	79.567786	3	2213.0912	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	429	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24138	76.584044	2	1973.9170	1973.9164	M	V	2	20
PSM	SETAPAETAAPAPVEKSPAK	430	sp|P43276|H15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9935	34.294099	2	2072.9672	2072.9662	M	K	2	22
PSM	AASENSQDAFRVVSTSGEQLKVYK	431	sp|Q03267-2|IKZF1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=16343	52.672	3	2693.2698	2693.2698	R	C	206	230
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	432	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=20506	64.634	4	3913.6489	3913.6489	R	I	245	277
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	433	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,22-UNIMOD:21,35-UNIMOD:35	ms_run[2]:scan=18470	58.555	4	4147.7875	4147.7875	K	R	104	142
PSM	FSSQLQAVSLRRPPAQAMLSGP	434	sp|P30987|TA2R_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:21	ms_run[2]:scan=19966	63.017	3	2420.2036	2420.2036	R	-	320	342
PSM	HKMSPPPSSFNEPR	435	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=5730	22.078	3	1689.7334	1689.7334	R	S	363	377
PSM	HKMSPPPSSFNEPR	436	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=5842	22.422	3	1689.7334	1689.7334	R	S	363	377
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	437	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=26002	83.513	4	3763.7863	3763.7863	R	V	592	630
PSM	LKELFDYSPPLHK	438	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	8-UNIMOD:21	ms_run[2]:scan=16345	52.677	3	1665.8168	1665.8168	K	S	216	229
PSM	LRPRSIEVENDFLPVEK	439	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:21	ms_run[2]:scan=17047	54.528	3	2120.0667	2120.0667	K	T	167	184
PSM	LSRQPSIELPSMAVASTK	440	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:21	ms_run[2]:scan=18100	57.492	3	1993.9908	1993.9908	K	T	236	254
PSM	NRTPSDVKELVLDNCK	441	sp|O35381|AN32A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11994	40.19	3	1966.9183	1966.9183	R	S	13	29
PSM	NSSPAVPAPTPEGVQAVNTTKK	442	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:21	ms_run[2]:scan=10932	37	3	2272.11	2272.1100	R	A	851	873
PSM	QICLVMLETLSQSPQGR	443	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=25714	82.47	3	2038.9581	2038.9581	K	V	161	178
PSM	RGLLYDSSEEDEERPAR	444	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=9469	32.715	3	2100.9113	2100.9113	R	K	133	150
PSM	RGRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	445	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=23467	74.074	4	3944.6837	3944.6837	R	V	192	225
PSM	RKASGPPVSELITK	446	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=7918	28.424	3	1561.8229	1561.8229	K	A	34	48
PSM	RKASGPPVSELITK	447	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=7975	28.596	3	1561.8229	1561.8229	K	A	34	48
PSM	RKASGPPVSELITK	448	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:21	ms_run[2]:scan=8092	28.938	3	1561.8229	1561.8229	K	A	34	48
PSM	RLSVQGQAISVVGSQSTMSPLEEEVPQAK	449	sp|Q80X82|SYMPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=21166	66.706	3	3134.5319	3134.5319	R	R	492	521
PSM	SASADNLILPR	450	sp|Q8BGU5-2|CCNY-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=16055	51.929	2	1235.5911	1235.5911	R	W	299	310
PSM	SASPDDDLGSSNWEAADLGNEERK	451	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=17318	55.348	3	2642.077	2642.0770	R	Q	15	39
PSM	SGVSITIDDPVRTAQVPSPPRGK	452	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:21	ms_run[2]:scan=15619	50.825	3	2456.2425	2456.2425	K	I	920	943
PSM	SGVSITIDDPVRTAQVPSPPRGK	453	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	18-UNIMOD:21	ms_run[2]:scan=15764	51.168	3	2456.2425	2456.2425	K	I	920	943
PSM	SLSPLSGTTDTKAESPAGR	454	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	3-UNIMOD:21	ms_run[2]:scan=10180	35.019	2	1953.9045	1953.9045	R	V	423	442
PSM	SVPTVDSGNEDDDSSFKIK	455	sp|Q05D44|IF2P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:21	ms_run[2]:scan=13244	43.622	3	2118.8994	2118.8994	K	T	209	228
PSM	TVETRDGQVINETSQHHDDLE	456	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7367	26.9	4	2422.0997	2422.0997	K	-	446	467
PSM	KASGPPVSELITK	457	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=11468	38.519818	3	1405.722689	1405.721798	R	A	34	47
PSM	RKTSGPPVSELITK	458	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:21	ms_run[1]:scan=8008	28.685047	3	1591.833841	1591.833473	K	A	33	47
PSM	ERSPALKSPLQSVVVR	459	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=12692	42.039601	3	1844.988460	1844.987348	R	R	246	262
PSM	ERSPALKSPLQSVVVR	460	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=12823	42.389018	3	1844.988460	1844.987348	R	R	246	262
PSM	ERSPALKSPLQSVVVR	461	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=12885	42.558317	3	1844.988460	1844.987348	R	R	246	262
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	462	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21859	68.61213	4	3914.635345	3913.648853	R	I	245	277
PSM	HAVSEGTKAVTKYTSSK	463	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=2433	11.128472	4	1792.929604	1792.931927	K	-	110	127
PSM	SETAPVAQAASTATEKPAAAK	464	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=13339	43.958343	2	2121.0004	2120.9986	M	K	2	23
PSM	ASGVAVSDGVIKVFNDMK	465	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29323	91.95697	2	1957.9219	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIK	466	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18451	58.500321	2	1223.5803	1223.5794	M	V	2	14
PSM	ASGQAFELILSPR	467	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=22472	70.833235	2	1467.713010	1467.712296	R	S	15	28
PSM	ASGQAFELILSPR	468	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=22431	70.663034	2	1467.713010	1467.712296	R	S	15	28
PSM	ASGQAFELILSPR	469	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	29.0	11-UNIMOD:21	ms_run[1]:scan=22388	70.490358	2	1467.713010	1467.712296	R	S	15	28
PSM	SGEDEQQEQTIAEDLVVTKYK	470	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=23195	73.339166	3	2531.1323	2531.1311	M	M	2	23
PSM	ATPPKRFCPSPSTSSEGTR	471	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=8602	30.430168	3	2183.9667	2183.9666	M	I	2	21
PSM	AASENSQDAFRVVSTSGEQLK	472	sp|Q03267-2|IKZF1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=14973	49.076	3	2303.0431	2303.0431	R	V	206	227
PSM	DGRGAAQNIIPASTGAAK	473	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7711	27.856	3	1696.8856	1696.8856	R	A	196	214
PSM	DRGGDTSDTESSIIIR	474	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=11580	38.835	3	1800.7891	1800.7891	R	R	308	324
PSM	DRGGDTSDTESSIIIR	475	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=11634	39.006	3	1800.7891	1800.7891	R	R	308	324
PSM	ELEKRASGQAFELILSPR	476	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=19499	61.725	3	2203.0439	2203.0440	K	S	10	28
PSM	ESTESSPGKHLVTSEELISEGK	477	tr|A0A0A6YVU1|A0A0A6YVU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=13086	43.124	3	2423.1105	2423.1105	R	W	5	27
PSM	GHLSRPEAQSLSPYTTSANR	478	sp|Q9R190|MTA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:21	ms_run[2]:scan=8998	31.407	3	2251.0383	2251.0383	R	A	424	444
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	479	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=20727	65.292	3	3090.4005	3090.4005	K	S	1028	1055
PSM	GLLYDSSEEDEERPAR	480	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=12362	41.14	2	1944.8102	1944.8102	R	K	134	150
PSM	GLSASLPDLDSESWIEVK	481	tr|Z4YJT3|Z4YJT3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=26869	86.349	2	2024.9344	2024.9344	K	K	521	539
PSM	GRHLSHPEPEQQHVIQR	482	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:21	ms_run[2]:scan=3139	13.907	4	2127.0123	2127.0123	R	L	652	669
PSM	GSYRGGSISVQVNSVKFDSE	483	tr|A0A286YDA2|A0A286YDA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:21	ms_run[2]:scan=16135	52.131	3	2194.9896	2194.9896	R	-	681	701
PSM	HQGVMVGMGQKDSYVGDEAQSK	484	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7968	28.573	4	2350.0682	2350.0682	R	R	40	62
PSM	ILDEIEEHSIKIYHLPDAESDEDEDFKEQTR	485	tr|E9Q3V6|E9Q3V6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:21	ms_run[2]:scan=19316	61.252	4	3822.7149	3822.7149	R	L	159	190
PSM	IYHLPDAESDEDEDFKEQTR	486	tr|E9Q3V6|E9Q3V6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=14268	47.038	3	2516.0381	2516.0381	K	L	170	190
PSM	KFPDRLADDEGDSDSESVGQSR	487	sp|Q9Z277-2|BAZ1B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=10192	35.05	3	2489.0344	2489.0344	R	G	1154	1176
PSM	KNEPEDEEEEEEEEEEEDDEEEEEDEE	488	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12197	40.731	3	3398.1609	3398.1609	K	-	184	211
PSM	LKQLSVPASDEEDEVPAPIPR	489	tr|G3V012|G3V012_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:21	ms_run[2]:scan=17532	55.961	3	2369.1516	2369.1516	R	G	4	25
PSM	LSGSGPAELAELSAGEDDELESEPVSK	490	tr|Q8QZW8|Q8QZW8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:21	ms_run[2]:scan=21606	67.846	3	2795.2274	2795.2274	R	S	185	212
PSM	LSRQPSIELPSMAVASTK	491	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=13789	45.664	3	2009.9857	2009.9857	K	T	236	254
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	492	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	19-UNIMOD:21	ms_run[2]:scan=16010	51.808	4	3318.5816	3318.5816	R	S	2386	2416
PSM	QISQDVKLEPDILLR	493	sp|Q9DBT5|AMPD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=21454	67.402	3	1845.9601	1845.9601	R	A	85	100
PSM	RQQDPSPGSNLGGGDDLKLR	494	sp|Q08024-4|PEBB-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:21	ms_run[2]:scan=10179	35.017	4	2189.0226	2189.0226	R	-	129	149
PSM	SGVSITIDDPVRTAQVPSPPRGK	495	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:21	ms_run[2]:scan=15551	50.653	3	2456.2425	2456.2425	K	I	920	943
PSM	SIEVENDFLPVEK	496	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21	ms_run[2]:scan=22276	70.075	2	1597.7277	1597.7277	R	T	171	184
PSM	SKKGGEFDEFVNDDTDDDLPVSK	497	sp|Q62018-3|CTR9-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:21	ms_run[2]:scan=16590	53.329	3	2636.1167	2636.1167	R	K	866	889
PSM	SRSDVDMDPGSATAVLGPTR	498	tr|F6ZN61|F6ZN61_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:21	ms_run[2]:scan=15088	49.432	3	2110.9354	2110.9354	R	R	111	131
PSM	SVPTVDSGNEDDDSSFKIK	499	sp|Q05D44|IF2P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:21	ms_run[2]:scan=13341	43.964	3	2118.8994	2118.8994	K	T	209	228
PSM	TFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIK	500	tr|F6YB25|F6YB25_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	18-UNIMOD:21	ms_run[2]:scan=27764	88.784	3	3918.7248	3918.7248	R	A	49	83
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	501	tr|D3YWA4|D3YWA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=21518	67.575	3	2685.1041	2685.1041	K	M	39	63
PSM	TVETRDGQVINETSQHHDDLE	502	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7361	26.882	3	2422.0997	2422.0997	K	-	446	467
PSM	TVSDNSLSSSKEGKPELR	503	sp|Q80TY0-5|FNBP1-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:21	ms_run[2]:scan=5940	22.753	3	2012.9416	2012.9416	R	F	294	312
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	504	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	25-UNIMOD:21	ms_run[1]:scan=26622	85.509218	4	3734.886353	3734.884195	R	M	46	81
PSM	KASGPPVSELITK	505	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=11284	37.994463	2	1405.722657	1405.721798	R	A	34	47
PSM	KASGPPVSELITK	506	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=11583	38.842217	2	1405.722657	1405.721798	R	A	34	47
PSM	KASGPPVSELITK	507	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21	ms_run[1]:scan=11341	38.16181	2	1405.722657	1405.721798	R	A	34	47
PSM	RKTSGPPVSELITK	508	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:21	ms_run[1]:scan=8068	28.858784	3	1591.833841	1591.833473	K	A	33	47
PSM	ERSPALKSPLQSVVVR	509	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=13851	45.831953	3	1924.956083	1924.953679	R	R	246	262
PSM	RADALTSSPGRDLPPFEDESEGLLGTEGPMEEEEDGEELIGDGMER	510	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	8-UNIMOD:21	ms_run[1]:scan=26589	85.412369	4	5041.1683	5041.1637	R	D	34	80
PSM	ASGVAVSDGVIKVFNDMK	511	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26772	86.019282	2	1957.9228	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	512	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29314	91.927379	3	1957.9225	1957.9215	M	V	2	20
PSM	ASGVAVSDGVIK	513	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18509	58.674416	2	1223.5803	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	514	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18275	57.984691	2	1223.5803	1223.5794	M	V	2	14
PSM	SGEDEQQEQTIAEDLVVTK	515	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25425	81.436462	3	2239.9738	2239.9728	M	Y	2	21
PSM	HIAEEADRKYEEVAR	516	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=4769	19.442456	4	1814.891057	1814.891125	K	K	117	132
PSM	SGDEMIFDPTMSKKK	517	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=17386	55.541641	3	1834.7884	1834.7877	M	K	2	17
PSM	GAPDPRVDDDSLGEFPVSNSR	518	sp|Q61103|REQU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	28.0	11-UNIMOD:21	ms_run[1]:scan=16240	52.399615	3	2308.997164	2308.996135	R	A	132	153
PSM	ANSFVGTAQYVSPELLTEK	519	tr|F2Z3Z9|F2Z3Z9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=23203	73.357	2	2133.0031	2133.0031	R	S	115	134
PSM	ASSPPDRIDIFGR	520	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=16966	54.298	3	1509.6977	1509.6977	R	T	55	68
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	521	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=18483	58.593	4	4287.8937	4287.8937	K	S	104	143
PSM	DRGGDTSDTESSIIIR	522	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=11518	38.662	3	1800.7891	1800.7891	R	R	308	324
PSM	DSSSVEKVLDQKEHR	523	sp|Q99020|ROAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5816	22.345	4	1755.8751	1755.8751	K	L	125	140
PSM	EAQVNVRMDSFDEDLARPSGLLAQER	524	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:21	ms_run[2]:scan=21525	67.592	4	3025.3965	3025.3965	R	K	563	589
PSM	EGINPGYDDYADSDEDQHDAYLER	525	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=16859	54.023	3	2866.0879	2866.0879	K	M	432	456
PSM	GAPDPRVDDDSLGEFPVSNSR	526	tr|F8WIP7|F8WIP7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:21	ms_run[2]:scan=16307	52.575	3	2308.9961	2308.9961	R	A	88	109
PSM	GEEPDVRYDFEPYVSNNSWSPIMR	527	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	20-UNIMOD:21	ms_run[2]:scan=24942	79.619	3	2966.2582	2966.2582	R	T	549	573
PSM	GLLYDSSEEDEERPAR	528	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=12370	41.163	3	1944.8102	1944.8102	R	K	134	150
PSM	GLLYDSSEEDEERPAR	529	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=12441	41.339	3	1944.8102	1944.8102	R	K	134	150
PSM	GRHLSHPEPEQQHVIQR	530	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=3089	13.736	4	2127.0123	2127.0123	R	L	652	669
PSM	HASAAGFPLSGTATWTLGR	531	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=21654	67.98	3	1979.9255	1979.9255	R	G	70	89
PSM	HLQLAIRNDEELNKLLGR	532	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17273	55.218	4	2131.1862	2131.1862	R	V	83	101
PSM	HLSHPEPEQQHVIQR	533	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=3825	16.327	4	1913.8898	1913.8898	R	L	654	669
PSM	KAPKEELASDLEEMATSSAK	534	tr|A2APD7|A2APD7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=19115	60.616	3	2214.0127	2214.0127	K	R	221	241
PSM	KGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIR	535	sp|Q9CW03|SMC3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=16336	52.656	4	4191.8102	4191.8102	K	V	1059	1100
PSM	KQEFMSDTNLSEHAAIPAR	536	sp|Q8C3J5|DOCK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=13378	44.118	3	2223.9984	2223.9984	R	V	1724	1743
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	537	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:21	ms_run[2]:scan=12465	41.399	4	3097.2826	3097.2826	R	K	9	36
PSM	LASNSPVLPQAFAR	538	tr|A0A0G2JGN6|A0A0G2JGN6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=18280	58	2	1549.7654	1549.7654	R	V	78	92
PSM	LIHTLDDRTQLWASEPGTPPVPTSLPSQNPILK	539	tr|A0A0G2JDF8|A0A0G2JDF8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:21	ms_run[2]:scan=22701	71.657	4	3700.8866	3700.8866	K	N	168	201
PSM	LKDLGHPVEEEDESGDQEDDDDEIDDGDKDQDI	540	sp|Q9Z1Z0-2|USO1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:21	ms_run[2]:scan=14787	48.493	4	3808.4756	3808.4756	K	-	865	898
PSM	LKQLSVPASDEEDEVPAPIPR	541	tr|G3V012|G3V012_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=17413	55.618	3	2369.1516	2369.1516	R	G	4	25
PSM	LKQLSVPASDEEDEVPAPIPR	542	tr|G3V012|G3V012_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=17591	56.131	3	2369.1516	2369.1516	R	G	4	25
PSM	LQEYFSVAAGAGDH	543	sp|Q9D892|ITPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15166	49.642	2	1463.6681	1463.6681	K	-	185	199
PSM	LSRQPSIELPSMAVASTK	544	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=13730	45.496	3	2009.9857	2009.9857	K	T	236	254
PSM	LSRQPSIELPSMAVASTK	545	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=13922	46.014	3	2009.9857	2009.9857	K	T	236	254
PSM	LSSESHHGGSPIHWVLPAGMSAK	546	tr|D6RG95|D6RG95_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:21	ms_run[2]:scan=14692	48.223	4	2464.1359	2464.1359	R	M	410	433
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKR	547	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=14788	48.495	4	3680.5396	3680.5396	R	I	373	406
PSM	NKSVPTVDSGNEDDDSSFKIK	548	sp|Q05D44|IF2P_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=10478	35.762	3	2361.0373	2361.0373	K	T	207	228
PSM	NLDIERPTYTNLNR	549	sp|P68373|TBA1C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12267	40.913	3	1717.8747	1717.8747	R	L	216	230
PSM	QAVDFLCNEGHIYSTVDDDHFKSTDAE	550	tr|Q3TE40|Q3TE40_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=18489	58.611	4	3112.3356	3112.3356	K	-	244	271
PSM	QGSLEPDWGLQPR	551	sp|Q8C708|CP054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=19844	62.662	2	1561.6926	1561.6926	R	V	193	206
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	552	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	24-UNIMOD:21	ms_run[2]:scan=22604	71.351	4	3491.5606	3491.5606	R	T	545	573
PSM	RASGQAFELILSPR	553	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=19619	62.052	3	1623.8134	1623.8134	K	S	14	28
PSM	RHSVNLDEGESAQAVHK	554	sp|E9PVX6-2|KI67-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=3886	16.569	4	1955.8851	1955.8851	R	T	335	352
PSM	RIDISPSTFRK	555	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=9958	34.387	3	1398.7021	1398.7021	R	H	675	686
PSM	RIDISPSTFRK	556	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=10128	34.903	3	1398.7021	1398.7021	R	H	675	686
PSM	RVPSPTPVPKEAIR	557	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:21	ms_run[2]:scan=6702	25.161	3	1625.8654	1625.8654	K	E	2532	2546
PSM	RVSEPVEIGIQVTPDEDDHLLSPTKGICPK	558	sp|Q99PV8-2|BC11B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	22-UNIMOD:21,28-UNIMOD:4	ms_run[2]:scan=19495	61.713	4	3408.6636	3408.6636	R	Q	107	137
PSM	SASPDDDLGSSNWEAADLGNEERKQK	559	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=14817	48.593	3	2898.2305	2898.2305	R	F	15	41
PSM	SGVSITIDDPVRTAQVPSPPRGK	560	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	18-UNIMOD:21	ms_run[2]:scan=15486	50.483	3	2456.2425	2456.2425	K	I	920	943
PSM	SKDPGSPQLNQEAMADGVEGTPWSAEKPR	561	sp|Q3UZA1-2|CPZIP-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:21	ms_run[2]:scan=16628	53.438	4	3161.4125	3161.4125	K	R	181	210
PSM	TDSREDEISPPPPNPVVK	562	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:21	ms_run[2]:scan=11033	37.273	3	2055.9514	2055.9514	R	G	75	93
PSM	TGIRTDSREDEISPPPPNPVVK	563	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:21	ms_run[2]:scan=11147	37.584	3	2483.2057	2483.2057	K	G	71	93
PSM	VRHFSQSEDTGNEVFGALHEEQPLPR	564	sp|Q6GYP7-4|RGPA1-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:21	ms_run[2]:scan=16506	53.107	4	3058.3934	3058.3934	R	S	768	794
PSM	YLSFTPPEKDGFPSGTPALNTK	565	sp|Q8CIN4|PAK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:21	ms_run[2]:scan=21049	66.332	3	2446.1458	2446.1458	K	G	139	161
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	566	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=20673	65.118408	3	3091.401923	3090.400547	K	S	1028	1055
PSM	SETAPAAPAAPAPVEKTPVKK	567	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9122	31.692189	3	2181.1088	2181.1077	M	K	2	23
PSM	SETAPAAPAAPAPVEKTPVK	568	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12082	40.445505	3	2053.0141	2053.0128	M	K	2	22
PSM	RKTSGPPVSELITK	569	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=7949	28.508928	3	1591.833841	1591.833473	K	A	33	47
PSM	RKTSGPPVSELITK	570	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=7892	28.338656	3	1591.833841	1591.833473	K	A	33	47
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	571	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20792	65.49667	4	3913.649129	3913.648853	R	I	245	277
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	572	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21912	68.782656	4	3914.635345	3913.648853	R	I	245	277
PSM	AETLSGLGDASAAGAAAVSSAASETGTRR	573	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=23299	73.585173	3	2756.2636	2756.2609	M	L	2	31
PSM	SVVSFDKVKESR	574	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:21	ms_run[1]:scan=8245	29.398637	3	1459.707930	1459.707210	R	K	623	635
PSM	ASGVAVSDGVIK	575	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18341	58.155778	2	1223.5803	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIKVFNDMKVR	576	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=26240	84.289228	4	2251.0391	2251.0468	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	577	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26179	84.108296	2	2213.0926	2213.0910	M	K	2	22
PSM	LGEESKEPLSDEDEEDNDDVEPISEFR	578	tr|Q923F1|Q923F1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	10-UNIMOD:21	ms_run[1]:scan=19903	62.832859	3	3201.288241	3201.303454	K	F	91	118
PSM	AAAAAAAAAAGDSDSWDADTFSMEDPVRK	579	sp|Q3UGC7|EI3JA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=25781	82.715583	3	2989.2420	2989.2432	M	V	2	31
PSM	CRELPVSYDSTSTESLYPR	580	sp|O54957|LAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=17098	54.697284	3	2340.018359	2339.014093	R	S	30	49
PSM	AGRESPPPSAPSMAPISFGFTR	581	sp|Q56A08|GPKOW_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	27.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=24394	77.52109	3	2381.0870	2381.0870	M	T	2	24
PSM	NLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALR	582	sp|Q60787|LCP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0	14-UNIMOD:21	ms_run[1]:scan=27133	87.200008	4	4736.283570	4736.279968	R	K	397	438
PSM	HLQLAIRNDEELNKLLGR	583	sp|C0HKE1|H2A1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19930	62.898825	4	2132.171128	2131.186185	R	V	83	101
PSM	TEDSVRNYEDGMEVETTPTVAGQFEDADVDH	584	sp|Q61189|ICLN_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19609	62.023939	3	3458.462911	3455.458318	R	-	206	237
PSM	AAKPCPTEASPPAASPSGDSSPPATAPYDPR	585	tr|A0A1B0GRU3|A0A1B0GRU3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=11576	38.827	3	3129.3751	3129.3751	R	V	971	1002
PSM	AGGQAPSSPSYENSLHSLQSR	586	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:21	ms_run[2]:scan=12702	42.074	3	2251.9859	2251.9859	R	M	209	230
PSM	AGSPNPQSSSGELPRKDWTEAPGLEPPATSLSTVAK	587	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=18578	58.889	4	3741.7887	3741.7887	R	G	21	57
PSM	ASSPPDRIDIFGR	588	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=16903	54.123	3	1509.6977	1509.6977	R	T	55	68
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	589	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23768	75.21	3	3450.4641	3450.4641	R	-	226	256
PSM	DNLTLWTSDTQGDEAEAGEGGEN	590	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21793	68.409	2	2407.9888	2407.9888	R	-	223	246
PSM	ERASSPPDRIDIFGR	591	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21	ms_run[2]:scan=13863	45.861	3	1794.8414	1794.8414	R	T	53	68
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	592	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:21	ms_run[2]:scan=16257	52.448	3	3275.3151	3275.3151	K	L	145	174
PSM	GLKLTFDSSFSPNTGKK	593	tr|F2Z471|F2Z471_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:21	ms_run[2]:scan=14959	49.028	3	1905.9237	1905.9237	R	N	94	111
PSM	HKMSPPPSSFNEPR	594	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21	ms_run[2]:scan=5789	22.251	3	1689.7334	1689.7334	R	S	363	377
PSM	HKMSPPPSSFNEPR	595	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21	ms_run[2]:scan=5942	22.759	3	1689.7334	1689.7334	R	S	363	377
PSM	HKMSPPPSSFNEPR	596	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21	ms_run[2]:scan=5985	22.929	3	1689.7334	1689.7334	R	S	363	377
PSM	KAPKEELASDLEEMATSSAK	597	tr|A2APD7|A2APD7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21	ms_run[2]:scan=19171	60.785	3	2214.0127	2214.0127	K	R	221	241
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	598	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=7731	27.915	4	3400.4593	3400.4593	R	G	575	609
PSM	KHPDASVNFSEFSKK	599	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6447	24.479	4	1719.858	1719.8580	K	C	30	45
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	600	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:21	ms_run[2]:scan=24975	79.748	3	2990.3223	2990.3223	K	T	1561	1587
PSM	LISWYDNEYGYSNR	601	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18640	59.091	2	1778.79	1778.7900	K	V	308	322
PSM	LSRQPSIELPSMAVASTK	602	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:21	ms_run[2]:scan=17464	55.762	3	1993.9908	1993.9908	K	T	236	254
PSM	RHTDPVQLQAAGR	603	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=4102	17.275	3	1527.7307	1527.7307	R	V	252	265
PSM	RIDISPSTFRK	604	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:21	ms_run[2]:scan=10008	34.559	3	1398.7021	1398.7021	R	H	675	686
PSM	RKSELPQDVYTIK	605	tr|Q91V89|Q91V89_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=9340	32.301	3	1655.8284	1655.8284	R	A	563	576
PSM	RSASPDDDLGSSNWEAADLGNEER	606	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:21	ms_run[2]:scan=17368	55.49	3	2670.0831	2670.0831	K	K	14	38
PSM	RVPSPTPVPKEAIR	607	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:21	ms_run[2]:scan=6770	25.332	3	1625.8654	1625.8654	K	E	2532	2546
PSM	RYSWGTVEVENPHHCDFLNLRR	608	tr|A0A0U1RQA1|A0A0U1RQA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=16658	53.517	4	2864.2966	2864.2966	R	M	211	233
PSM	SFKLSGFSFKK	609	sp|P26645|MARCS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:21	ms_run[2]:scan=15148	49.595	3	1354.6686	1354.6686	K	S	156	167
PSM	SIEVENDFLPVEK	610	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:21	ms_run[2]:scan=22232	69.898	2	1597.7277	1597.7277	R	T	171	184
PSM	SRSGEGEVSGLLR	611	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=11130	37.537	3	1425.6613	1425.6613	R	K	471	484
PSM	SSPKEEVASEPEEAASPTTPK	612	tr|A2APD7|A2APD7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21	ms_run[2]:scan=7527	27.326	3	2249.9941	2249.9941	K	K	244	265
PSM	TASFSESRADEVAPAKK	613	tr|Q3TS02|Q3TS02_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=5727	22.067	3	1872.8619	1872.8619	R	A	453	470
PSM	TDSREDEISPPPPNPVVK	614	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:21	ms_run[2]:scan=10969	37.103	3	2055.9514	2055.9514	R	G	75	93
PSM	TVSDNSLSSSKEGKPELR	615	sp|Q80TY0-5|FNBP1-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=5891	22.584	3	2012.9416	2012.9416	R	F	294	312
PSM	YHGHSMSDPGVSYR	616	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:21	ms_run[2]:scan=5692	21.958	3	1671.6501	1671.6501	R	T	289	303
PSM	YHGHSMSDPGVSYRTREEIQEVR	617	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11061	37.35	4	2892.2052	2892.2052	R	S	289	312
PSM	YLSFTPPEKDGFPSGTPALNTK	618	sp|Q8CIN4|PAK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:21	ms_run[2]:scan=20947	65.994	3	2446.1458	2446.1458	K	G	139	161
PSM	KASGPPVSELITK	619	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=11344	38.16891	3	1405.722689	1405.721798	R	A	34	47
PSM	KASGPPVSELITK	620	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21	ms_run[1]:scan=11528	38.690509	3	1405.722689	1405.721798	R	A	34	47
PSM	ERSPALKSPLQSVVVR	621	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=13786	45.656725	3	1924.956083	1924.953679	R	R	246	262
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	622	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21575	67.748373	4	3913.649000	3913.648853	R	I	245	277
PSM	HAVSEGTKAVTKYTSSK	623	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=2474	11.300745	4	1792.929604	1792.931927	K	-	110	127
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	624	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=21741	68.23287	4	3060.465639	3059.461764	R	L	162	189
PSM	ASGQAFELILSPR	625	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:21	ms_run[1]:scan=22513	71.003655	2	1467.713010	1467.712296	R	S	15	28
PSM	SDAAVDTSSEITTKDLK	626	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=13506	44.630571	2	1821.8844	1821.8838	M	E	2	19
PSM	DGEIKKAGSDGDIMDSSTETPPISIK	627	sp|Q3V3V9|CARL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	9-UNIMOD:21	ms_run[1]:scan=16102	52.049719	3	2771.262687	2770.261988	K	S	1126	1152
PSM	MEIQSGPQPGSPGRAER	628	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=12723	42.120807	3	1917.8403	1917.8399	-	L	1	18
PSM	EAQQKVPDEEENEESDTETSTSDSAAEAGPTFNYLLDMPLWYLTK	629	sp|Q01320|TOP2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	15-UNIMOD:21	ms_run[1]:scan=36297	105.54624	4	5158.2302	5158.2321	K	E	1091	1136
PSM	AAAAAAAAAAGDSDSWDADTFSMEDPVRK	630	sp|Q3UGC7|EI3JA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=25689	82.373317	3	2989.2420	2989.2432	M	V	2	31
PSM	LKGQEDSLASAVDATTGQEACDSD	631	sp|Q8R344|CCD12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	21-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=18857	59.800342	3	2547.032575	2547.031988	R	-	143	167
PSM	LKDLGHPVEEEDESGDQEDDDDEIDDGDKDQDI	632	sp|Q9Z1Z0|USO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	14-UNIMOD:21	ms_run[1]:scan=14726	48.319627	4	3808.477255	3808.475618	K	-	927	960
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	633	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=18435	58.447317	4	3740.591388	3740.585918	R	I	372	405
PSM	AAVFDLDLETEEGSEGEGEPEFSPADVCPLGELR	634	sp|Q9Z1M4|KS6B2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1,23-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=36382	105.73342	3	3786.6182	3785.6172	M	A	2	36
PSM	HLQLAIRNDEELNKLLGR	635	sp|C0HKE1|H2A1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19989	63.073891	4	2132.171128	2131.186185	R	V	83	101
PSM	AASENSQDAFRVVSTSGEQLK	636	sp|Q03267-2|IKZF1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:21	ms_run[2]:scan=14920	48.905	3	2303.0431	2303.0431	R	V	206	227
PSM	ALAAAGYDVEKNNSR	637	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5725	22.064	3	1577.7798	1577.7798	K	I	65	80
PSM	ALHKLQEYFSVAAGAGDH	638	sp|Q9D892|ITPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14615	48.004	3	1912.9432	1912.9432	R	-	181	199
PSM	ARTELESPEESGPPEDEEDAEDFVIDGGPEEAAAKEEEQR	639	tr|A0A494BB21|A0A494BB21_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:21	ms_run[2]:scan=21270	66.985	4	4465.8718	4465.8718	R	C	94	134
PSM	ASGSPPLLPAPDPVSLESEPIAEDGALGPPEPIQGTAQPVKR	640	sp|Q8VBT9-3|ASPC1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:21	ms_run[2]:scan=24592	78.315	4	4264.1304	4264.1304	R	S	395	437
PSM	CQSPILHSSSSASSNIPSATNQKPQPQNQNIPR	641	sp|D0QMC3|MNDAL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10966	37.096	4	3652.7053	3652.7053	R	G	274	307
PSM	DGRGAAQNIIPASTGAAK	642	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7649	27.679	3	1696.8856	1696.8856	R	A	196	214
PSM	DNLTLWTSDTQGDEAEAGEGGEN	643	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21904	68.759	2	2407.9888	2407.9888	R	-	223	246
PSM	DNLTLWTSENQGDEGDAGEGEN	644	sp|Q9CQV8-2|1433B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20986	66.126	2	2349.9469	2349.9469	R	-	223	245
PSM	ELEKRASGQAFELILSPR	645	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:21	ms_run[2]:scan=17790	56.658	3	2123.0776	2123.0776	K	S	10	28
PSM	FHDSEGDDTEETEDYRQFRK	646	tr|A0A087WRN1|A0A087WRN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=8835	31.019	4	2583.0187	2583.0187	K	S	105	125
PSM	GAPDPRVDDDSLGEFPVSNSR	647	tr|F8WIP7|F8WIP7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:21	ms_run[2]:scan=16372	52.744	3	2308.9961	2308.9961	R	A	88	109
PSM	HKMSPPPSSFNEPR	648	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=5675	21.905	3	1689.7334	1689.7334	R	S	363	377
PSM	HLQLAIRNDEELNKLLGR	649	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16925	54.176	4	2131.1862	2131.1862	R	V	83	101
PSM	HLSHPEPEQQHVIQR	650	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=3776	16.152	4	1913.8898	1913.8898	R	L	654	669
PSM	ISSFENFGSSQLPDRGVQR	651	sp|O54824-2|IL16-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=16936	54.205	3	2203.0059	2203.0059	R	L	139	158
PSM	KNEPEDEEEEEEEEEEEDDEEEEEDEE	652	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12263	40.904	3	3398.1609	3398.1609	K	-	184	211
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	653	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	20-UNIMOD:21,37-UNIMOD:4	ms_run[2]:scan=25902	83.166	3	3763.7863	3763.7863	R	V	592	630
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEDEEDVK	654	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=14094	46.477	4	3686.5931	3686.5931	R	L	102	135
PSM	LKELFDYSPPLHK	655	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:21	ms_run[2]:scan=16279	52.504	3	1665.8168	1665.8168	K	S	216	229
PSM	NSSPAVPAPTPEGVQAVNTTKK	656	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:21	ms_run[2]:scan=10877	36.833	3	2272.11	2272.1100	R	A	851	873
PSM	QICLVMLETLSQSPQGR	657	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=25715	82.472	2	2038.9581	2038.9581	K	V	161	178
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	658	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	24-UNIMOD:21	ms_run[2]:scan=22757	71.86	4	3491.5606	3491.5606	R	T	545	573
PSM	QPSIELPSMAVASTK	659	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=20444	64.445	2	1637.7736	1637.7736	R	T	239	254
PSM	QPSIELPSMAVASTK	660	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=20557	64.791	2	1637.7736	1637.7736	R	T	239	254
PSM	RASGQAFELILSPR	661	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=19553	61.882	3	1623.8134	1623.8134	K	S	14	28
PSM	RGSSVALMLDVQSLGTVEPICSVNTPR	662	sp|Q8BUM3|PTN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=25484	81.648	3	2965.4402	2965.4402	R	E	42	69
PSM	RHTDPVQLQAAGR	663	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=4047	17.103	3	1527.7307	1527.7307	R	V	252	265
PSM	RISGLIYEETRGVLK	664	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=19357	61.361	3	1812.9499	1812.9499	K	V	46	61
PSM	RISGLIYEETRGVLK	665	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=19426	61.532	3	1812.9499	1812.9499	K	V	46	61
PSM	RKSELPQDVYTIK	666	tr|Q91V89|Q91V89_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=9392	32.474	3	1655.8284	1655.8284	R	A	563	576
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	667	sp|Q99LI7|CSTF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:21	ms_run[2]:scan=11298	38.027	4	2845.2556	2845.2556	K	A	686	710
PSM	RQSLEVAAPEGPKMER	668	tr|Q9D3Q7|Q9D3Q7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=8731	30.786	3	1876.8866	1876.8866	R	Q	37	53
PSM	RVPSPTPVPKEAIR	669	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:21	ms_run[2]:scan=6640	24.993	3	1625.8654	1625.8654	K	E	2532	2546
PSM	SASADNLILPR	670	sp|Q8BGU5-2|CCNY-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=15990	51.76	2	1235.5911	1235.5911	R	W	299	310
PSM	SASADNLILPR	671	sp|Q8BGU5-2|CCNY-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=16122	52.101	2	1235.5911	1235.5911	R	W	299	310
PSM	SESLIDASEDSQLEAAIR	672	sp|Q6P5G6|UBXN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:21	ms_run[2]:scan=22684	71.605	2	2012.894	2012.8940	R	A	256	274
PSM	SKLDWESFKEEEGIGEELAIHNR	673	sp|O88271|CFDP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:21	ms_run[2]:scan=20453	64.472	4	2795.2804	2795.2804	K	G	240	263
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	674	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:21	ms_run[2]:scan=21550	67.665	4	4195.8998	4195.8998	R	D	224	260
PSM	SLSPLSGTTDTKAESPAGRVSDESVLPLAQK	675	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=18147	57.63	4	3220.5864	3220.5864	R	S	423	454
PSM	SNSVEKPVSSLLSR	676	sp|P70429-2|EVL-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=13757	45.575	3	1581.7764	1581.7764	R	V	327	341
PSM	SRSGEGEVSGLLR	677	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=11134	37.545	2	1425.6613	1425.6613	R	K	471	484
PSM	TAHNSEADLEESFNEHELEPSSPKTK	678	sp|Q9D4J7-2|PHF6-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	21-UNIMOD:21	ms_run[2]:scan=13045	43.016	4	3005.2928	3005.2928	K	K	54	80
PSM	TGIRTDSREDEISPPPPNPVVK	679	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=10946	37.041	4	2483.2057	2483.2057	K	G	71	93
PSM	TGIRTDSREDEISPPPPNPVVK	680	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:21	ms_run[2]:scan=11087	37.415	3	2483.2057	2483.2057	K	G	71	93
PSM	TPLATIADQQQLQLSPLKR	681	sp|P11157|RIR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:21	ms_run[2]:scan=19415	61.508	3	2200.1617	2200.1617	R	L	6	25
PSM	TSSLTHSEEKSSGFR	682	sp|Q9CT10|RANB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=3821	16.316	3	1731.7465	1731.7465	R	L	56	71
PSM	VAPEEHPVLLTEAPLNPK	683	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14189	46.791	3	1953.0571	1953.0571	R	A	96	114
PSM	YHGHSMSDPGVSYR	684	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:21	ms_run[2]:scan=5632	21.782	3	1671.6501	1671.6501	R	T	289	303
PSM	YRSPEPDPYLSYR	685	tr|A0A1L1STP6|A0A1L1STP6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=13076	43.093	3	1721.7451	1721.7451	R	W	31	44
PSM	YRSPEPDPYLSYR	686	tr|A0A1L1STP6|A0A1L1STP6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:21	ms_run[2]:scan=13134	43.262	3	1721.7451	1721.7451	R	W	31	44
PSM	KASGPPVSELITK	687	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=11224	37.81986	2	1405.722657	1405.721798	R	A	34	47
PSM	KASGPPVSELITK	688	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21	ms_run[1]:scan=11403	38.345709	3	1405.722689	1405.721798	R	A	34	47
PSM	SETAPAAPAAPAPAEKTPVKK	689	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=7734	27.92211	3	2153.0771	2153.0764	M	K	2	23
PSM	RKTSGPPVSELITK	690	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=8129	29.032933	3	1591.833841	1591.833473	K	A	33	47
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	691	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21957	68.952211	4	3914.635345	3913.648853	R	I	245	277
PSM	HAVSEGTKAVTKYTSSK	692	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2418	11.078076	4	1792.929604	1792.931927	K	-	110	127
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	693	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=26202	84.187364	3	3764.793511	3763.786332	R	V	592	630
PSM	SVVSFDKVKESR	694	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=8302	29.569159	3	1459.707930	1459.707210	R	K	623	635
PSM	SVVSFDKVKESR	695	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21	ms_run[1]:scan=8358	29.744264	3	1459.707930	1459.707210	R	K	623	635
PSM	ASGVAVSDGVIKVFNDMKVR	696	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=25940	83.308348	3	2213.0911	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIK	697	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18208	57.811448	2	1223.5803	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIK	698	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18397	58.327585	2	1223.5803	1223.5794	M	V	2	14
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	699	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10677	36.272643	3	3526.258953	3526.255817	K	-	183	211
PSM	ASGQAFELILSPR	700	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:21	ms_run[1]:scan=22341	70.317301	2	1467.713010	1467.712296	R	S	15	28
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	701	tr|A0A087WR05|A0A087WR05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:21	ms_run[1]:scan=21054	66.345207	4	3174.578183	3174.578452	R	L	26	58
PSM	TQSCETKLLDEKASK	702	sp|O54824|IL16_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=5926	22.704963	3	1816.827659	1816.827796	R	L	965	980
PSM	MEIQSGPQPGSPGRAERLNAR	703	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=13206	43.498963	3	2372.1074	2372.1051	-	L	1	22
PSM	RGSSVALMLDVQSLGTVEPICSVNTPR	704	sp|Q8BUM3|PTN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=25454	81.541157	3	2965.439860	2965.440244	R	E	42	69
PSM	ADGDSGSERGGGGGGGGGPGGFQPAPR	705	sp|O35295|PURB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=10739	36.435862	3	2434.9888	2434.9882	M	G	2	29
PSM	AASLRGGVGAPGSPSTPPTR	706	sp|Q3UYC0-2|PPM1H-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=8414	29.907	3	1914.9313	1914.9313	R	F	208	228
PSM	AASLRGGVGAPGSPSTPPTRFFTEK	707	sp|Q3UYC0-2|PPM1H-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=15063	49.363	4	2567.2534	2567.2534	R	K	208	233
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	708	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=21421	67.324	3	3913.6489	3913.6489	R	I	245	277
PSM	ALSTGEKGFGYKGSSFHR	709	tr|A0A1L1SST0|A0A1L1SST0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6326	24.113	4	1927.9541	1927.9541	R	I	30	48
PSM	AMSGSWERDQQVEAAQR	710	sp|Q9CQV4|RETR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=10858	36.772	3	2027.8521	2027.8521	R	T	24	41
PSM	ASEDESDLEDEEEKSQEDTEQKR	711	sp|P25206|MCM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:21	ms_run[2]:scan=9439	32.627	3	2805.0985	2805.0985	K	K	667	690
PSM	ASSPPDRIDIFGR	712	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=16752	53.779	3	1509.6977	1509.6977	R	T	55	68
PSM	ASSPPDRIDIFGR	713	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=16824	53.948	3	1509.6977	1509.6977	R	T	55	68
PSM	ASSPRPHPEFLQTLCR	714	sp|Q8C3R1|BRAT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=13286	43.762	3	1974.9135	1974.9135	R	L	683	699
PSM	DNLTLWTSDTQGDEAEAGEGGEN	715	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21846	68.578	3	2407.9888	2407.9888	R	-	223	246
PSM	DSSSVEKVLDQKEHR	716	sp|Q99020|ROAA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5761	22.171	4	1755.8751	1755.8751	K	L	125	140
PSM	EFITGDVEPTDAESAWHSENEEEDKLAGDMKNK	717	sp|Q78ZA7|NP1L4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:21	ms_run[2]:scan=19554	61.884	4	3800.6037	3800.6037	R	V	108	141
PSM	GGSISVQVNSVKFDSE	718	tr|A0A286YDA2|A0A286YDA2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:21	ms_run[2]:scan=18010	57.245	2	1731.7717	1731.7717	R	-	685	701
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	719	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:21	ms_run[2]:scan=20780	65.469	3	3090.4005	3090.4005	K	S	1028	1055
PSM	GLSASLPDLDSESWIEVK	720	tr|Z4YJT3|Z4YJT3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=26922	86.519	2	2024.9344	2024.9344	K	K	521	539
PSM	HKMSPPPSSFNEPR	721	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21	ms_run[2]:scan=5559	21.564	3	1689.7334	1689.7334	R	S	363	377
PSM	HKMSPPPSSFNEPR	722	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21	ms_run[2]:scan=5616	21.733	3	1689.7334	1689.7334	R	S	363	377
PSM	HKMSPPPSSFNEPR	723	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21	ms_run[2]:scan=6027	23.101	3	1689.7334	1689.7334	R	S	363	377
PSM	HLQLAIRNDEELNKLLGR	724	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16003	51.788	4	2131.1862	2131.1862	R	V	83	101
PSM	HQGVMVGMGQKDSYVGDEAQSKR	725	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:35	ms_run[2]:scan=4464	18.41	4	2522.1642	2522.1642	R	G	40	63
PSM	IFPDRLSGDTSPPTTPSFPR	726	sp|Q8BLB7-2|LMBL3-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:21	ms_run[2]:scan=18972	60.164	3	2267.0624	2267.0624	R	S	570	590
PSM	KHPDASVNFSEFSKK	727	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6386	24.303	4	1719.858	1719.8580	K	C	30	45
PSM	KISVVSATKGVQAGNSDTEGGQPGR	728	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=8460	30.031	3	2522.2126	2522.2126	R	K	769	794
PSM	KNEPEDEEEEEEEEEEEDDEEEEEDEE	729	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12125	40.559	3	3398.1609	3398.1609	K	-	184	211
PSM	KQEFMSDTNLSEHAAIPAR	730	sp|Q8C3J5|DOCK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:21	ms_run[2]:scan=13421	44.29	3	2223.9984	2223.9984	R	V	1724	1743
PSM	LFMAQALQEYNN	731	sp|Q91WK2|EIF3H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22155	69.616	2	1440.6708	1440.6708	K	-	341	353
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	732	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=18473	58.564	4	4372.9716	4372.9716	R	R	102	142
PSM	LKDLGHPVEEEDESGDQEDDDDEIDDGDKDQDI	733	sp|Q9Z1Z0-2|USO1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:21	ms_run[2]:scan=14769	48.439	3	3808.4756	3808.4756	K	-	865	898
PSM	LKQLSVPASDEEDEVPAPIPR	734	tr|G3V012|G3V012_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:21	ms_run[2]:scan=17352	55.445	3	2369.1516	2369.1516	R	G	4	25
PSM	LQEKLSPPYSSPQEFAQDVGR	735	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:21	ms_run[2]:scan=19734	62.349	3	2455.1421	2455.1421	R	M	747	768
PSM	LSQSSQDSSPVRNLPSFGTEEPAYSTR	736	sp|Q5SVQ0-4|KAT7-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=17805	56.699	3	3019.356	3019.3560	R	R	49	76
PSM	LSQSSQDSSPVRNLPSFGTEEPAYSTR	737	sp|Q5SVQ0-4|KAT7-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=17867	56.869	3	3019.356	3019.3560	R	R	49	76
PSM	NRTPSDVKELVLDNCK	738	sp|O35381|AN32A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11937	40.02	3	1966.9183	1966.9183	R	S	13	29
PSM	NRTPSDVKELVLDNCK	739	sp|O35381|AN32A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=12053	40.365	3	1966.9183	1966.9183	R	S	13	29
PSM	QPSIELPSMAVASTK	740	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=20340	64.103	2	1637.7736	1637.7736	R	T	239	254
PSM	QPSIELPSMAVASTK	741	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=20395	64.276	2	1637.7736	1637.7736	R	T	239	254
PSM	RASGQAFELILSPR	742	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=19686	62.228	3	1623.8134	1623.8134	K	S	14	28
PSM	RIDISPSTFR	743	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=13847	45.823	2	1270.6071	1270.6071	R	K	675	685
PSM	RIDISPSTFR	744	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=13913	45.996	2	1270.6071	1270.6071	R	K	675	685
PSM	RIDISPSTFR	745	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=13978	46.167	2	1270.6071	1270.6071	R	K	675	685
PSM	RIDISPSTFRK	746	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=10061	34.732	3	1398.7021	1398.7021	R	H	675	686
PSM	RIDISPSTFRK	747	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:21	ms_run[2]:scan=10204	35.073	3	1398.7021	1398.7021	R	H	675	686
PSM	RKEDEVEEWQHR	748	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3336	14.615	4	1639.7703	1639.7703	R	A	437	449
PSM	RKTSDANETEDHLESLICK	749	sp|Q3UYV9|NCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=13230	43.574	4	2325.0308	2325.0308	R	V	19	38
PSM	RMSLEGREELPPSVLDEMSLK	750	sp|O89110|CASP8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=20784	65.478	3	2495.1801	2495.1801	R	M	186	207
PSM	RRSIQDLTVTGTEPGQVSSR	751	tr|A2AP93|A2AP93_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=9888	34.14	3	2266.1067	2266.1067	R	S	410	430
PSM	SASPDDDLGSSNWEAADLGNEER	752	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=20411	64.326	3	2513.982	2513.9820	R	K	15	38
PSM	SASPDDDLGSSNWEAADLGNEERKQK	753	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=14667	48.15	4	2898.2305	2898.2305	R	F	15	41
PSM	SGVSITIDDPVRTAQVPSPPRGK	754	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:21	ms_run[2]:scan=15219	49.796	3	2456.2425	2456.2425	K	I	920	943
PSM	SGVSITIDDPVRTAQVPSPPRGK	755	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	18-UNIMOD:21	ms_run[2]:scan=15564	50.682	4	2456.2425	2456.2425	K	I	920	943
PSM	SHHAPMSPGSSGGGGQPLAR	756	sp|A2BH40-3|ARI1A-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:21	ms_run[2]:scan=4589	18.825	3	1966.8469	1966.8469	R	T	359	379
PSM	SIEVENDFLPVEK	757	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=22323	70.248	2	1597.7277	1597.7277	R	T	171	184
PSM	SLSPLSGTTDTKAESPAGR	758	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=10300	35.298	3	1953.9045	1953.9045	R	V	423	442
PSM	SLSPLSGTTDTKAESPAGRVSDESVLPLAQK	759	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=18086	57.458	4	3220.5864	3220.5864	R	S	423	454
PSM	SLSPLSGTTDTKAESPAGRVSDESVLPLAQK	760	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=19669	62.183	3	3300.5528	3300.5528	R	S	423	454
PSM	SLSSPTVTLSAPLEGAKDSPIRR	761	tr|E9PXB7|E9PXB7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=16836	53.972	3	2461.2578	2461.2578	R	A	306	329
PSM	SRKESYSVYVYK	762	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5355	20.944	3	1507.7671	1507.7671	R	V	33	45
PSM	SSGSPYGGGYGSGGGSGGYGSR	763	tr|A2AL12|A2AL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21	ms_run[2]:scan=8903	31.187	2	1989.749	1989.7490	R	R	295	317
PSM	SSGSPYGGGYGSGGGSGGYGSR	764	tr|A2AL12|A2AL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21	ms_run[2]:scan=9134	31.719	2	1989.749	1989.7490	R	R	295	317
PSM	TDSREDEISPPPPNPVVK	765	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:21	ms_run[2]:scan=10912	36.928	3	2055.9514	2055.9514	R	G	75	93
PSM	TDSREDEISPPPPNPVVK	766	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:21	ms_run[2]:scan=11098	37.446	3	2055.9514	2055.9514	R	G	75	93
PSM	TGIRTDSREDEISPPPPNPVVK	767	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=11010	37.213	4	2483.2057	2483.2057	K	G	71	93
PSM	TGIRTDSREDEISPPPPNPVVK	768	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=10957	37.073	3	2483.2057	2483.2057	K	G	71	93
PSM	TGIRTDSREDEISPPPPNPVVK	769	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:21	ms_run[2]:scan=11204	37.756	3	2483.2057	2483.2057	K	G	71	93
PSM	TRSFDNLTTTCENMVPLASR	770	tr|M0QW74|M0QW74_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=19049	60.414	3	2392.0552	2392.0552	K	R	611	631
PSM	TVETRDGQVINETSQHHDDLE	771	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7432	27.069	4	2422.0997	2422.0997	K	-	446	467
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	772	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	20-UNIMOD:35,25-UNIMOD:21	ms_run[2]:scan=25659	82.283	4	3750.8791	3750.8791	R	M	46	81
PSM	VKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVK	773	tr|Q5SQB0|Q5SQB0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15149	49.597	4	4403.6376	4403.6376	K	K	156	193
PSM	VMSSSNPDLTGSHCAADEEVKNIMSSK	774	sp|Q8C147-2|DOCK8-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=17338	55.403	4	2973.2555	2973.2555	R	I	535	562
PSM	YRSPEPDPYLSYR	775	tr|A0A1L1STP6|A0A1L1STP6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:21	ms_run[2]:scan=13186	43.433	3	1721.7451	1721.7451	R	W	31	44
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	776	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22411	70.586851	4	4114.7674	4114.7655	K	R	104	142
PSM	HQGVMVGMGQKDSYVGDEAQSKR	777	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6939	25.744717	4	2507.170969	2506.169291	R	G	40	63
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	778	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20276	63.920707	4	3914.656272	3913.648853	R	I	245	277
PSM	AGSPNPQSSSGELPRKDWTEAPGLEPPATSLSTVAK	779	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=18523	58.719566	4	3741.789011	3741.788715	R	G	21	57
PSM	QPSIELPSMAVASTK	780	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=20498	64.616773	2	1638.776641	1637.773575	R	T	241	256
PSM	ASGVAVSDGVIKVFNDMK	781	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=25797	82.775789	2	1957.9222	1957.9215	M	V	2	20
PSM	AHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	782	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=5057	20.131377	4	2984.284634	2984.284563	R	R	198	233
PSM	SETAPAETAAPAPVEKSPAK	783	sp|P43276|H15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9737	33.611044	2	2072.9672	2072.9662	M	K	2	22
PSM	SGDEMIFDPTMSKKK	784	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=17323	55.366732	3	1834.7884	1834.7877	M	K	2	17
PSM	YVESDDEKPTDENVNEKAATENSENDITMQSLPK	785	sp|Q61687|ATRX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:21	ms_run[1]:scan=15092	49.441037	4	3919.678554	3919.683049	K	G	89	123
PSM	ASGVQVADEVCRIFYDMK	786	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:1,2-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=36305	105.56099	3	2209.9642	2208.9582	M	V	2	20
PSM	LKQLSVPASDEEDEVPAPIPR	787	sp|Q6P542|ABCF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:21	ms_run[1]:scan=17663	56.305901	3	2369.153144	2369.151573	R	G	99	120
PSM	KIQPQLPDEDGNHSDKEDEQPQVVVLK	788	sp|Q8K039|K1143_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	14-UNIMOD:21	ms_run[1]:scan=13096	43.158805	4	3165.507109	3164.502704	K	K	37	64
PSM	LGIAVIHGEAQDAESDLVDGRHSPPMVR	789	sp|Q8R574|KPRB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	23-UNIMOD:21	ms_run[1]:scan=18289	58.023753	4	3048.448339	3048.448834	R	S	205	233
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	790	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	22-UNIMOD:21	ms_run[1]:scan=18965	60.147601	4	3724.589812	3724.591003	R	I	372	405
PSM	KLSVGGDSDPPLKR	791	sp|Q6NZF1|ZC11A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:21	ms_run[1]:scan=6278	23.962862	3	1547.772166	1547.770873	R	S	287	301
PSM	AACEQLHQQQQQQQEETTAATLLLQGEEEGEED	792	sp|P42669|PURA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=21674	68.038	3	3768.6657	3768.6657	R	-	289	322
PSM	AASENSQDAFRVVSTSGEQLKVYK	793	sp|Q03267-2|IKZF1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:21	ms_run[2]:scan=16411	52.845	3	2693.2698	2693.2698	R	C	206	230
PSM	ALQQHQHGYDSDEEVDSELGTWEHQLR	794	sp|Q8CH02|SUGP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:21	ms_run[2]:scan=18424	58.412	4	3286.3953	3286.3953	K	R	473	500
PSM	ASSPRPHPEFLQTLCR	795	sp|Q8C3R1|BRAT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=13235	43.592	3	1974.9135	1974.9135	R	L	683	699
PSM	CSGPGLSPGMVR	796	tr|B7FAV1|B7FAV1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=12995	42.87	2	1296.5356	1296.5356	K	A	1429	1441
PSM	DKFSPTQDRPESSTVLK	797	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:21	ms_run[2]:scan=9118	31.683	3	2013.9409	2013.9409	R	V	1148	1165
PSM	FGSSPQRDPNWIGDR	798	sp|Q8K3W3|CASC3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:21	ms_run[2]:scan=13194	43.455	3	1810.7788	1810.7788	R	S	260	275
PSM	GRLGSTGGKMQGVPLK	799	tr|D3Z4F8|D3Z4F8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:21	ms_run[2]:scan=7442	27.095	3	1664.8433	1664.8433	R	H	43	59
PSM	HIAEEADRKYEEVAR	800	tr|E9Q7Q3|E9Q7Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4651	19.031	3	1814.8911	1814.8911	K	K	117	132
PSM	HLQLAIRNDEELNKLLGR	801	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17110	54.739	3	2131.1862	2131.1862	R	V	83	101
PSM	HLSSTSDDEPLSSVNHAAK	802	tr|D3Z491|D3Z491_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=7330	26.8	3	2073.9004	2073.9004	R	A	25	44
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	803	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=21812	68.462	3	3059.4618	3059.4618	R	L	160	187
PSM	IYHLPDAESDEDEDFKEQTR	804	tr|E9Q3V6|E9Q3V6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:21	ms_run[2]:scan=14215	46.868	3	2516.0381	2516.0381	K	L	170	190
PSM	KGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIR	805	sp|Q9CW03|SMC3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:21	ms_run[2]:scan=16403	52.823	4	4191.8102	4191.8102	K	V	1059	1100
PSM	KHPDSSVNFAEFSKK	806	sp|P30681|HMGB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5765	22.18	4	1719.858	1719.8580	K	C	30	45
PSM	KLSGDLEAGAPK	807	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=6971	25.831	2	1264.6064	1264.6064	R	N	1189	1201
PSM	KTSGPPVSELITK	808	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=11543	38.736	3	1435.7324	1435.7324	R	A	34	47
PSM	KTSGPPVSELITK	809	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=11552	38.763	2	1435.7324	1435.7324	R	A	34	47
PSM	LFMAQALQEYNN	810	sp|Q91WK2|EIF3H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22200	69.784	2	1440.6708	1440.6708	K	-	341	353
PSM	LGPGLPQDGSDEEDEEWPTLEK	811	sp|O54825|BYST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:21	ms_run[2]:scan=23028	72.825	3	2520.0581	2520.0581	R	A	88	110
PSM	LISWYDNEYGYSNR	812	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18590	58.919	2	1778.79	1778.7900	K	V	308	322
PSM	LKELFDYSPPLHK	813	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:21	ms_run[2]:scan=16665	53.539	3	1665.8168	1665.8168	K	S	216	229
PSM	LQEYFSVAAGAGDH	814	sp|Q9D892|ITPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15225	49.81	2	1463.6681	1463.6681	K	-	185	199
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIR	815	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=16329	52.636	4	4149.8409	4149.8409	R	A	373	410
PSM	NIDQSEFEGFSFVNSEFLKPEVKS	816	sp|P68404-2|KPCB-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:21	ms_run[2]:scan=27475	88.16	3	2856.2895	2856.2895	R	-	650	674
PSM	NSSPSPVPGSQNVPAPAVKK	817	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21	ms_run[2]:scan=8335	29.678	3	2040.0041	2040.0041	R	I	130	150
PSM	NSSPSPVPGSQNVPAPAVKK	818	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21	ms_run[2]:scan=8395	29.853	3	2040.0041	2040.0041	R	I	130	150
PSM	NSSPSPVPGSQNVPAPAVKK	819	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=9138	31.728	3	2040.0041	2040.0041	R	I	130	150
PSM	QRSPIALPVKQEPPQIDAVK	820	tr|A2AJT3|A2AJT3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=13914	45.997	3	2293.2195	2293.2195	R	R	209	229
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	821	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=23190	73.329	4	3254.5448	3254.5448	R	L	12	44
PSM	RGSSVALMLDVQSLGTVEPICSVNTPR	822	sp|Q8BUM3|PTN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21,21-UNIMOD:4	ms_run[2]:scan=25422	81.424	3	2965.4402	2965.4402	R	E	42	69
PSM	RIDISPSALR	823	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21	ms_run[2]:scan=12876	42.538	2	1206.6122	1206.6122	R	K	365	375
PSM	RIDISPSALR	824	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21	ms_run[2]:scan=12936	42.707	2	1206.6122	1206.6122	R	K	365	375
PSM	RIDISPSALR	825	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21	ms_run[2]:scan=12997	42.875	2	1206.6122	1206.6122	R	K	365	375
PSM	RIDISPSALR	826	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21	ms_run[2]:scan=13059	43.05	2	1206.6122	1206.6122	R	K	365	375
PSM	RISQVSSGETEYNPGEAR	827	tr|F6ZZB1|F6ZZB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=9141	31.737	3	2058.9008	2058.9008	R	-	1056	1074
PSM	RKSELPQDVYTIK	828	tr|Q91V89|Q91V89_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=9284	32.125	3	1655.8284	1655.8284	R	A	563	576
PSM	RKSELPQDVYTIK	829	tr|Q91V89|Q91V89_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=9447	32.648	3	1655.8284	1655.8284	R	A	563	576
PSM	RMSLEGREELPPSVLDEMSLK	830	sp|O89110|CASP8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=20732	65.305	3	2495.1801	2495.1801	R	M	186	207
PSM	RQEAQQREVDQDDEENSEEDEMDSGTMVR	831	tr|F7BYZ4|F7BYZ4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	17-UNIMOD:21	ms_run[2]:scan=10145	34.94	4	3534.3784	3534.3784	K	A	20	49
PSM	RRSIQDLTVTGTEPGQVSSR	832	tr|A2AP93|A2AP93_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=9939	34.307	3	2266.1067	2266.1067	R	S	410	430
PSM	SEDDSAKFDSNEEDTASVFAPSFGLK	833	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:21	ms_run[2]:scan=23260	73.496	3	2872.1964	2872.1964	K	Q	1444	1470
PSM	SGVSITIDDPVRTAQVPSPPRGK	834	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:21	ms_run[2]:scan=15356	50.144	3	2456.2425	2456.2425	K	I	920	943
PSM	SKPLDQSVEDLSKAPPSSVPK	835	sp|Q9JL26-2|FMNL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:21	ms_run[2]:scan=12029	40.3	3	2288.1301	2288.1301	K	S	152	173
PSM	SNSVKKSQPTLPISTIDER	836	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:21	ms_run[2]:scan=11371	38.252	3	2179.0886	2179.0886	K	L	201	220
PSM	SRKESYSVYVYK	837	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5302	20.775	3	1507.7671	1507.7671	R	V	33	45
PSM	SRKESYSVYVYK	838	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5417	21.126	3	1507.7671	1507.7671	R	V	33	45
PSM	TAHNSEADLEESFNEHELEPSSPKTK	839	sp|Q9D4J7-2|PHF6-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	21-UNIMOD:21	ms_run[2]:scan=12985	42.843	4	3005.2928	3005.2928	K	K	54	80
PSM	TDLTDYLNRHYKAPR	840	sp|Q9CZ13|QCR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12207	40.755	4	1861.9435	1861.9435	R	M	214	229
PSM	TGIRTDSREDEISPPPPNPVVK	841	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:21	ms_run[2]:scan=11075	37.386	4	2483.2057	2483.2057	K	G	71	93
PSM	TGSPGAKIPFSVPEVPLVFQGQTK	842	sp|Q9D8C4|IN35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:21	ms_run[2]:scan=25331	81.059	3	2563.3087	2563.3087	R	Q	34	58
PSM	TVETRDGQVINETSQHHDDLE	843	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7425	27.051	3	2422.0997	2422.0997	K	-	446	467
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	844	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	20-UNIMOD:35,25-UNIMOD:21	ms_run[2]:scan=25611	82.107	4	3750.8791	3750.8791	R	M	46	81
PSM	VVDLMAYMASKE	845	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21408	67.294	2	1355.6465	1355.6465	R	-	322	334
PSM	YHGHSMSDPGVSYRTREEIQEVR	846	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=10998	37.181	4	2892.2052	2892.2052	R	S	289	312
PSM	YRPGTVALREIR	847	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6733	25.232	4	1429.8154	1429.8154	R	R	42	54
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	848	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19862	62.707991	4	4131.794182	4131.792616	K	R	104	142
PSM	KASGPPVSELITK	849	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=11589	38.862475	3	1405.722689	1405.721798	R	A	34	47
PSM	KASGPPVSELITK	850	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=11285	37.995938	3	1405.722689	1405.721798	R	A	34	47
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	851	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21804	68.437694	4	3914.635345	3913.648853	R	I	245	277
PSM	SASPDDDLGSSNWEAADLGNEER	852	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=20238	63.817639	3	2513.983370	2513.982001	R	K	15	38
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	853	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	8-UNIMOD:21	ms_run[1]:scan=24925	79.560428	3	2990.324089	2990.322280	K	T	1561	1587
PSM	AASAAATAAASAATAASAASGSPGSGEGSAGGEK	854	sp|Q62318|TIF1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,22-UNIMOD:21	ms_run[1]:scan=22840	72.152356	3	2842.2269	2842.2249	M	R	2	36
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	855	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=21792	68.406721	4	3060.465414	3059.461764	R	L	162	189
PSM	ASGVAVSDGVIKVFNDMKVR	856	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26111	83.878857	3	2213.0915	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	857	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24039	76.203671	3	1973.9171	1973.9164	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	858	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29047	91.239802	3	1957.9225	1957.9215	M	V	2	20
PSM	MEGHDPKEPEQLRK	859	sp|Q8BG05-2|ROA3-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=5099	20.227476	4	1734.8357	1734.8354	-	L	1	15
PSM	ASGQAFELILSPR	860	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21	ms_run[1]:scan=22296	70.148994	2	1467.713010	1467.712296	R	S	15	28
PSM	KLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQR	861	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=14466	47.615775	4	3956.922509	3956.922404	R	Y	184	218
PSM	SDAAVDTSSEITTKDLK	862	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,7-UNIMOD:21	ms_run[1]:scan=14495	47.687819	2	1901.8506	1901.8502	M	E	2	19
PSM	SGDEMIFDPTMSK	863	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=26091	83.80942	2	1578.5978	1578.5978	M	K	2	15
PSM	SGDEMIFDPTMSK	864	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=26040	83.636476	2	1578.5978	1578.5978	M	K	2	15
PSM	QLVRGEPNVSYICSR	865	sp|Q2NL51|GSK3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=12269	40.915537	3	1856.862658	1856.860433	K	Y	269	284
PSM	MEIQSGPQPGSPGRAERLNAR	866	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=13153	43.326843	3	2372.1074	2372.1051	-	L	1	22
PSM	MEIQSGPQPGSPGRAER	867	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=12605	41.774351	3	1917.8403	1917.8399	-	L	1	18
PSM	MEIQSGPQPGSPGRAER	868	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=12662	41.945343	3	1917.8403	1917.8399	-	L	1	18
PSM	SDFDEFERQLNENKQER	869	sp|P26369|U2AF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=20147	63.565517	3	2304.9647	2304.9643	M	D	2	19
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	870	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=22078	69.342501	4	4195.900577	4195.899841	R	D	224	260
PSM	ADGDSGSERGGGGGGGGGPGGFQPAPR	871	sp|O35295|PURB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=10673	36.263684	3	2435.9922	2434.9882	M	G	2	29
PSM	SKSEEAHAEDSVMDHHFR	872	sp|Q9CY58|PAIRB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=7241	26.574564	4	2190.875679	2190.878996	K	K	327	345
PSM	IGGHGAEYGAEALER	873	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7961	28.547552	3	1528.728348	1528.727020	K	M	18	33
PSM	IGGHGAEYGAEALER	874	sp|P01942|HBA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8022	28.720337	3	1528.728348	1528.727020	K	M	18	33
PSM	AAKPCPTEASPPAASPSGDSSPPATAPYDPR	875	tr|A0A1B0GRU3|A0A1B0GRU3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=11514	38.653	3	3129.3751	3129.3751	R	V	971	1002
PSM	ALAAAGYDVEKNNSR	876	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5656	21.85	2	1577.7798	1577.7798	K	I	65	80
PSM	AMSLNMLNVDGPR	877	tr|D3Z710|D3Z710_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=21839	68.557	2	1496.6517	1496.6517	R	A	465	478
PSM	AQLYLAPTSSPPNEGLDSLAQELSR	878	tr|D6RGB4|D6RGB4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:21	ms_run[2]:scan=28151	89.535	3	2736.3008	2736.3008	R	S	54	79
PSM	AQSSPASATFPMSVQEPPTKPR	879	tr|A0A087WQ92|A0A087WQ92_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=15000	49.154	3	2393.1087	2393.1087	R	F	59	81
PSM	ATSPPHLDGTSNPESTVPEKK	880	tr|F7BTZ2|F7BTZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=7937	28.483	3	2271.042	2271.0420	K	I	472	493
PSM	CRELPVSYDSTSTESLYPR	881	tr|A0A0U1RQ02|A0A0U1RQ02_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=17211	55.046	3	2339.0141	2339.0141	R	S	30	49
PSM	CRSPGMLEPLGSAR	882	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=11890	39.86	3	1609.7106	1609.7106	R	T	2082	2096
PSM	CSGPGLSPGMVR	883	tr|B7FAV1|B7FAV1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=12927	42.676	2	1296.5356	1296.5356	K	A	1429	1441
PSM	DGQVINETSQHHDDLE	884	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6990	25.883	3	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	885	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7115	26.23	3	1835.7922	1835.7922	R	-	451	467
PSM	EDHGRGYFEYIEENKYSR	886	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12554	41.624	4	2291.0243	2291.0243	R	A	227	245
PSM	ERASSPPDRIDIFGR	887	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:21	ms_run[2]:scan=13801	45.691	3	1794.8414	1794.8414	R	T	53	68
PSM	ERTSSLTHSEEKSSGFR	888	sp|Q9CT10|RANB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=3627	15.676	4	2016.8902	2016.8902	R	L	54	71
PSM	GFGFGQGAGALVHSE	889	sp|P97315|CSRP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:21	ms_run[2]:scan=19971	63.027	2	1512.6399	1512.6399	K	-	179	194
PSM	GGSLDINDGHCGLGSEVNATLMHR	890	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18075	57.421	3	2589.1101	2589.1101	R	R	228	252
PSM	GLLYDSSEEDEERPARK	891	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:21	ms_run[2]:scan=9061	31.55	3	2072.9052	2072.9052	R	R	134	151
PSM	GPPDFSSDEEREPTPVLGSGASVGR	892	sp|Q61033-2|LAP2A-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:21	ms_run[2]:scan=15961	51.679	3	2622.1599	2622.1599	K	G	61	86
PSM	HLQLAIRNDEELNKLLGR	893	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18740	59.418	4	2131.1862	2131.1862	R	V	83	101
PSM	HLSSTSDDEPLSSVNHAAK	894	tr|D3Z491|D3Z491_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=7255	26.607	3	2073.9004	2073.9004	R	A	25	44
PSM	IAGTPGTGGRLSPENNQVLTK	895	sp|Q8VE65|TAF12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:21	ms_run[2]:scan=11594	38.873	3	2189.0842	2189.0842	K	K	40	61
PSM	IDISPSTFRK	896	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:21	ms_run[2]:scan=12671	41.971	2	1242.601	1242.6010	R	H	676	686
PSM	ILSDVTHSAVFGVPASK	897	tr|A0A571BDM4|A0A571BDM4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=21725	68.183	2	1806.8917	1806.8917	R	S	97	114
PSM	KASEEEYVIRK	898	tr|H3BKQ0|H3BKQ0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=4230	17.688	3	1430.6807	1430.6807	R	S	235	246
PSM	KETESEAEDDNLDDLER	899	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=11948	40.053	3	2086.8216	2086.8216	R	H	874	891
PSM	KETESEAEDDNLDDLERHLR	900	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=15378	50.213	4	2493.0657	2493.0657	R	E	874	894
PSM	KFPDRLADDEGDSDSESVGQSR	901	sp|Q9Z277-2|BAZ1B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:21	ms_run[2]:scan=9999	34.528	3	2489.0344	2489.0344	R	G	1154	1176
PSM	KLEKEEEEGISQESSEEEQ	902	sp|P17095-1|HMGA1-1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:21	ms_run[2]:scan=6229	23.818	3	2315.953	2315.9530	K	-	78	97
PSM	KLSGDLEAGAPK	903	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=7036	26.007	2	1264.6064	1264.6064	R	N	1189	1201
PSM	KTSGPPVSELITK	904	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:21	ms_run[2]:scan=11483	38.562	3	1435.7324	1435.7324	R	A	34	47
PSM	KVVDYSQFQESDDADEDYGRDSGPPAK	905	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:21	ms_run[2]:scan=12725	42.126	3	3097.2826	3097.2826	R	K	9	36
PSM	LGIAVIHGEAQDAESDLVDGRHSPPMVR	906	sp|Q8R574|KPRB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	23-UNIMOD:21	ms_run[2]:scan=18411	58.369	4	3048.4488	3048.4488	R	S	205	233
PSM	LKATVTPSPVKGK	907	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:21	ms_run[2]:scan=3173	14.033	3	1404.7742	1404.7742	R	A	173	186
PSM	LQEKLSPPYSSPQEFAQDVGR	908	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:21	ms_run[2]:scan=19665	62.172	3	2455.1421	2455.1421	R	M	747	768
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIR	909	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	22-UNIMOD:21	ms_run[2]:scan=16826	53.951	4	4133.846	4133.8460	R	A	373	410
PSM	MSMKEVDEQMLNVQNK	910	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15164	49.636	3	1922.89	1922.8900	R	N	321	337
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	911	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	19-UNIMOD:21	ms_run[2]:scan=15945	51.636	4	3318.5816	3318.5816	R	S	2386	2416
PSM	NLTANDPSQDYVASDCEEDPEVEFLK	912	sp|Q9DA19|CIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=23568	74.457	3	3064.2533	3064.2533	R	S	189	215
PSM	NSSPSPVPGSQNVPAPAVK	913	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:21	ms_run[2]:scan=11534	38.709	2	1911.9092	1911.9092	R	K	130	149
PSM	QPSIELPSMAVASTK	914	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=20621	64.969	2	1637.7736	1637.7736	R	T	239	254
PSM	RASGQAFELILSPR	915	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=19491	61.704	3	1623.8134	1623.8134	K	S	14	28
PSM	RATSPSSSVSGDFDDGHHSVPTPGPSR	916	tr|D6RIL0|D6RIL0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=9181	31.836	4	2816.2151	2816.2151	R	K	7	34
PSM	RIDISPSTFR	917	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:21	ms_run[2]:scan=13782	45.648	2	1270.6071	1270.6071	R	K	675	685
PSM	RIDISPSTFRK	918	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:21	ms_run[2]:scan=9908	34.217	3	1398.7021	1398.7021	R	H	675	686
PSM	RISQVSSGETEYNPGEAR	919	tr|F6ZZB1|F6ZZB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=9206	31.907	3	2058.9008	2058.9008	R	-	1056	1074
PSM	RKEDEVEEWQHR	920	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3333	14.604	3	1639.7703	1639.7703	R	A	437	449
PSM	SASADNLILPR	921	sp|Q8BGU5-2|CCNY-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=15925	51.589	2	1235.5911	1235.5911	R	W	299	310
PSM	SFKLSGFSFKK	922	sp|P26645|MARCS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:21	ms_run[2]:scan=15209	49.765	3	1354.6686	1354.6686	K	S	156	167
PSM	SGVSITIDDPVRTAQVPSPPRGK	923	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	18-UNIMOD:21	ms_run[2]:scan=15421	50.315	3	2456.2425	2456.2425	K	I	920	943
PSM	SGVSITIDDPVRTAQVPSPPRGK	924	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	18-UNIMOD:21	ms_run[2]:scan=15494	50.506	4	2456.2425	2456.2425	K	I	920	943
PSM	SGVSITIDDPVRTAQVPSPPRGK	925	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	18-UNIMOD:21	ms_run[2]:scan=15632	50.854	4	2456.2425	2456.2425	K	I	920	943
PSM	SLAAAGYDVEKNNSR	926	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6224	23.796	3	1593.7747	1593.7747	K	I	67	82
PSM	SNSVKKSQPTLPISTIDER	927	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=11257	37.914	3	2179.0886	2179.0886	K	L	201	220
PSM	SRSGEGEVSGLLR	928	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=11068	37.366	3	1425.6613	1425.6613	R	K	471	484
PSM	SRSGEGEVSGLLR	929	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=11070	37.372	2	1425.6613	1425.6613	R	K	471	484
PSM	SYELPDGQVITIGNER	930	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20570	64.823	2	1789.8846	1789.8846	K	F	239	255
PSM	TDSREDEISPPPPNPVVK	931	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:21	ms_run[2]:scan=10853	36.754	3	2055.9514	2055.9514	R	G	75	93
PSM	TGIRTDSREDEISPPPPNPVVK	932	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:21	ms_run[2]:scan=11137	37.556	4	2483.2057	2483.2057	K	G	71	93
PSM	TLSISTQDLSPR	933	tr|D3Z710|D3Z710_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:21	ms_run[2]:scan=15907	51.537	2	1396.6599	1396.6599	R	-	494	506
PSM	TSSLTHSEEKSSGFR	934	sp|Q9CT10|RANB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:21	ms_run[2]:scan=3864	16.487	3	1731.7465	1731.7465	R	L	56	71
PSM	TTSFAESCKPVQQPSAFGSMK	935	sp|Q9WV60|GSK3B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=14152	46.657	3	2367.0276	2367.0276	R	V	7	28
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	936	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	20-UNIMOD:35,25-UNIMOD:21	ms_run[2]:scan=25565	81.933	4	3750.8791	3750.8791	R	M	46	81
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	937	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	20-UNIMOD:35,25-UNIMOD:21	ms_run[2]:scan=25709	82.453	4	3750.8791	3750.8791	R	M	46	81
PSM	VAPEEHPVLLTEAPLNPK	938	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14244	46.961	3	1953.0571	1953.0571	R	A	96	114
PSM	VRGWSPPPEVRR	939	tr|D6RHA7|D6RHA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:21	ms_run[2]:scan=9143	31.742	3	1514.7507	1514.7507	R	S	26	38
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	940	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22231	69.896847	4	4114.7674	4114.7655	K	R	104	142
PSM	SETAPAAPAAPAPVEKTPVKK	941	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=8898	31.175505	3	2181.1088	2181.1077	M	K	2	23
PSM	HQGVMVGMGQKDSYVGDEAQSK	942	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=4356	18.095964	4	2382.058641	2382.058010	R	R	40	62
PSM	ERSPALKSPLQSVVVR	943	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=13005	42.89699	3	1844.988460	1844.987348	R	R	246	262
PSM	SSSPVNVKKLK	944	sp|Q8VEK3|HNRPU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=5924	22.699405	2	1307.6854	1307.6845	M	V	2	13
PSM	LKATVTPSPVKGK	945	sp|Q80XU3|NUCKS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=3221	14.202015	3	1404.774676	1404.774167	R	A	174	187
PSM	RADALTSSPGRDLPPFEDESEGLLGTEGPMEEEEDGEELIGDGMER	946	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=26696	85.753702	4	5041.1683	5041.1637	R	D	34	80
PSM	LSRQPSIELPSMAVASTK	947	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=13985	46.188151	3	2009.986508	2009.985694	K	T	238	256
PSM	ASGVAVSDGVIKVFNDMK	948	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=29196	91.605629	3	1995.8697	1995.8773	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMK	949	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24126	76.542909	3	1973.9171	1973.9164	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMKVR	950	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=26299	84.461718	4	2251.0391	2251.0468	M	K	2	22
PSM	ASGQAFELILSPR	951	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	11-UNIMOD:21	ms_run[1]:scan=22555	71.17771	2	1467.713010	1467.712296	R	S	15	28
PSM	LSSESHHGGSPIHWVLPAGMSAK	952	sp|E9Q5K9|YTDC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:21	ms_run[1]:scan=14782	48.476622	3	2467.141088	2464.135880	R	M	416	439
PSM	SGDEMIFDPTMSKKK	953	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=17265	55.194068	3	1834.7884	1834.7877	M	K	2	17
PSM	SGDEMIFDPTMSK	954	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25987	83.469668	2	1578.5978	1578.5978	M	K	2	15
PSM	AASLRGGVGAPGSPSTPPTR	955	sp|Q3UYC0|PPM1H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21	ms_run[1]:scan=8355	29.736826	3	1914.933158	1914.931290	R	F	208	228
PSM	KKIPDPDSDDVSEVDAR	956	sp|Q3TKT4|SMCA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	8-UNIMOD:21	ms_run[1]:scan=7800	28.10187	3	1964.874213	1964.872832	K	H	688	705
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	957	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0		ms_run[1]:scan=13149	43.317993	4	5183.9652	5182.9782	R	K	34	79
PSM	RGSSVALMLDVQSLGTVEPICSVNTPR	958	sp|Q8BUM3|PTN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=25502	81.708135	3	2965.439860	2965.440244	R	E	42	69
PSM	QISPVKFNDADSVLPHKK	959	sp|Q8BJ37|TYDP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=16698	53.635711	3	2086.0322	2085.0292	R	Q	59	77
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	960	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=18467	58.547856	4	3740.591388	3740.585918	R	I	372	405
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	961	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=18381	58.274923	4	3740.591388	3740.585918	R	I	372	405
PSM	RDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWR	962	sp|Q923E4|SIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	14-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=19287	61.146784	4	3565.691540	3565.688564	R	E	38	75
PSM	ALSHAELFGDESEEEDSSLGAGAPR	963	sp|Q7TT28|REXO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:21	ms_run[1]:scan=17854	56.829056	3	2654.124311	2653.118100	R	V	503	528
PSM	ATPPKRFCPSPSTSSEGTR	964	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=8655	30.603225	3	2183.9667	2183.9666	M	I	2	21
PSM	ATPPKRFCPSPSTSSEGTR	965	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=8725	30.77231	3	2183.9667	2183.9666	M	I	2	21
PSM	AASLRGGVGAPGSPSTPPTR	966	sp|Q3UYC0-2|PPM1H-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=8476	30.077	3	1914.9313	1914.9313	R	F	208	228
PSM	AGLQFPVGR	967	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12974	42.818	2	943.52395	943.5240	R	V	22	31
PSM	AGLQFPVGR	968	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13035	42.993	2	943.52395	943.5240	R	V	22	31
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	969	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=21289	67.033	3	3913.6489	3913.6489	R	I	245	277
PSM	ALAAAGYDVEKNNSR	970	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5496	21.371	3	1577.7798	1577.7798	K	I	65	80
PSM	ALAAAGYDVEKNNSR	971	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5594	21.676	2	1577.7798	1577.7798	K	I	65	80
PSM	CPNLAVKEADDDEEADDDVSEMPSPK	972	sp|P13864-2|DNMT1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=14682	48.194	3	2955.1675	2955.1675	R	K	576	602
PSM	CRSPGMLEPLGSAR	973	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=11840	39.687	3	1609.7106	1609.7106	R	T	2082	2096
PSM	DGQVINETSQHHDDLE	974	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7051	26.056	3	1835.7922	1835.7922	R	-	451	467
PSM	DVYLSPRDDGYSTKDSYSSR	975	tr|S4R1F6|S4R1F6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:21	ms_run[2]:scan=11495	38.593	3	2390.0064	2390.0064	R	E	76	96
PSM	EDHGRGYFEYIEENKYSR	976	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12415	41.271	4	2291.0243	2291.0243	R	A	227	245
PSM	ELEKRASGQAFELILSPR	977	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:21	ms_run[2]:scan=18054	57.37	3	2123.0776	2123.0776	K	S	10	28
PSM	ELEKRASGQAFELILSPR	978	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:21	ms_run[2]:scan=17881	56.908	4	2123.0776	2123.0776	K	S	10	28
PSM	ELEKRASGQAFELILSPR	979	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=19434	61.556	3	2203.0439	2203.0440	K	S	10	28
PSM	ELEKRASGQAFELILSPR	980	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=19691	62.242	3	2203.0439	2203.0440	K	S	10	28
PSM	FHDSEGDDTEETEDYRQFR	981	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:21	ms_run[2]:scan=11302	38.036	3	2454.9238	2454.9238	K	K	105	124
PSM	FMVTPTKIDDIPGLSDTSPDLSSR	982	tr|A2AGJ9|A2AGJ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	17-UNIMOD:21	ms_run[2]:scan=23244	73.459	3	2671.2452	2671.2452	R	S	15	39
PSM	FSLVGIAGQDLNEGNR	983	sp|Q61233|PLSL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20083	63.37	2	1688.8482	1688.8482	K	T	473	489
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	984	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	18-UNIMOD:21	ms_run[2]:scan=16268	52.473	4	3275.3151	3275.3151	K	L	145	174
PSM	GLKLTFDSSFSPNTGKK	985	tr|F2Z471|F2Z471_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	11-UNIMOD:21	ms_run[2]:scan=14903	48.856	3	1905.9237	1905.9237	R	N	94	111
PSM	HHEDEIDHHSKEIER	986	tr|E9PV44|E9PV44_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1452	7.048	4	1909.8667	1909.8667	K	L	41	56
PSM	HITDEADRKYEEVAR	987	tr|A0A571BEU1|A0A571BEU1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5145	20.331	4	1830.886	1830.8860	K	K	27	42
PSM	HKMSPPPSSFNEPR	988	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:21	ms_run[2]:scan=6069	23.272	3	1689.7334	1689.7334	R	S	363	377
PSM	HLQLAIRNDEELNKLLGR	989	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17334	55.394	4	2131.1862	2131.1862	R	V	83	101
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	990	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=21705	68.114	3	3059.4618	3059.4618	R	L	160	187
PSM	ILSDVTHSAVFGVPASK	991	tr|A0A571BDM4|A0A571BDM4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=21665	68.013	2	1806.8917	1806.8917	R	S	97	114
PSM	KETESEAEDDNLDDLER	992	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=12066	40.393	3	2086.8216	2086.8216	R	H	874	891
PSM	KTSGPPVSELITK	993	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=11493	38.587	2	1435.7324	1435.7324	R	A	34	47
PSM	LKELFDYSPPLHK	994	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=16212	52.328	3	1665.8168	1665.8168	K	S	216	229
PSM	LKGFDTSPEHSLDLGISGR	995	sp|Q8CHI8-5|EP400-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:21	ms_run[2]:scan=17577	56.094	3	2107.9939	2107.9939	R	K	917	936
PSM	LLEGEEERLKLSPSPSSR	996	sp|P14733|LMNB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	12-UNIMOD:21	ms_run[2]:scan=12650	41.909	3	2106.0358	2106.0358	K	V	381	399
PSM	LLKEGEEPTVYSDDEEPKDETAR	997	sp|O55022|PGRC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	12-UNIMOD:21	ms_run[2]:scan=10259	35.201	3	2729.1957	2729.1957	K	K	170	193
PSM	LSSESHHGGSPIHWVLPAGMSAK	998	tr|D6RG95|D6RG95_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:21	ms_run[2]:scan=14704	48.257	3	2464.1359	2464.1359	R	M	410	433
PSM	LVDSLSQRSPKPSLR	999	tr|A2A6U3|A2A6U3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:21	ms_run[2]:scan=7840	28.203	3	1761.9138	1761.9138	R	R	59	74
PSM	LVQDVANNTNEEAGDGTTTATVLAR	1000	sp|P63038|CH60_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13938	46.05	3	2559.2413	2559.2413	K	S	97	122
PSM	MDSFDEDLARPSGLLAQER	1001	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=21076	66.424	3	2228.9773	2228.9773	R	K	570	589
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKR	1002	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=14896	48.839	4	3680.5396	3680.5396	R	I	373	406
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1003	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=15078	49.407	4	3334.5766	3334.5766	R	S	2386	2416
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1004	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	19-UNIMOD:21	ms_run[2]:scan=15814	51.297	4	3318.5816	3318.5816	R	S	2386	2416
PSM	NAFADHPHKSDGSNFANYSPPVNR	1005	sp|Q76N33-2|STALP-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	19-UNIMOD:21	ms_run[2]:scan=10170	34.993	4	2721.1721	2721.1721	R	A	58	82
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	1006	sp|O88569-3|ROA2-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11125	37.524	3	2188.8981	2188.8981	R	S	274	299
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	1007	sp|O88569-3|ROA2-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11183	37.696	3	2188.8981	2188.8981	R	S	274	299
PSM	NRNSNVVPYDFNR	1008	tr|S4R1M0|S4R1M0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:21	ms_run[2]:scan=12280	40.942	3	1673.7311	1673.7311	K	V	798	811
PSM	PGPTPSGTNVGSSGRSPSKAVAAR	1009	sp|Q9CQS8|SC61B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:21	ms_run[2]:scan=4873	19.733	4	2317.1176	2317.1176	M	A	2	26
PSM	QGSLEPDWGLQPR	1010	sp|Q8C708|CP054_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=19782	62.488	2	1561.6926	1561.6926	R	V	193	206
PSM	QICLVMLETLSQSPQGR	1011	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=25614	82.119	2	2038.9581	2038.9581	K	V	161	178
PSM	RASGQAFELILSPR	1012	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=19575	61.941	2	1623.8134	1623.8134	K	S	14	28
PSM	RDSFDDRGPSLNPVLDYDHGSR	1013	tr|A0A494BAZ2|A0A494BAZ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=14994	49.132	4	2597.1296	2597.1296	R	S	186	208
PSM	RGLEVNKCEIAR	1014	tr|G3UYK8|G3UYK8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4	ms_run[2]:scan=4024	17.029	3	1443.7616	1443.7616	K	F	325	337
PSM	RHSWGPGKNAASDAEMNQR	1015	sp|E9Q394-2|AKP13-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=4836	19.634	4	2190.9378	2190.9378	R	S	1526	1545
PSM	RHTDPVQLQAAGR	1016	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=4155	17.444	3	1527.7307	1527.7307	R	V	252	265
PSM	SASPDDDLGSSNWEAADLGNEERKQK	1017	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=14447	47.565	3	2898.2305	2898.2305	R	F	15	41
PSM	SFTGGLGQLAGPGK	1018	sp|Q9EQN3|T22D4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:21	ms_run[2]:scan=18693	59.266	2	1368.6439	1368.6439	R	A	165	179
PSM	SGVSITIDDPVRTAQVPSPPRGK	1019	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	18-UNIMOD:21	ms_run[2]:scan=15284	49.968	3	2456.2425	2456.2425	K	I	920	943
PSM	SGVSITIDDPVRTAQVPSPPRGK	1020	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	18-UNIMOD:21	ms_run[2]:scan=15428	50.337	4	2456.2425	2456.2425	K	I	920	943
PSM	SIYGEKFEDENFILK	1021	tr|A0A1L1SST0|A0A1L1SST0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18585	58.909	3	1830.904	1830.9040	R	H	69	84
PSM	SLAALDALNTDDENDEEEYEAWKVR	1022	sp|C0HKD9|MFA1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:21	ms_run[2]:scan=23037	72.86	3	2975.271	2975.2710	R	E	258	283
PSM	SLVSKGTLVQTK	1023	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5069	20.16	3	1259.7449	1259.7449	K	G	86	98
PSM	SLVSKGTLVQTK	1024	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5148	20.339	3	1259.7449	1259.7449	K	G	86	98
PSM	SMGTGDSAGVEVPSSPLRR	1025	tr|H3BKM2|H3BKM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	14-UNIMOD:21	ms_run[2]:scan=12584	41.719	3	1981.8929	1981.8929	R	T	338	357
PSM	SNSVKKSQPTLPISTIDER	1026	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:21	ms_run[2]:scan=11200	37.743	3	2179.0886	2179.0886	K	L	201	220
PSM	SQSFAGFSGLQER	1027	sp|Q80U16-4|RIPR2-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=18691	59.26	2	1492.6348	1492.6348	R	R	44	57
PSM	SSSFKDFAK	1028	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=6748	25.269	2	1095.4638	1095.4638	R	S	25	34
PSM	SSSFKDFAK	1029	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=6883	25.611	2	1095.4638	1095.4638	R	S	25	34
PSM	SSSFKDFAK	1030	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=6952	25.782	2	1095.4638	1095.4638	R	S	25	34
PSM	SSSLGDLLRESPQHPR	1031	sp|Q8K124|PKHO2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21	ms_run[2]:scan=13964	46.127	3	1857.8734	1857.8734	R	L	393	409
PSM	SYELPDGQVITIGNER	1032	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20507	64.636	2	1789.8846	1789.8846	K	F	239	255
PSM	TGIRTDSREDEISPPPPNPVVK	1033	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:21	ms_run[2]:scan=10899	36.899	3	2483.2057	2483.2057	K	G	71	93
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1034	tr|D3YWA4|D3YWA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	14-UNIMOD:21	ms_run[2]:scan=21375	67.224	3	2685.1041	2685.1041	K	M	39	63
PSM	TTAVEIDYDSLKR	1035	sp|O35601-2|FYB1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:21	ms_run[2]:scan=12600	41.76	3	1589.7338	1589.7338	K	K	552	565
PSM	VKVDGPRSPSYGR	1036	sp|Q6PDM2|SRSF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=3624	15.668	3	1496.7137	1496.7137	R	S	192	205
PSM	VKVDGPRSPSYGR	1037	sp|Q6PDM2|SRSF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=3675	15.84	3	1496.7137	1496.7137	R	S	192	205
PSM	VKVDGPRSPSYGR	1038	sp|Q6PDM2|SRSF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:21	ms_run[2]:scan=3729	16.011	3	1496.7137	1496.7137	R	S	192	205
PSM	VMSSSNPDLTGSHCAADEEVKNIMSSK	1039	sp|Q8C147-2|DOCK8-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=17277	55.226	4	2973.2555	2973.2555	R	I	535	562
PSM	YRPGTVALREIR	1040	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6802	25.406	4	1429.8154	1429.8154	R	R	42	54
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	1041	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22349	70.341986	3	4114.7692	4114.7655	K	R	104	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	1042	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=22302	70.170716	3	4114.7692	4114.7655	K	R	104	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVK	1043	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15274	49.940607	4	3445.416169	3445.414085	K	L	104	135
PSM	KASGPPVSELITK	1044	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=11225	37.821335	3	1405.722689	1405.721798	R	A	34	47
PSM	HQGVMVGMGQKDSYVGDEAQSKR	1045	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6466	24.525744	4	2506.169141	2506.169291	R	G	40	63
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	1046	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=24480	77.861669	3	2990.324089	2990.322280	K	T	1561	1587
PSM	ASGVAVSDGVIK	1047	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=18566	58.844563	2	1223.5803	1223.5794	M	V	2	14
PSM	ASGVAVSDGVIKVFNDMKVR	1048	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=22011	69.145404	3	2229.0859	2229.0859	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	1049	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=29041	91.22524	3	1957.9237	1957.9215	M	V	2	20
PSM	SDAAVDTSSEITTKDLK	1050	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=15716	51.057388	2	1902.8532	1901.8502	M	E	2	19
PSM	KGGEFDEFVNDDTDDDLPVSK	1051	sp|Q62018|CTR9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:21	ms_run[1]:scan=19440	61.568496	3	2420.991463	2420.989712	K	K	913	934
PSM	SRASGSYEEQDVANGINQNVALAIAGNHFNLK	1052	sp|Q8C147|DOCK8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21	ms_run[1]:scan=21984	69.052786	4	3467.612408	3466.626675	R	T	1241	1273
PSM	AAKPCPTEASPPAASPSGDSSPPATAPYDPR	1053	sp|Q6ZPZ3|ZC3H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=11454	38.478396	3	3129.376586	3129.375061	R	V	1095	1126
PSM	CRELPVSYDSTSTESLYPR	1054	sp|O54957|LAT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=17149	54.86657	3	2340.019122	2339.014093	R	S	30	49
PSM	SDNDDIEVESDADKRAHHNALER	1055	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9591	33.066839	4	2758.1472	2757.1622	M	K	2	25
PSM	SDNDDIEVESDADKRAHHNALER	1056	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9239	31.984692	4	2757.1627	2757.1622	M	K	2	25
PSM	AGRESPPPSAPSMAPISFGFTR	1057	sp|Q56A08|GPKOW_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=24347	77.349589	3	2381.0870	2381.0870	M	T	2	24
PSM	RHSWGPGKNAASDAEMNQR	1058	sp|E9Q394|AKP13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=4841	19.649955	4	2190.939155	2190.937849	R	S	1530	1549
PSM	DKQSPSQANGCSDQRPIDILEMLSR	1059	sp|Q91YD3|DCP1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=25092	80.161716	4	2925.300167	2924.315772	R	A	159	184
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1060	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:21	ms_run[1]:scan=21810	68.456048	3	2685.104491	2685.104090	K	M	106	130
PSM	AAIPPPVYEEPDRPRSPTGPSNSFLANMGGTVAHK	1061	sp|Q8JZX4|SPF45_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	18-UNIMOD:21	ms_run[1]:scan=18233	57.880508	4	3741.788266	3739.781796	K	I	207	242
PSM	YAHQQPPSPLPVYSSSAK	1062	sp|Q8VI36|PAXI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:21	ms_run[1]:scan=10658	36.21866	3	2035.940449	2035.940458	R	N	76	94
PSM	LRPRSIEVENDFLPVEK	1063	sp|Q8R550|SH3K1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:21	ms_run[1]:scan=16703	53.645763	3	2121.052065	2120.066721	K	T	270	287
PSM	AAIPPPVYEEPDRPRSPTGPSNSFLANMGGTVAHK	1064	sp|Q8JZX4|SPF45_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	18-UNIMOD:21	ms_run[2]:scan=18116	57.54	4	3739.7818	3739.7818	K	I	207	242
PSM	AASPPASASDLIEQQQKR	1065	sp|Q8C079-2|STRP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=12434	41.321	3	1975.9364	1975.9364	R	G	333	351
PSM	ALSHAELFGDESEEEDSSLGAGAPR	1066	sp|Q7TT28|REXO1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	12-UNIMOD:21	ms_run[2]:scan=17884	56.913	3	2653.1181	2653.1181	R	V	503	528
PSM	ALSPVIPIIPR	1067	tr|A0A0A0MQ73|A0A0A0MQ73_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=23141	73.189	2	1254.7101	1254.7101	R	T	4787	4798
PSM	AQSSPASATFPMSVQEPPTKPR	1068	tr|A0A087WQ92|A0A087WQ92_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=14944	48.986	3	2393.1087	2393.1087	R	F	59	81
PSM	ATWGDGGDNSPSNVVSKQPSR	1069	tr|B0R030|B0R030_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:21	ms_run[2]:scan=10333	35.384	3	2237.9703	2237.9703	K	I	101	122
PSM	DGQVINETSQHHDDLE	1070	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6926	25.711	3	1835.7922	1835.7922	R	-	451	467
PSM	DGRGAAQNIIPASTGAAK	1071	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7772	28.024	3	1696.8856	1696.8856	R	A	196	214
PSM	DRGGDTSDTESSIIIR	1072	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:21	ms_run[2]:scan=11655	39.06	2	1800.7891	1800.7891	R	R	308	324
PSM	DRGGDTSDTESSIIIR	1073	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:21	ms_run[2]:scan=11694	39.173	3	1800.7891	1800.7891	R	R	308	324
PSM	DRGGDTSDTESSIIIRR	1074	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:21	ms_run[2]:scan=8774	30.882	3	1956.8902	1956.8902	R	R	308	325
PSM	DSQDTSAEQSDHDDEVASLASASGGFGSKIPTPR	1075	tr|D6RE33|D6RE33_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:21	ms_run[2]:scan=19692	62.244	4	3541.5118	3541.5118	R	L	813	847
PSM	DYSGSQGGYDRYSGGNYRDNYDN	1076	sp|O89086|RBM3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10809	36.63	3	2622.028	2622.0280	R	-	131	154
PSM	ELEKRASGQAFELILSPR	1077	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=19694	62.247	3	2203.0439	2203.0440	K	S	10	28
PSM	ERASSPPDRIDIFGR	1078	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=13931	46.035	3	1794.8414	1794.8414	R	T	53	68
PSM	FRTPSFLKK	1079	sp|Q9QYB8-3|ADDB-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:21	ms_run[2]:scan=10790	36.574	3	1202.6213	1202.6213	K	S	460	469
PSM	FRTPSFLKK	1080	sp|Q9QYB8-3|ADDB-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:21	ms_run[2]:scan=10906	36.917	3	1202.6213	1202.6213	K	S	460	469
PSM	FRTPSFLKK	1081	sp|Q9QYB8-3|ADDB-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:21	ms_run[2]:scan=10962	37.087	3	1202.6213	1202.6213	K	S	460	469
PSM	GPQAPTGRRDSDICLNAP	1082	tr|S4R2F6|S4R2F6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=11085	37.41	3	2003.8884	2003.8884	R	-	76	94
PSM	GSSLKILSK	1083	sp|P70658-2|CXCR4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=7300	26.723	2	1011.5366	1011.5366	R	G	328	337
PSM	HKMSPPPSSFNEPR	1084	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=6165	23.614	3	1689.7334	1689.7334	R	S	363	377
PSM	HQGVMVGMGQKDSYVGDEAQSK	1085	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7957	28.533	3	2350.0682	2350.0682	R	R	40	62
PSM	HQGVMVGMGQKDSYVGDEAQSKR	1086	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:35	ms_run[2]:scan=4346	18.068	4	2522.1642	2522.1642	R	G	40	63
PSM	IDISPSALRK	1087	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=11876	39.811	3	1178.606	1178.6060	R	H	366	376
PSM	IDISPSTFRK	1088	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=12664	41.951	3	1242.601	1242.6010	R	H	676	686
PSM	IDISPSTFRK	1089	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=12722	42.119	3	1242.601	1242.6010	R	H	676	686
PSM	IDISPSTFRK	1090	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=12785	42.291	3	1242.601	1242.6010	R	H	676	686
PSM	IDISPSTFRK	1091	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=12851	42.459	3	1242.601	1242.6010	R	H	676	686
PSM	IDISPSTFRK	1092	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=12732	42.144	2	1242.601	1242.6010	R	H	676	686
PSM	IKGEHPGLSIGDVAK	1093	sp|P63158|HMGB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6966	25.818	3	1519.8358	1519.8358	K	K	113	128
PSM	ISGLIYEETRGVLK	1094	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16238	52.394	3	1576.8825	1576.8825	R	V	47	61
PSM	KALAAAGYDVEKNNSR	1095	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3687	15.882	3	1705.8747	1705.8747	K	I	64	80
PSM	KITISDCGQL	1096	tr|A0A1L1SST0|A0A1L1SST0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=10750	36.466	2	1133.5751	1133.5751	K	-	147	157
PSM	KTVSEPNLKLR	1097	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=6620	24.937	3	1363.7225	1363.7225	R	Y	175	186
PSM	LFDYRGRLSPVPVPR	1098	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:21	ms_run[2]:scan=16438	52.918	3	1850.9557	1850.9557	R	A	111	126
PSM	LKGFDTSPEHSLDLGISGR	1099	sp|Q8CHI8-5|EP400-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:21	ms_run[2]:scan=17518	55.924	3	2107.9939	2107.9939	R	K	917	936
PSM	LREQGTESRSSTPLPTVSSSAENTR	1100	sp|Q61033-2|LAP2A-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=8911	31.205	4	2849.2594	2849.2594	K	Q	148	173
PSM	LSRQPSIELPSMAVASTK	1101	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:21	ms_run[2]:scan=17816	56.727	2	1993.9908	1993.9908	K	T	236	254
PSM	MQASIEKGGSLPKVEAK	1102	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:21	ms_run[2]:scan=8844	31.045	3	1851.9166	1851.9166	K	F	221	238
PSM	QISQDVKLEPDILLR	1103	sp|Q9DBT5|AMPD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=21520	67.578	3	1845.9601	1845.9601	R	A	85	100
PSM	QPSIELPSMAVASTK	1104	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=20685	65.146	2	1637.7736	1637.7736	R	T	239	254
PSM	RASVVSLMTWKPSK	1105	sp|Q8VD58|EVI2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=15367	50.173	3	1668.8423	1668.8423	K	S	267	281
PSM	RDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWR	1106	sp|Q923E4-2|SIR1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=19235	60.98	4	3565.6886	3565.6886	R	E	38	75
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	1107	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=23139	73.183	3	3254.5448	3254.5448	R	L	12	44
PSM	RIDISPSALR	1108	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:21	ms_run[2]:scan=12813	42.364	2	1206.6122	1206.6122	R	K	365	375
PSM	RIDISPSALR	1109	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:21	ms_run[2]:scan=12877	42.539	3	1206.6122	1206.6122	R	K	365	375
PSM	RIDISPSALR	1110	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:21	ms_run[2]:scan=12938	42.712	3	1206.6122	1206.6122	R	K	365	375
PSM	RLSLDASTVDKGACLPR	1111	tr|E9Q7Y4|E9Q7Y4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13733	45.503	3	1937.9394	1937.9394	R	T	131	148
PSM	RLSPVEKAQGPR	1112	tr|E9Q8J8|E9Q8J8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=2858	12.848	3	1416.7239	1416.7239	R	L	124	136
PSM	RPHTPTPGIYMGRPTYGSSR	1113	tr|F8WJG3|F8WJG3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=8390	29.838	4	2310.0729	2310.0729	K	R	98	118
PSM	RVPSPTPVPKEAIR	1114	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21	ms_run[2]:scan=6575	24.825	3	1625.8654	1625.8654	K	E	2532	2546
PSM	SFGSPNRAYTHQVVTR	1115	tr|A0A286YDC0|A0A286YDC0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=8962	31.32	3	1978.8452	1978.8452	K	W	124	140
PSM	SFTGGLGQLAGPGK	1116	sp|Q9EQN3|T22D4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=18641	59.093	2	1368.6439	1368.6439	R	A	165	179
PSM	SGVSITIDDPVRTAQVPSPPRGK	1117	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	18-UNIMOD:21	ms_run[2]:scan=15706	51.031	4	2456.2425	2456.2425	K	I	920	943
PSM	SKKGGEFDEFVNDDTDDDLPVSK	1118	sp|Q62018-3|CTR9-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	15-UNIMOD:21	ms_run[2]:scan=16521	53.143	3	2636.1167	2636.1167	R	K	866	889
PSM	SPFLSTPPLPPMPAGTPPPQPPAK	1119	sp|Q99PV8-2|BC11B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	16-UNIMOD:21	ms_run[2]:scan=23430	73.948	3	2501.243	2501.2430	K	S	329	353
PSM	SRSDVDMDPGSATAVLGPTRR	1120	tr|F6ZN61|F6ZN61_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=12774	42.265	3	2267.0366	2267.0366	R	A	111	132
PSM	SRSGEGEVSGLLR	1121	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:21	ms_run[2]:scan=11189	37.71	3	1425.6613	1425.6613	R	K	471	484
PSM	SRSPVDSPVPASMFAPEPSSPGAAR	1122	sp|O08582|GTPB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:21	ms_run[2]:scan=17753	56.555	3	2576.1731	2576.1731	R	A	6	31
PSM	STAGDTHLGGEDFDNR	1123	tr|Q504P4|Q504P4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7001	25.912	3	1690.7183	1690.7183	K	M	202	218
PSM	STAGDTHLGGEDFDNR	1124	tr|Q504P4|Q504P4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7062	26.081	3	1690.7183	1690.7183	K	M	202	218
PSM	STRSVENLPECGITHEQR	1125	tr|D6RI80|D6RI80_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=8558	30.312	3	2191.9681	2191.9681	R	A	93	111
PSM	TAMRVSPHHPAPTPNPR	1126	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:21	ms_run[2]:scan=3756	16.096	4	1944.9142	1944.9142	R	A	207	224
PSM	TASFGGITVLTR	1127	sp|Q9DCB4-5|ARP21-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:21	ms_run[2]:scan=21155	66.676	2	1301.6381	1301.6381	K	G	346	358
PSM	TDSREDEISPPPPNPVVK	1128	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:21	ms_run[2]:scan=11158	37.618	3	2055.9514	2055.9514	R	G	75	93
PSM	TDSREDEISPPPPNPVVK	1129	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:21	ms_run[2]:scan=11214	37.789	3	2055.9514	2055.9514	R	G	75	93
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1130	tr|D3YWA4|D3YWA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:21	ms_run[2]:scan=21574	67.747	3	2685.1041	2685.1041	K	M	39	63
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	1131	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	30-UNIMOD:21	ms_run[2]:scan=25908	83.186	4	3734.8842	3734.8842	R	M	46	81
PSM	TVTAMDVVYALKR	1132	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18943	60.087	3	1465.7963	1465.7963	K	Q	81	94
PSM	VVDYSQFQESDDADEDYGRDSGPPAK	1133	tr|A0A087WRY3|A0A087WRY3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:21	ms_run[2]:scan=14721	48.309	3	2969.1876	2969.1876	K	K	10	36
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1134	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,22-UNIMOD:21,35-UNIMOD:35	ms_run[1]:scan=17120	54.769109	4	4303.890406	4303.888642	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	1135	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19605	62.0135	4	4131.794182	4131.792616	K	R	104	142
PSM	IHTTALTGQSPPLASGHQGEGDAPSVEPGATNIQQPSSPAPSTK	1136	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21,37-UNIMOD:21	ms_run[1]:scan=15571	50.704567	4	4478.045156	4478.042848	K	Q	286	330
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1137	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21695	68.092681	4	3913.644868	3913.648853	R	I	245	277
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1138	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20738	65.320734	4	3913.649129	3913.648853	R	I	245	277
PSM	RIDISPSALR	1139	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=12999	42.881011	3	1206.612276	1206.612187	R	K	652	662
PSM	RADALTSSPGRDLPPFEDESEGLLGTEGPMEEEEDGEELIGDGMER	1140	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=26537	85.244709	4	5041.1683	5041.1637	R	D	34	80
PSM	KKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE	1141	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10509	35.852497	3	4005.326148	4005.321784	K	-	184	216
PSM	ISGLIYEETRGVLK	1142	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16171	52.221368	3	1577.886473	1576.882458	R	V	47	61
PSM	ASGVAVSDGVIKVFNDMK	1143	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24082	76.373922	3	1973.9171	1973.9164	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMKVR	1144	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26274	84.393702	3	2213.0915	2213.0910	M	K	2	22
PSM	MEGHDPKEPEQLRK	1145	sp|Q8BG05-2|ROA3-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=5018	20.049838	4	1734.8357	1734.8354	-	L	1	15
PSM	SSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPK	1146	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	27-UNIMOD:21	ms_run[1]:scan=10445	35.669934	4	3595.548885	3594.562874	K	K	114	150
PSM	LCDFGSASHVADNDITPYLVSR	1147	sp|Q61136|PRP4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=20204	63.732791	3	2517.090948	2516.104305	K	F	832	854
PSM	TTSFAESCKPVQQPSAFGSMK	1148	sp|Q9WV60|GSK3B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=14202	46.827428	3	2369.035200	2367.027635	R	V	7	28
PSM	FNTGSNPTEEAATSSRPFKVAGQSSPSGIQSR	1149	sp|O35601|FYB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	25-UNIMOD:21	ms_run[1]:scan=13276	43.727874	4	3374.554534	3374.552842	K	K	4	36
PSM	MEIQSGPQPGSPGRAER	1150	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=12681	41.999693	2	1917.8403	1917.8399	-	L	1	18
PSM	MEIQSGPQPGSPGRAER	1151	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=12789	42.299347	3	1917.8403	1917.8399	-	L	1	18
PSM	ASGVQVADEVCR	1152	sp|Q9R0P5|DEST_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,2-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=16896	54.105465	2	1411.5804	1411.5798	M	I	2	14
PSM	AAKPCPTEASPPAASPSGDSSPPATAPYDPR	1153	sp|Q6ZPZ3|ZC3H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4,10-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=13080	43.105686	3	3209.343522	3209.341392	R	V	1095	1126
PSM	KRSESPPAELPSLR	1154	sp|G5E870|TRIPC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:21	ms_run[1]:scan=9316	32.218982	3	1646.824371	1645.818886	K	R	308	322
PSM	AGRESPPPSAPSMAPISFGFTR	1155	sp|Q56A08|GPKOW_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=24437	77.68941	3	2381.0870	2381.0870	M	T	2	24
PSM	SKFSFLASDTEEEEENSSAGPGAR	1156	sp|E9PYH6|SET1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=17241	55.133121	3	2624.093881	2624.091551	R	D	514	538
PSM	MREDYDSVEQDGDEPGPQR	1157	sp|Q9CWZ3|RBM8A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:21	ms_run[1]:scan=9311	32.204503	3	2301.884798	2301.884535	R	S	50	69
PSM	SIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCSGDDKAR	1158	sp|Q9Z1F9|SAE2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	28-UNIMOD:21,39-UNIMOD:4	ms_run[1]:scan=16873	54.056734	4	4820.951216	4819.963594	K	K	563	609
PSM	KLSVGGDSDPPLKR	1159	sp|Q6NZF1|ZC11A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:21	ms_run[1]:scan=6222	23.793194	3	1547.772166	1547.770873	R	S	287	301
PSM	YAHQQPPSPLPVYSSSAK	1160	sp|Q8VI36|PAXI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:21	ms_run[1]:scan=10591	36.042471	3	2035.940449	2035.940458	R	N	76	94
PSM	SSDTSPAVVTTPPPPSMPHKER	1161	sp|Q9QYB5|ADDG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=11124	37.52267	3	2439.1110	2439.1136	M	Y	2	24
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1162	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	9-UNIMOD:21	ms_run[1]:scan=17051	54.537229	3	3007.409068	3005.423056	K	S	157	186
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	1163	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	20.0	10-UNIMOD:21	ms_run[1]:scan=20612	64.945648	3	3093.407415	3090.400547	K	S	1028	1055
PSM	AGGQAPSSPSYENSLHSLQSR	1164	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:21	ms_run[2]:scan=12886	42.56	3	2251.9859	2251.9859	R	M	209	230
PSM	ALSRQEMQEVQSSR	1165	sp|O88569-3|ROA2-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5628	21.773	3	1647.7999	1647.7999	K	S	175	189
PSM	APTAALSPEPQDSKEDVKK	1166	sp|D3YXK2|SAFB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:21	ms_run[2]:scan=5024	20.061	3	2089.9933	2089.9933	R	F	360	379
PSM	ASGQAFELILSPR	1167	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:21	ms_run[2]:scan=22409	70.581	3	1467.7123	1467.7123	R	S	15	28
PSM	ASSPPDRIDIFGR	1168	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=16938	54.21	2	1509.6977	1509.6977	R	T	55	68
PSM	ASSPRPHPEFLQTLCR	1169	sp|Q8C3R1|BRAT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=13332	43.933	3	1974.9135	1974.9135	R	L	683	699
PSM	DGRGAAQNIIPASTGAAK	1170	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7532	27.337	3	1696.8856	1696.8856	R	A	196	214
PSM	DKSPVREPIDNLTPEER	1171	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=10875	36.827	3	2073.9732	2073.9732	K	D	134	151
PSM	DKSPVREPIDNLTPEER	1172	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=10933	37.001	3	2073.9732	2073.9732	K	D	134	151
PSM	DNIQGITKPAIRR	1173	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5818	22.351	3	1480.8474	1480.8474	R	L	25	38
PSM	DNLTLWTSENQGDEGDAGEGEN	1174	sp|Q9CQV8-2|1433B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20934	65.956	2	2349.9469	2349.9469	R	-	223	245
PSM	DRGGDTSDTESSIIIRR	1175	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:21	ms_run[2]:scan=8848	31.054	3	1956.8902	1956.8902	R	R	308	325
PSM	ELEKRASGQAFELILSPR	1176	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:21	ms_run[2]:scan=17955	57.083	4	2123.0776	2123.0776	K	S	10	28
PSM	EMEAELEDERKQR	1177	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4511	18.57	3	1661.7679	1661.7679	R	S	1593	1606
PSM	FGSSPQRDPNWIGDR	1178	sp|Q8K3W3|CASC3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=13246	43.628	3	1810.7788	1810.7788	R	S	260	275
PSM	FRTPSFLKK	1179	sp|Q9QYB8-3|ADDB-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:21	ms_run[2]:scan=10729	36.402	3	1202.6213	1202.6213	K	S	460	469
PSM	FRTPSFLKK	1180	sp|Q9QYB8-3|ADDB-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:21	ms_run[2]:scan=10851	36.748	3	1202.6213	1202.6213	K	S	460	469
PSM	GRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	1181	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=25441	81.491	3	3788.5825	3788.5825	R	V	193	225
PSM	GSSLKILSK	1182	sp|P70658-2|CXCR4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=7234	26.555	2	1011.5366	1011.5366	R	G	328	337
PSM	GSYRGGSISVQVNSVKFDSE	1183	tr|A0A286YDA2|A0A286YDA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	19-UNIMOD:21	ms_run[2]:scan=16206	52.307	3	2194.9896	2194.9896	R	-	681	701
PSM	HLQLAIRNDEELNKLLGR	1184	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15935	51.61	4	2131.1862	2131.1862	R	V	83	101
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVKK	1185	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	12-UNIMOD:21	ms_run[2]:scan=8363	29.759	4	2886.4865	2886.4865	R	I	123	150
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVKK	1186	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:21	ms_run[2]:scan=8625	30.505	4	2886.4865	2886.4865	R	I	123	150
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	1187	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=21867	68.632	3	3059.4618	3059.4618	R	L	160	187
PSM	IAGTPGTGGRLSPENNQVLTK	1188	sp|Q8VE65|TAF12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:21	ms_run[2]:scan=11531	38.698	3	2189.0842	2189.0842	K	K	40	61
PSM	IAQLEEELEEEQGNTELINDR	1189	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20821	65.585	3	2471.1664	2471.1664	R	L	1731	1752
PSM	IDISPSALR	1190	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=16577	53.303	2	1050.5111	1050.5111	R	K	366	375
PSM	IDISPSTFRK	1191	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=12795	42.316	2	1242.601	1242.6010	R	H	676	686
PSM	IDISPSTFRK	1192	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=12861	42.49	2	1242.601	1242.6010	R	H	676	686
PSM	ISDPLTSSPGRSSR	1193	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:21	ms_run[2]:scan=7971	28.584	3	1538.709	1538.7090	R	R	20	34
PSM	ISDPLTSSPGRSSR	1194	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:21	ms_run[2]:scan=8032	28.759	3	1538.709	1538.7090	R	R	20	34
PSM	ITNYLTVPAHKLDSPTLSR	1195	sp|Q61165|SL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	14-UNIMOD:21	ms_run[2]:scan=15342	50.11	3	2205.1195	2205.1195	K	A	684	703
PSM	KAEVEGKDLPEHAVLK	1196	sp|Q8VEK3|HNRPU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5048	20.112	4	1761.9625	1761.9625	K	M	596	612
PSM	KKDEGSDIDDEDMEELLNDTR	1197	tr|E9Q9T6|E9Q9T6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:21	ms_run[2]:scan=19529	61.811	3	2546.0367	2546.0367	R	L	535	556
PSM	KLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQR	1198	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=14398	47.419	4	3956.9224	3956.9224	R	Y	184	218
PSM	KLSGDLEAGAPK	1199	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=7100	26.178	2	1264.6064	1264.6064	R	N	1189	1201
PSM	KLSQRPTVAELLAR	1200	sp|Q501J7-2|PHAR4-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=14015	46.267	3	1660.9026	1660.9026	R	K	591	605
PSM	LLEGEEERLKLSPSPSSR	1201	sp|P14733|LMNB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	12-UNIMOD:21	ms_run[2]:scan=12704	42.08	3	2106.0358	2106.0358	K	V	381	399
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1202	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	19-UNIMOD:21	ms_run[2]:scan=16142	52.152	4	3318.5816	3318.5816	R	S	2386	2416
PSM	PGPTPSGTNVGSSGRSPSKAVAAR	1203	sp|Q9CQS8|SC61B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	12-UNIMOD:21	ms_run[2]:scan=4814	19.579	3	2317.1176	2317.1176	M	A	2	26
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1204	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	24-UNIMOD:21,27-UNIMOD:35	ms_run[2]:scan=20869	65.738	4	3507.5555	3507.5555	R	T	545	573
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	1205	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=23075	72.988	4	3254.5448	3254.5448	R	L	12	44
PSM	RKEDEVEEWQHR	1206	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3285	14.446	4	1639.7703	1639.7703	R	A	437	449
PSM	RKEDEVEEWQHR	1207	sp|P26040|EZRI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3384	14.782	4	1639.7703	1639.7703	R	A	437	449
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	1208	sp|Q99LI7|CSTF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:21	ms_run[2]:scan=11353	38.2	4	2845.2556	2845.2556	K	A	686	710
PSM	RRISDPLTSSPGR	1209	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=5929	22.712	3	1520.7461	1520.7461	R	S	18	31
PSM	SASRPSSLIEQEKQR	1210	sp|E9Q394-2|AKP13-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=5337	20.891	3	1794.8625	1794.8625	R	S	2503	2518
PSM	SESGHRGFVPEKNFR	1211	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=4980	19.97	4	1825.8261	1825.8261	R	V	505	520
PSM	SESGHRGFVPEKNFR	1212	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=5065	20.149	4	1825.8261	1825.8261	R	V	505	520
PSM	SGVSITIDDPVRTAQVPSPPRGK	1213	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	18-UNIMOD:21	ms_run[2]:scan=15832	51.34	3	2456.2425	2456.2425	K	I	920	943
PSM	SGVSLAALKK	1214	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5980	22.907	2	972.59678	972.5968	R	A	55	65
PSM	SGVSLAALKK	1215	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6022	23.079	2	972.59678	972.5968	R	A	55	65
PSM	SKDPGSPQLNQEAMADGVEGTPWSAEKPR	1216	sp|Q3UZA1-2|CPZIP-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:21	ms_run[2]:scan=16578	53.304	3	3161.4125	3161.4125	K	R	181	210
PSM	SLSSPTVTLSAPLEGAKDSPIRR	1217	tr|E9PXB7|E9PXB7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=16759	53.803	3	2461.2578	2461.2578	R	A	306	329
PSM	SLSSPTVTLSAPLEGAKDSPIRR	1218	tr|E9PXB7|E9PXB7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=16912	54.142	3	2461.2578	2461.2578	R	A	306	329
PSM	SNSVEKPVSSLLSR	1219	sp|P70429-2|EVL-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=13699	45.402	3	1581.7764	1581.7764	R	V	327	341
PSM	SRSDVDMDPGSATAVLGPTRR	1220	tr|F6ZN61|F6ZN61_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=12708	42.089	3	2267.0366	2267.0366	R	A	111	132
PSM	SVVSFDKVK	1221	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=10116	34.876	2	1087.5315	1087.5315	R	E	623	632
PSM	TASFGGITVLTR	1222	sp|Q9DCB4-5|ARP21-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=21097	66.498	2	1301.6381	1301.6381	K	G	346	358
PSM	TEWLDGKHVVFGK	1223	tr|A0A1L1SST0|A0A1L1SST0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12395	41.219	4	1514.7882	1514.7882	K	V	111	124
PSM	TGEEDKKINEELESQYQQSMDSK	1224	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13836	45.792	4	2715.2181	2715.2181	R	L	69	92
PSM	TGIRTDSREDEISPPPPNPVVK	1225	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:21	ms_run[2]:scan=11021	37.244	3	2483.2057	2483.2057	K	G	71	93
PSM	TIDIEPDIETLLSQQSGNS	1226	tr|A0A0A6YY34|A0A0A6YY34_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=29385	92.135	3	2058.9957	2058.9957	R	-	126	145
PSM	TKPPRPDSPTTTPNISVK	1227	tr|A0A2I3BPX9|A0A2I3BPX9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:21	ms_run[2]:scan=7172	26.39	3	2015.0089	2015.0089	K	K	143	161
PSM	TLSPTPSAEGYQDVRDR	1228	tr|E9Q9Q7|E9Q9Q7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=10784	36.559	3	1970.8735	1970.8735	R	M	87	104
PSM	TTAVEIDYDSLKR	1229	sp|O35601-2|FYB1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	10-UNIMOD:21	ms_run[2]:scan=12565	41.65	2	1589.7338	1589.7338	K	K	552	565
PSM	TVETRDGQVINETSQHHDDLE	1230	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7295	26.709	3	2422.0997	2422.0997	K	-	446	467
PSM	TVSEPNLKLR	1231	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=9310	32.203	2	1235.6275	1235.6275	K	Y	176	186
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	1232	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	25-UNIMOD:21	ms_run[2]:scan=25860	83.012	4	3734.8842	3734.8842	R	M	46	81
PSM	VHVQFFDDSPTRGWVSKR	1233	tr|A0A3Q4EGF1|A0A3Q4EGF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:21	ms_run[2]:scan=15666	50.946	4	2240.0528	2240.0528	R	M	50	68
PSM	VSSSPGIKGGAATILKPGNSK	1234	tr|A0A2I3BPX9|A0A2I3BPX9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:21	ms_run[2]:scan=9236	31.974	3	2048.0667	2048.0667	R	A	294	315
PSM	VVDLMAYMASKE	1235	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21328	67.121	2	1355.6465	1355.6465	R	-	322	334
PSM	YGGSVGSRSSPPATDPGPVPSSPSQEPPTKR	1236	tr|A0A498WFS2|A0A498WFS2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:21	ms_run[2]:scan=8852	31.067	4	3158.467	3158.4670	K	E	144	175
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	1237	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:21	ms_run[1]:scan=20834	65.637746	3	3090.400920	3090.400547	K	S	1028	1055
PSM	IDISPSTFR	1238	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=17892	56.934968	2	1114.506637	1114.505991	R	K	676	685
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1239	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21751	68.265993	4	3914.635345	3913.648853	R	I	245	277
PSM	KISVVSATKGVQAGNSDTEGGQPGR	1240	sp|Q9JIX8|ACINU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=8449	29.999923	3	2522.213894	2522.212610	R	K	823	848
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	1241	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=25030	79.949961	3	2991.326120	2990.322280	K	T	1561	1587
PSM	LLLPGELAK	1242	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14983	49.105766	2	952.596397	952.595718	R	H	101	110
PSM	LLLPGELAK	1243	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14815	48.590271	2	952.596397	952.595718	R	H	101	110
PSM	LLLPGELAK	1244	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14869	48.762247	2	952.596397	952.595718	R	H	101	110
PSM	LLLPGELAK	1245	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14927	48.933948	2	952.596397	952.595718	R	H	101	110
PSM	HASAAGFPLSGTATWTLGR	1246	tr|D3Z7R7|D3Z7R7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=21820	68.488635	3	1979.927364	1979.925476	R	G	81	100
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1247	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:21	ms_run[1]:scan=18007	57.238333	3	3006.409343	3005.423056	K	S	157	186
PSM	LKELFDYSPPLHK	1248	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=16496	53.085988	4	1665.816394	1665.816761	K	S	503	516
PSM	IDISPSALRK	1249	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=11863	39.774811	2	1178.606965	1178.606039	R	H	653	663
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	1250	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=21869	68.635659	3	3062.473990	3059.461764	R	L	162	189
PSM	SNSVKKSQPTLPISTIDER	1251	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=11432	38.422209	3	2179.089103	2179.088579	K	L	203	222
PSM	DNIQGITKPAIR	1252	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8069	28.859963	3	1324.748376	1324.746299	R	R	25	37
PSM	DNIQGITKPAIR	1253	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8128	29.031458	3	1324.748376	1324.746299	R	R	25	37
PSM	RVSEPVEIGIQVTPDEDDHLLSPTKGICPK	1254	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	22-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=19556	61.886794	4	3408.664100	3408.663638	R	Q	107	137
PSM	VSEPVEIGIQVTPDEDDHLLSPTKGICPK	1255	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	21-UNIMOD:21,27-UNIMOD:4	ms_run[1]:scan=21391	67.258109	4	3252.565339	3252.562527	R	Q	108	137
PSM	ASGVAVSDGVIKVFNDMKVR	1256	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24426	77.646171	3	2213.0913	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMK	1257	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=25855	82.990271	3	1957.9225	1957.9215	M	V	2	20
PSM	QEAQQREVDQDDEENSEEDEMDSGTMVR	1258	sp|Q9JI11|STK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	16-UNIMOD:21	ms_run[1]:scan=12223	40.799548	3	3378.274783	3378.277333	R	A	305	333
PSM	SSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPK	1259	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	27-UNIMOD:21	ms_run[1]:scan=10373	35.484547	4	3595.548885	3594.562874	K	K	114	150
PSM	SSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPK	1260	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	21-UNIMOD:21	ms_run[1]:scan=10305	35.309246	4	3595.548885	3594.562874	K	K	114	150
PSM	KLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQR	1261	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=14537	47.793045	4	3956.922509	3956.922404	R	Y	184	218
PSM	AQQRAESPETSAVESTQSTPQKGR	1262	sp|Q4VA53|PDS5B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:21	ms_run[1]:scan=4569	18.768975	3	2652.216249	2652.214067	R	G	1350	1374
PSM	RASMQPAQIAEGVGITTR	1263	sp|E9Q7G0|NUMA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=16044	51.904024	3	1964.950824	1964.950311	R	Q	1949	1967
PSM	AADVSVTHRPPLSPEAEAEAETPETVDR	1264	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=17329	55.384301	3	3095.4095	3095.4079	M	R	2	30
PSM	AADVSVTHRPPLSPEAEAEAETPETVDR	1265	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=17320	55.355834	3	3095.4095	3095.4079	M	R	2	30
PSM	LGTHEGLSPTPFMNSNLIGK	1266	sp|Q61286|HTF4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=20605	64.928105	3	2192.034389	2192.033706	R	T	91	111
PSM	HIAEEADRKYEEVAR	1267	tr|D3Z2H9|D3Z2H9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=4566	18.76191	4	1814.891057	1814.891125	K	K	117	132
PSM	SDAAVDTSSEITTKDLKEK	1268	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12912	42.636037	3	2158.9884	2158.9877	M	K	2	21
PSM	SGDEMIFDPTMSK	1269	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=26140	83.98409	2	1578.5978	1578.5978	M	K	2	15
PSM	RILSDVTHSAVFGVPASK	1270	sp|Q3UHJ0|AAK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:21	ms_run[1]:scan=18554	58.810173	3	1962.994188	1962.992828	R	S	632	650
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	1271	sp|P57776|EF1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	18-UNIMOD:21	ms_run[1]:scan=16063	51.948882	4	3275.316897	3275.315082	K	L	145	174
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	1272	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:35	ms_run[1]:scan=23734	75.079795	3	3467.492890	3466.459047	R	-	226	256
PSM	KKIPDPDSDDVSEVDAR	1273	sp|Q3TKT4|SMCA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=7732	27.916552	3	1964.874213	1964.872832	K	H	688	705
PSM	MEIQSGPQPGSPGRAERLNAR	1274	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=13096	43.158805	3	2372.1074	2372.1051	-	L	1	22
PSM	CKESASPTIPNLDLLEAHTK	1275	sp|Q9WTU0|PHF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=18194	57.77199	3	2303.088040	2303.086864	K	E	531	551
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	1276	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=14013	46.261665	4	5183.9632	5182.9782	R	K	34	79
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	1277	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=13094	43.151382	4	5183.9652	5182.9782	R	K	34	79
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	1278	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=14025	46.289315	4	5183.9632	5182.9782	R	K	34	79
PSM	KRSESPPAELPSLR	1279	sp|G5E870|TRIPC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:21	ms_run[1]:scan=9099	31.630252	3	1646.823220	1645.818886	K	R	308	322
PSM	NAENFDRFFTRHPPVLTPPDQEVIR	1280	sp|P68404-2|KPCB-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:21	ms_run[1]:scan=20057	63.283933	4	3074.476713	3074.476370	R	N	625	650
PSM	LSGSGPAELAELSAGEDDELESEPVSK	1281	tr|Q1HDU4|Q1HDU4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=21554	67.679025	3	2795.229566	2795.227376	R	S	360	387
PSM	ADGDSGSERGGGGGGGGGPGGFQPAPR	1282	sp|O35295|PURB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=10609	36.093433	3	2434.9887	2434.9882	M	G	2	29
PSM	KFPDRLADDEGDSDSESVGQSR	1283	sp|Q9Z277|BAZ1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=11847	39.711401	3	2569.001046	2569.000702	R	G	1452	1474
PSM	ASSPDPPSPLLVR	1284	sp|Q3UIR3|DTX3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=20378	64.228984	2	1456.6968	1456.6958	M	L	2	15
PSM	AAAAALSGAGAPPAGGGAGGGGSPPGGWAVAR	1285	sp|Q3UCQ1|FOXK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=24408	77.577329	3	2665.2403	2665.2393	M	L	2	34
PSM	AAIPPPVYEEPDRPRSPTGPSNSFLANMGGTVAHK	1286	sp|Q8JZX4|SPF45_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:21	ms_run[1]:scan=18172	57.711774	4	3739.780990	3739.781796	K	I	207	242
PSM	MQEMNLLPTPESPVTRQEK	1287	sp|O88685|PRS6A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=23351	73.71369	3	2350.0772	2349.0742	-	M	1	20
PSM	ATPPKRFCPSPSTSSEGTR	1288	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,2-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=11206	37.761104	3	2263.9319	2263.9329	M	I	2	21
PSM	ATPPKRFCPSPSTSSEGTR	1289	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=8542	30.259317	3	2183.9667	2183.9666	M	I	2	21
PSM	ISKVEGTEIVKPSPK	1290	sp|P97868|RBBP6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:21	ms_run[1]:scan=6232	23.826617	3	1690.892009	1690.890654	K	R	1167	1182
PSM	ALSRQEMQEVQSSR	1291	sp|O88569-3|ROA2-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5685	21.942	3	1647.7999	1647.7999	K	S	175	189
PSM	ARFEELNADLFRGTLDPVEK	1292	tr|Q504P4|Q504P4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19949	62.96	4	2319.1859	2319.1859	R	A	281	301
PSM	ARTELESPEESGPPEDEEDAEDFVIDGGPEEAAAKEEEQR	1293	tr|A0A494BB21|A0A494BB21_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=22710	71.691	4	4545.8382	4545.8382	R	C	94	134
PSM	ASSPPDRIDIFGR	1294	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=16690	53.612	3	1509.6977	1509.6977	R	T	55	68
PSM	CHSLGYNFIHK	1295	tr|A0A087WQ61|A0A087WQ61_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10460	35.712	3	1454.6166	1454.6166	K	M	348	359
PSM	DGRGAAQNIIPASTGAAK	1296	tr|S4R1W1|S4R1W1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7592	27.509	3	1696.8856	1696.8856	R	A	196	214
PSM	DNLTLWTSDQQDDDGGEGNN	1297	sp|P61982|1433G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20960	66.039	2	2192.873	2192.8730	R	-	228	248
PSM	EGINPGYDDYADSDEDQHDAYLER	1298	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21	ms_run[2]:scan=16711	53.665	3	2866.0879	2866.0879	K	M	432	456
PSM	EMEAELEDERKQR	1299	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4512	18.572	4	1661.7679	1661.7679	R	S	1593	1606
PSM	FHSPSTTWSPNKDAAQEKR	1300	tr|A0A2I3BQU5|A0A2I3BQU5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=5834	22.393	4	2266.0168	2266.0168	R	R	819	838
PSM	FSSQLQAVSLRRPPAQAMLSGP	1301	sp|P30987|TA2R_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:21	ms_run[2]:scan=20024	63.185	3	2420.2036	2420.2036	R	-	320	342
PSM	FVSEGDGGRLKPESY	1302	sp|Q61823|PDCD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=11920	39.966	2	1719.7505	1719.7505	R	-	455	470
PSM	GAKEEHGGLIRSPR	1303	tr|Q80XR5|Q80XR5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:21	ms_run[2]:scan=2059	9.5452	4	1585.7726	1585.7726	R	H	68	82
PSM	GLLYDSSEEDEERPAR	1304	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=12513	41.513	3	1944.8102	1944.8102	R	K	134	150
PSM	GPPDFSSDEEREPTPVLGSGASVGR	1305	sp|Q61033-2|LAP2A-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	14-UNIMOD:21	ms_run[2]:scan=15893	51.508	3	2622.1599	2622.1599	K	G	61	86
PSM	GRLSPVPVPR	1306	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=8237	29.371	2	1156.6118	1156.6118	R	A	116	126
PSM	GRSPQPPAEEDEDDFDDTLVAIDTYNCDLHFK	1307	sp|Q8VDM6-3|HNRL1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=25489	81.664	3	3788.5825	3788.5825	R	V	193	225
PSM	GSSLKILSK	1308	sp|P70658-2|CXCR4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=7168	26.379	2	1011.5366	1011.5366	R	G	328	337
PSM	GSSLKILSK	1309	sp|P70658-2|CXCR4-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=7364	26.892	2	1011.5366	1011.5366	R	G	328	337
PSM	HHEDEIDHHSKEIERLQK	1310	tr|E9PV44|E9PV44_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2936	13.162	4	2279.1043	2279.1043	K	Q	41	59
PSM	HHEDEIDHHSKEIERLQK	1311	tr|E9PV44|E9PV44_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2978	13.331	4	2279.1043	2279.1043	K	Q	41	59
PSM	HKMSPPPSSFNEPR	1312	tr|A0A1L1SRY4|A0A1L1SRY4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=6116	23.441	3	1689.7334	1689.7334	R	S	363	377
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVKK	1313	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:21	ms_run[2]:scan=8424	29.932	4	2886.4865	2886.4865	R	I	123	150
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	1314	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=21637	67.927	3	3059.4618	3059.4618	R	L	160	187
PSM	HRAEAPPLQREDSGTFSLGK	1315	sp|Q9WTX2|PRKRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21	ms_run[2]:scan=9313	32.21	4	2275.0747	2275.0747	R	M	6	26
PSM	IDISPSALR	1316	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=16517	53.135	2	1050.5111	1050.5111	R	K	366	375
PSM	IDISPSALR	1317	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=16641	53.471	2	1050.5111	1050.5111	R	K	366	375
PSM	IDISPSALR	1318	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=16702	53.644	2	1050.5111	1050.5111	R	K	366	375
PSM	IDISPSTFRK	1319	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=12615	41.799	2	1242.601	1242.6010	R	H	676	686
PSM	IGLPHSIKLSR	1320	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=12559	41.639	3	1299.7064	1299.7064	K	R	112	123
PSM	ILDPDPDPPSPESPTETFAAPAEVR	1321	tr|A0A494BBB2|A0A494BBB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:21	ms_run[2]:scan=21673	68.037	3	2727.2317	2727.2317	K	H	186	211
PSM	ILSDVTHSAVFGVPASK	1322	tr|A0A571BDM4|A0A571BDM4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=21717	68.157	3	1806.8917	1806.8917	R	S	97	114
PSM	ISDPLTSSPGRSSR	1323	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:21	ms_run[2]:scan=8148	29.102	3	1538.709	1538.7090	R	R	20	34
PSM	KASEEEYVIRK	1324	tr|H3BKQ0|H3BKQ0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=4174	17.507	3	1430.6807	1430.6807	R	S	235	246
PSM	KKNLQYYDISAK	1325	tr|Q14AA6|Q14AA6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4809	19.569	3	1469.7878	1469.7878	R	S	141	153
PSM	KQEFMSDTNLSEHAAIPAR	1326	sp|Q8C3J5|DOCK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=13336	43.946	3	2223.9984	2223.9984	R	V	1724	1743
PSM	KRSESPPAELPSLR	1327	tr|A0A087WSG4|A0A087WSG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=9223	31.944	3	1645.8189	1645.8189	K	R	17	31
PSM	KTSGPPVSELITK	1328	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:21	ms_run[2]:scan=11421	38.396	3	1435.7324	1435.7324	R	A	34	47
PSM	LCDFGSASHVADNDITPYLVSR	1329	sp|Q61136|PRP4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=20085	63.376	3	2516.1043	2516.1043	K	F	832	854
PSM	LDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKK	1330	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13300	43.809	4	4304.5692	4304.5692	K	G	158	194
PSM	LKELFDYSPPLHK	1331	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:21	ms_run[2]:scan=16144	52.155	3	1665.8168	1665.8168	K	S	216	229
PSM	LSESQLSFRRSPTK	1332	sp|Q8C2Q3|RBM14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:21	ms_run[2]:scan=7819	28.15	3	1714.8403	1714.8403	R	S	617	631
PSM	LSGFSFKK	1333	sp|P26645|MARCS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21	ms_run[2]:scan=11092	37.432	2	992.47323	992.4732	K	S	159	167
PSM	LSGFSFKK	1334	sp|P26645|MARCS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21	ms_run[2]:scan=11152	37.6	2	992.47323	992.4732	K	S	159	167
PSM	LSRQPSIELPSMAVASTK	1335	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=13674	45.323	3	2009.9857	2009.9857	K	T	236	254
PSM	LSSESHHGGSPIHWVLPAGMSAK	1336	tr|D6RG95|D6RG95_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=14809	48.567	4	2464.1359	2464.1359	R	M	410	433
PSM	MDSFDEDLARPSGLLAQER	1337	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=21129	66.592	3	2228.9773	2228.9773	R	K	570	589
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1338	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=15142	49.579	4	3334.5766	3334.5766	R	S	2386	2416
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1339	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=15204	49.754	4	3334.5766	3334.5766	R	S	2386	2416
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1340	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	19-UNIMOD:21	ms_run[2]:scan=16075	51.981	4	3318.5816	3318.5816	R	S	2386	2416
PSM	NDEELNKLLGR	1341	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13716	45.457	3	1299.6783	1299.6783	R	V	90	101
PSM	NLTANDPSQDYVASDCEEDPEVEFLK	1342	sp|Q9DA19|CIR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	14-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=23477	74.109	3	3064.2533	3064.2533	R	S	189	215
PSM	NRNSNVVPYDFNR	1343	tr|S4R1M0|S4R1M0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=12212	40.769	3	1673.7311	1673.7311	K	V	798	811
PSM	NRNSNVVPYDFNR	1344	tr|S4R1M0|S4R1M0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=12239	40.842	2	1673.7311	1673.7311	K	V	798	811
PSM	NSATFKSFEDRVGTIK	1345	tr|V9GWU5|V9GWU5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:21	ms_run[2]:scan=15477	50.464	3	1878.8877	1878.8877	R	S	139	155
PSM	QICLVMLETLSQSPQGR	1346	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=25761	82.643	3	2038.9581	2038.9581	K	V	161	178
PSM	QISPVKFNDADSVLPHKK	1347	tr|B8JJC1|B8JJC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=12318	41.033	4	2102.0562	2102.0562	R	Q	59	77
PSM	QISQDVKLEPDILLR	1348	sp|Q9DBT5|AMPD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=21376	67.226	3	1845.9601	1845.9601	R	A	85	100
PSM	QKHSQAVEELADQLEQTKR	1349	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11446	38.459	4	2237.14	2237.1400	R	V	1192	1211
PSM	QSLGESPRTLSPTPSAEGYQDVRDR	1350	tr|E9Q9Q7|E9Q9Q7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:21	ms_run[2]:scan=12068	40.4	4	2825.2981	2825.2981	R	M	79	104
PSM	RASGQAFELILSPR	1351	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:21	ms_run[2]:scan=18542	58.771	3	1623.8134	1623.8134	K	S	14	28
PSM	RASGQAFELILSPR	1352	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:21	ms_run[2]:scan=18596	58.941	3	1623.8134	1623.8134	K	S	14	28
PSM	RASGQAFELILSPR	1353	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=22000	69.113	3	1703.7797	1703.7797	K	S	14	28
PSM	RASGQAFELILSPR	1354	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=22055	69.282	3	1703.7797	1703.7797	K	S	14	28
PSM	RASVVSLMTWKPSK	1355	sp|Q8VD58|EVI2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=15327	50.075	3	1668.8423	1668.8423	K	S	267	281
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	1356	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=21105	66.518	4	3174.5785	3174.5785	R	L	12	44
PSM	RIDISPSTFR	1357	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21	ms_run[2]:scan=13893	45.946	3	1270.6071	1270.6071	R	K	675	685
PSM	RIDISPSTFR	1358	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21	ms_run[2]:scan=13960	46.117	3	1270.6071	1270.6071	R	K	675	685
PSM	RPMDSLDARLSPPAGLFTSAR	1359	sp|P42230|STA5A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:21	ms_run[2]:scan=20319	64.045	4	2337.1301	2337.1301	R	S	769	790
PSM	SASPDDDLGSSNWEAADLGNEERKQK	1360	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=14699	48.245	3	2898.2305	2898.2305	R	F	15	41
PSM	SASPDDDLGSSNWEAADLGNEERKQK	1361	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=15004	49.167	3	2898.2305	2898.2305	R	F	15	41
PSM	SGMSPEQSKTKPDSSIYPLVDSK	1362	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:21	ms_run[2]:scan=12516	41.524	3	2560.1768	2560.1768	K	S	1094	1117
PSM	SGVSITIDDPVRTAQVPSPPRGK	1363	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	18-UNIMOD:21	ms_run[2]:scan=15079	49.409	3	2456.2425	2456.2425	K	I	920	943
PSM	SLAAAGYDVEKNNSR	1364	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6281	23.97	3	1593.7747	1593.7747	K	I	67	82
PSM	SNSAPLIHGLSDSSPVFQAEAPSAR	1365	sp|Q9DB52|F122A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:21	ms_run[2]:scan=20753	65.364	3	2617.2174	2617.2174	R	R	32	57
PSM	SPFLSTPPLPPMPAGTPPPQPPAK	1366	sp|Q99PV8-2|BC11B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	16-UNIMOD:21	ms_run[2]:scan=23372	73.772	3	2501.243	2501.2430	K	S	329	353
PSM	SQSFAGFSGLQER	1367	sp|Q80U16-4|RIPR2-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:21	ms_run[2]:scan=18745	59.435	2	1492.6348	1492.6348	R	R	44	57
PSM	SRSDVDMDPGSATAVLGPTR	1368	tr|F6ZN61|F6ZN61_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:21	ms_run[2]:scan=15032	49.26	3	2110.9354	2110.9354	R	R	111	131
PSM	SRSGEGEVSGLLR	1369	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:21	ms_run[2]:scan=11003	37.197	3	1425.6613	1425.6613	R	K	471	484
PSM	TAMRVSPHHPAPTPNPR	1370	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=3701	15.926	4	1944.9142	1944.9142	R	A	207	224
PSM	TDLTDYLNRHYKAPR	1371	sp|Q9CZ13|QCR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12133	40.58	4	1861.9435	1861.9435	R	M	214	229
PSM	TGIRTDSREDEISPPPPNPVVK	1372	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:21	ms_run[2]:scan=11195	37.724	4	2483.2057	2483.2057	K	G	71	93
PSM	TTAVEIDYDSLKR	1373	sp|O35601-2|FYB1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:21	ms_run[2]:scan=12628	41.831	2	1589.7338	1589.7338	K	K	552	565
PSM	VAPEEHPVLLTEAPLNPK	1374	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14140	46.619	3	1953.0571	1953.0571	R	A	96	114
PSM	VRHFSQSEDTGNEVFGALHEEQPLPR	1375	sp|Q6GYP7-4|RGPA1-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:21	ms_run[2]:scan=16444	52.935	4	3058.3934	3058.3934	R	S	768	794
PSM	YRPGTVALREIR	1376	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6779	25.351	3	1429.8154	1429.8154	R	R	42	54
PSM	YTFDFSEEEDDDAAAADDSNDLEELKVK	1377	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:21	ms_run[2]:scan=23336	73.681	3	3260.3082	3260.3082	K	A	1358	1386
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	1378	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	25-UNIMOD:21	ms_run[1]:scan=26674	85.68329	4	3734.886353	3734.884195	R	M	46	81
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1379	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=18292	58.030884	3	4289.905661	4287.893727	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVK	1380	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15253	49.886878	4	3445.416169	3445.414085	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1381	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,22-UNIMOD:21,35-UNIMOD:35	ms_run[1]:scan=17069	54.593589	4	4303.890406	4303.888642	K	S	104	143
PSM	IHTTALTGQSPPLASGHQGEGDAPSVEPGATNIQQPSSPAPSTK	1382	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	15-UNIMOD:21,38-UNIMOD:21	ms_run[1]:scan=15638	50.869832	4	4478.045156	4478.042848	K	Q	286	330
PSM	KASGPPVSELITK	1383	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=11638	39.014632	2	1405.722657	1405.721798	R	A	34	47
PSM	ERSPALKSPLQSVVVR	1384	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,8-UNIMOD:21	ms_run[1]:scan=13727	45.485086	3	1924.956083	1924.953679	R	R	246	262
PSM	RIDISPSTFRK	1385	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=9031	31.484657	3	1398.702694	1398.702065	R	H	675	686
PSM	RSASPDDDLGSSNWEAADLGNEER	1386	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:21	ms_run[1]:scan=17288	55.254926	3	2670.085053	2670.083112	K	K	14	38
PSM	LQEKLSPPYSSPQEFAQDVGR	1387	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21	ms_run[1]:scan=19590	61.983087	3	2456.142728	2455.142071	R	M	747	768
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1388	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	24-UNIMOD:21	ms_run[1]:scan=22804	72.027822	4	3492.550077	3491.560570	R	T	545	573
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1389	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	24-UNIMOD:21	ms_run[1]:scan=23071	72.979478	4	3492.548362	3491.560570	R	T	545	573
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1390	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=19292	61.166676	3	3085.389135	3085.389387	K	S	157	186
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1391	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=19288	61.148674	3	3085.389135	3085.389387	K	S	157	186
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1392	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=19379	61.416403	3	3085.392843	3085.389387	K	S	157	186
PSM	NSSPAVPAPTPEGVQAVNTTK	1393	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=13740	45.527244	3	2144.014743	2144.015079	R	K	851	872
PSM	IDISPSALRK	1394	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=11912	39.945791	2	1178.606965	1178.606039	R	H	653	663
PSM	IDISPSALRK	1395	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=11813	39.603089	2	1178.606965	1178.606039	R	H	653	663
PSM	TPSPLALEDTVELSSPPLSPTTK	1396	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=24828	79.185015	3	2459.210023	2459.208419	R	L	166	189
PSM	QPSIELPSMAVASTK	1397	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=25377	81.236905	2	1620.7467	1620.7465	R	T	241	256
PSM	QPSIELPSMAVASTK	1398	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=25332	81.061135	2	1620.7467	1620.7465	R	T	241	256
PSM	DNIQGITKPAIR	1399	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8110	28.986418	2	1324.748249	1324.746299	R	R	25	37
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	1400	sp|Q08943|SSRP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	16-UNIMOD:21	ms_run[1]:scan=15530	50.597738	4	3165.294617	3164.288413	R	M	429	456
PSM	KAPKEELASDLEEMATSSAK	1401	sp|Q9D6Z1|NOP56_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=19059	60.446624	3	2214.013457	2214.012696	K	R	505	525
PSM	RRSPSPYYSR	1402	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2983	13.344208	3	1427.575243	1427.574830	R	G	262	272
PSM	RRSPSPYYSR	1403	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=3030	13.522415	3	1427.575243	1427.574830	R	G	262	272
PSM	RRSPSPYYSR	1404	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=2940	13.176926	3	1427.575243	1427.574830	R	G	262	272
PSM	ASGQAFELILSPR	1405	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=22251	69.97554	2	1467.713010	1467.712296	R	S	15	28
PSM	SETAPAETAAPAPVEKSPAK	1406	sp|P43276|H15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9856	34.039108	3	2072.9678	2072.9662	M	K	2	22
PSM	HLQLAIRNDEELNKLLGR	1407	sp|C0HKE1|H2A1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17486	55.832765	4	2132.189070	2131.186185	R	V	83	101
PSM	RASVCAEAYNPDEEEDDAESR	1408	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=10447	35.675507	3	2491.944305	2491.943507	R	I	110	131
PSM	TAMRVSPHHPAPTPNPR	1409	sp|Q03347|RUNX1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:21	ms_run[1]:scan=3816	16.301346	4	1944.914873	1944.914200	R	A	207	224
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKR	1410	sp|P70288|HDAC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	22-UNIMOD:21	ms_run[1]:scan=15389	50.238024	4	3664.544693	3664.544721	R	I	373	406
PSM	TQSCETKLLDEKASK	1411	sp|O54824|IL16_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=5875	22.531185	3	1816.827659	1816.827796	R	L	965	980
PSM	TQSCETKLLDEKASK	1412	sp|O54824|IL16_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=5970	22.872612	3	1816.827659	1816.827796	R	L	965	980
PSM	GPPDFSSDEEREPTPVLGSGASVGR	1413	sp|Q61033|LAP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=16692	53.617461	3	2624.168158	2622.159906	K	G	61	86
PSM	HKMSPPPSSFNEPR	1414	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=6232	23.826617	3	1689.731916	1689.733442	R	S	623	637
PSM	HKMSPPPSSFNEPR	1415	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=5235	20.570753	3	1690.736445	1689.733442	R	S	623	637
PSM	AGGQAPSSPSYENSLHSLQSR	1416	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=11443	38.45045	3	2252.976399	2251.985904	R	M	209	230
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	1417	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:35	ms_run[1]:scan=23677	74.879283	3	3467.492890	3466.459047	R	-	226	256
PSM	KKIPDPDSDDVSEVDAR	1418	sp|Q3TKT4|SMCA4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=7670	27.743089	3	1964.874213	1964.872832	K	H	688	705
PSM	CRPREEISDHENNVTILLEDSDLR	1419	sp|Q61687|ATRX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=18076	57.422959	4	2989.360488	2989.360079	K	R	619	643
PSM	ILDPDPDPPSPESPTETFAAPAEVR	1420	sp|Q05AH6|SPNDC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=21608	67.849333	3	2728.238306	2727.231674	K	H	240	265
PSM	LKQLSVPASDEEDEVPAPIPR	1421	sp|Q6P542|ABCF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=19704	62.271231	3	2449.119356	2449.117904	R	G	99	120
PSM	IIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELR	1422	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	13-UNIMOD:21,29-UNIMOD:4,42-UNIMOD:4	ms_run[1]:scan=28326	89.853494	4	5213.4299	5213.4245	K	L	104	149
PSM	KIQPQLPDEDGNHSDKEDEQPQVVVLK	1423	sp|Q8K039|K1143_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:21	ms_run[1]:scan=13037	42.998418	4	3165.507109	3164.502704	K	K	37	64
PSM	SDNDDIEVESDADKRAHHNALER	1424	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=10405	35.561607	4	2837.1294	2837.1286	M	K	2	25
PSM	VLLHSPGRPSSPRFSSLDLEEDSEVFK	1425	sp|Q8R1G6|PDLI2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:21	ms_run[1]:scan=18994	60.229873	4	3107.496722	3107.496496	R	M	195	222
PSM	GRLSPVPVPR	1426	sp|Q64012|RALY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=8298	29.560598	2	1156.612679	1156.611793	R	A	132	142
PSM	SKLDWESFKEEEGIGEELAIHNR	1427	sp|O88271|CFDP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=20510	64.643271	4	2795.282302	2795.280355	K	G	240	263
PSM	ADGDSGSERGGGGGGGGGPGGFQPAPR	1428	sp|O35295|PURB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=10861	36.779362	3	2434.9888	2434.9882	M	G	2	29
PSM	TRSFDNLTTTCENMVPLASR	1429	sp|Q8K296|MTMR3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=18997	60.23881	3	2392.055067	2392.055247	K	R	611	631
PSM	KFPDRLADDEGDSDSESVGQSR	1430	sp|Q9Z277|BAZ1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:21	ms_run[1]:scan=10269	35.227486	3	2489.035060	2489.034371	R	G	1452	1474
PSM	AHSPVAVQVPGMQNNIADPEELFTKLER	1431	sp|Q99JT2|STK26_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,3-UNIMOD:21	ms_run[1]:scan=27246	87.556616	3	3211.5360	3211.5368	M	I	2	30
PSM	DKQSPSQANGCSDQRPIDILEMLSR	1432	sp|Q91YD3|DCP1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=25139	80.330519	4	2925.300167	2924.315772	R	A	159	184
PSM	MREDYDSVEQDGDEPGPQR	1433	sp|Q9CWZ3|RBM8A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:21	ms_run[1]:scan=9368	32.39537	3	2301.884798	2301.884535	R	S	50	69
PSM	NQAIQISPTIASSSGQTSSR	1434	sp|Q504N7|IFIXL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	9-UNIMOD:21	ms_run[1]:scan=14051	46.354216	3	2113.993193	2111.984842	R	S	146	166
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1435	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,19-UNIMOD:35	ms_run[1]:scan=19662	62.164124	3	2701.099004	2701.099005	K	M	106	130
PSM	MEVAEANSPTEEEEEEEEEGEETISEPRPHTR	1436	sp|Q3UI43|BABA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=19182	60.819424	3	3820.5414	3820.5413	-	S	1	33
PSM	SSPPAPGTAGPTSPSVALTNLALRR	1437	tr|E9Q6E5|E9Q6E5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=23630	74.701078	3	2539.2808	2539.2790	M	N	2	27
PSM	RASVVSLMTWKPSK	1438	sp|Q8VD58|EVI2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21	ms_run[1]:scan=15433	50.347084	3	1668.842732	1668.842264	K	S	267	281
PSM	KKEAEESAVCAVEDMECSDTQVQEAAQTR	1439	sp|Q80X41|VRK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:4,17-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=16381	52.770069	3	3379.409805	3378.405117	R	S	359	388
PSM	YAHQQPPSPLPVYSSSAK	1440	sp|Q8VI36|PAXI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=10573	36.001486	3	2035.940449	2035.940458	R	N	76	94
PSM	STLHEAPKAQLSPGLYDDSSAR	1441	sp|Q60974|NCOR1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:21	ms_run[1]:scan=11620	38.958072	3	2422.116968	2422.116584	R	R	1470	1492
PSM	RSETPPHWRQEMQR	1442	sp|A2AR02|PPIG_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:21	ms_run[1]:scan=5721	22.048228	4	1916.846784	1916.846514	R	A	353	367
PSM	RYPSSISSSPQKDLTQAK	1443	sp|Q80X50|UBP2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	8-UNIMOD:21	ms_run[1]:scan=8862	31.090622	3	2071.993682	2071.993950	R	N	621	639
PSM	ILELTPEPDRPR	1444	sp|Q69ZA1|CDK13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:21	ms_run[1]:scan=12141	40.599841	3	1514.751040	1514.749409	R	I	1241	1253
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1445	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21244	66.919509	3	3916.655341	3913.648853	R	I	245	277
PSM	GIPLPTGDTSPEPELLPGDPLPPPKEVINGNIK	1446	sp|Q9Z1D1|EIF3G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	18.0	10-UNIMOD:21	ms_run[1]:scan=25040	79.977171	3	3481.765793	3480.779320	K	T	33	66
PSM	AASPPASASDLIEQQQKR	1447	sp|Q8C079-2|STRP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=12152	40.628	3	1975.9364	1975.9364	R	G	333	351
PSM	AGLQFPVGR	1448	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12915	42.645	2	943.52395	943.5240	R	V	22	31
PSM	ALSRQEMQEVQSSR	1449	sp|O88569-3|ROA2-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5740	22.111	3	1647.7999	1647.7999	K	S	175	189
PSM	ASEDESDLEDEEEKSQEDTEQKR	1450	sp|P25206|MCM3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:21	ms_run[2]:scan=9497	32.798	3	2805.0985	2805.0985	K	K	667	690
PSM	ASGQAFELILSPR	1451	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	11-UNIMOD:21	ms_run[2]:scan=22452	70.749	3	1467.7123	1467.7123	R	S	15	28
PSM	ASGQAFELILSPR	1452	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	11-UNIMOD:21	ms_run[2]:scan=22493	70.915	3	1467.7123	1467.7123	R	S	15	28
PSM	ATAPQTQHVSPMRQVEPPTKK	1453	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	10-UNIMOD:21	ms_run[2]:scan=5746	22.127	4	2410.1828	2410.1828	R	G	124	145
PSM	CQSPILHSSSSASSNIPSATNQKPQPQNQNIPR	1454	sp|D0QMC3|MNDAL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10907	36.918	4	3652.7053	3652.7053	R	G	274	307
PSM	DNIQGITKPAIRR	1455	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5871	22.522	3	1480.8474	1480.8474	R	L	25	38
PSM	DRGGDTSDTESSIIIR	1456	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:21	ms_run[2]:scan=11538	38.717	2	1800.7891	1800.7891	R	R	308	324
PSM	DRGGDTSDTESSIIIRR	1457	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:21	ms_run[2]:scan=8698	30.708	3	1956.8902	1956.8902	R	R	308	325
PSM	EALVEPASESPRPALAR	1458	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:21	ms_run[2]:scan=11358	38.212	3	1871.9142	1871.9142	R	S	266	283
PSM	ERDHSPTPSVFNSDEERYR	1459	sp|Q9D824-3|FIP1-3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=8627	30.511	4	2400.0132	2400.0132	R	Y	430	449
PSM	GEEPDVRYDFEPYVSNNSWSPIMR	1460	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	20-UNIMOD:21	ms_run[2]:scan=24985	79.788	3	2966.2582	2966.2582	R	T	549	573
PSM	GFGFGQGAGALVHSE	1461	sp|P97315|CSRP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	14-UNIMOD:21	ms_run[2]:scan=20028	63.198	2	1512.6399	1512.6399	K	-	179	194
PSM	GRLSPVPVPR	1462	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=8276	29.5	3	1156.6118	1156.6118	R	A	116	126
PSM	GRLSPVPVPR	1463	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=8331	29.667	3	1156.6118	1156.6118	R	A	116	126
PSM	GRLSPVPVPR	1464	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=8389	29.837	3	1156.6118	1156.6118	R	A	116	126
PSM	GRLSPVPVPR	1465	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=8451	30.005	3	1156.6118	1156.6118	R	A	116	126
PSM	HCSEEKEDEEYMPIKNPNQDIYR	1466	sp|Q9CXG3|PPIL4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=12499	41.475	4	3003.2416	3003.2416	R	E	391	414
PSM	HLSHPEPEQQHVIQR	1467	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=3800	16.249	3	1913.8898	1913.8898	R	L	654	669
PSM	HQEGEIFDTEKEKYEITEQR	1468	sp|P47911|RL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10941	37.027	4	2508.1769	2508.1769	R	K	235	255
PSM	HQGVMVGMGQKDSYVGDEAQSKR	1469	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35	ms_run[2]:scan=5217	20.517	4	2522.1642	2522.1642	R	G	40	63
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVK	1470	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:21	ms_run[2]:scan=10520	35.877	3	2758.3916	2758.3916	R	K	123	149
PSM	HVSPEPVKMK	1471	sp|E9PVX6-2|KI67-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=2666	12.084	3	1230.5832	1230.5832	R	H	2737	2747
PSM	IDISPSALRK	1472	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=11924	39.979	3	1178.606	1178.6060	R	H	366	376
PSM	IFPDRLSGDTSPPTTPSFPR	1473	sp|Q8BLB7-2|LMBL3-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	10-UNIMOD:21	ms_run[2]:scan=18913	59.989	3	2267.0624	2267.0624	R	S	570	590
PSM	IQQFDDGGSDEEDIWEEKHIAFTPESQR	1474	tr|A0A286YCG3|A0A286YCG3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:21	ms_run[2]:scan=20039	63.223	4	3385.4412	3385.4412	R	R	85	113
PSM	ISDPLTSSPGRSSR	1475	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:21	ms_run[2]:scan=8090	28.932	3	1538.709	1538.7090	R	R	20	34
PSM	KASPEPPDSAESALKLGEEQQR	1476	sp|Q8K3X4|I2BPL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=12762	42.239	3	2446.1377	2446.1377	R	Q	524	546
PSM	KESYSVYVYK	1477	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7794	28.09	3	1264.634	1264.6340	R	V	35	45
PSM	KNEPEDEEEEEEEEEEEDDEEEEEDEE	1478	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12337	41.074	3	3398.1609	3398.1609	K	-	184	211
PSM	KPIKYLEESDDDDDLF	1479	sp|Q01320|TOP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:21	ms_run[2]:scan=20092	63.392	3	2020.8554	2020.8554	R	-	1513	1529
PSM	KPIKYLEESDDDDDLF	1480	sp|Q01320|TOP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:21	ms_run[2]:scan=20121	63.482	2	2020.8554	2020.8554	R	-	1513	1529
PSM	KRSASADNLILPR	1481	sp|Q8BGU5-2|CCNY-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=7568	27.441	3	1519.7872	1519.7872	R	W	297	310
PSM	LKKLELSENR	1482	sp|O35381|AN32A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3046	13.579	3	1228.7139	1228.7139	K	I	66	76
PSM	LLLLERSSPVRDR	1483	sp|Q0VBL3-2|RBM15-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:21	ms_run[2]:scan=10782	36.554	3	1632.8713	1632.8713	R	R	694	707
PSM	LLSSFLKRPK	1484	tr|A2AD32|A2AD32_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=13061	43.055	3	1267.7054	1267.7054	R	S	84	94
PSM	LLSSFLKRPK	1485	tr|A2AD32|A2AD32_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=13123	43.228	3	1267.7054	1267.7054	R	S	84	94
PSM	LQEYFSVAAGAGDH	1486	sp|Q9D892|ITPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15102	49.47	2	1463.6681	1463.6681	K	-	185	199
PSM	LSGFSFKK	1487	sp|P26645|MARCS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=11209	37.772	2	992.47323	992.4732	K	S	159	167
PSM	LSGLSFKR	1488	sp|P28667|MRP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=10021	34.606	2	986.49503	986.4950	K	N	100	108
PSM	LSGLSFKR	1489	sp|P28667|MRP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=10079	34.777	2	986.49503	986.4950	K	N	100	108
PSM	LSGLSFKR	1490	sp|P28667|MRP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=10149	34.948	2	986.49503	986.4950	K	N	100	108
PSM	LTWHSCPEDEAQ	1491	tr|Q9DCC5|Q9DCC5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:4	ms_run[2]:scan=9480	32.747	2	1471.6038	1471.6038	R	-	172	184
PSM	LTWHSCPEDEAQ	1492	tr|Q9DCC5|Q9DCC5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:4	ms_run[2]:scan=9542	32.922	2	1471.6038	1471.6038	R	-	172	184
PSM	LVREIAQDFKTDLR	1493	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13993	46.208	3	1702.9366	1702.9366	R	F	71	85
PSM	MREIVHLQAGQCGNQIGAK	1494	sp|P68372|TBB4B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:4	ms_run[2]:scan=8193	29.233	4	2109.0572	2109.0572	-	F	1	20
PSM	NKQEDLNSEALSPSITCDLSSR	1495	tr|A0A087WR39|A0A087WR39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=17057	54.557	3	2543.1211	2543.1211	K	V	101	123
PSM	NRNSNVVPYDFNR	1496	tr|S4R1M0|S4R1M0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=12139	40.597	3	1673.7311	1673.7311	K	V	798	811
PSM	NSSPSPVPGSQNVPAPAVKK	1497	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=8280	29.508	3	2040.0041	2040.0041	R	I	130	150
PSM	NSSPSPVPGSQNVPAPAVKK	1498	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=8457	30.023	3	2040.0041	2040.0041	R	I	130	150
PSM	QPLLLSEDEEDTKRVVR	1499	tr|A0A0U1RPR0|A0A0U1RPR0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:21	ms_run[2]:scan=13833	45.785	3	2106.0358	2106.0358	K	S	34	51
PSM	QPSIELPSMAVASTK	1500	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=20281	63.931	2	1637.7736	1637.7736	R	T	239	254
PSM	RHSVNLDEGESAQAVHK	1501	sp|E9PVX6-2|KI67-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=3923	16.685	3	1955.8851	1955.8851	R	T	335	352
PSM	RKLSGDLEAGAPK	1502	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=4358	18.102	3	1420.7075	1420.7075	K	N	1188	1201
PSM	RKTSDANETEDHLESLICK	1503	sp|Q3UYV9|NCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=13327	43.915	4	2325.0308	2325.0308	R	V	19	38
PSM	RLSPVEKAQGPR	1504	tr|E9Q8J8|E9Q8J8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=2819	12.675	3	1416.7239	1416.7239	R	L	124	136
PSM	RPPSAFFLFCSEYRPK	1505	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=20348	64.126	3	2080.9594	2080.9594	K	I	97	113
PSM	RPPSAFFLFCSEYRPK	1506	sp|P63158|HMGB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=20403	64.298	3	2080.9594	2080.9594	K	I	97	113
PSM	RRISDPLTSSPGR	1507	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=5975	22.886	3	1520.7461	1520.7461	R	S	18	31
PSM	RRSIQDLTVTGTEPGQVSSR	1508	tr|A2AP93|A2AP93_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=9837	33.97	3	2266.1067	2266.1067	R	S	410	430
PSM	SGVSITIDDPVRTAQVPSPPRGK	1509	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	18-UNIMOD:21	ms_run[2]:scan=15779	51.204	4	2456.2425	2456.2425	K	I	920	943
PSM	SLDLFGCEVTNR	1510	sp|Q9EST5|AN32B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=18623	59.039	2	1409.6609	1409.6609	K	S	117	129
PSM	SNSAPLIHGLSDSSPVFQAEAPSAR	1511	sp|Q9DB52|F122A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:21	ms_run[2]:scan=20806	65.536	3	2617.2174	2617.2174	R	R	32	57
PSM	SNSVGIQDAFPDGSDPTFQKR	1512	sp|A2BH40-3|ARI1A-3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:21	ms_run[2]:scan=18211	57.816	3	2345.0325	2345.0325	R	N	1183	1204
PSM	SRHEEHERPPFVAYPHLR	1513	sp|P43024|CX6A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6744	25.261	5	2256.1301	2256.1301	K	I	63	81
PSM	SSGSPYGGGYGSGGGSGGYGSRRF	1514	tr|A2AL12|A2AL12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=11234	37.847	3	2292.9186	2292.9186	R	-	295	319
PSM	SSSFKDFAK	1515	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=6815	25.441	2	1095.4638	1095.4638	R	S	25	34
PSM	SVVSFDKVK	1516	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:21	ms_run[2]:scan=10053	34.707	2	1087.5315	1087.5315	R	E	623	632
PSM	TASFSESRADEVAPAKK	1517	tr|Q3TS02|Q3TS02_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=5671	21.894	3	1872.8619	1872.8619	R	A	453	470
PSM	TGIRTDSREDEISPPPPNPVVK	1518	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=10887	36.866	4	2483.2057	2483.2057	K	G	71	93
PSM	TGIRTDSREDEISPPPPNPVVK	1519	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:21	ms_run[2]:scan=11263	37.93	3	2483.2057	2483.2057	K	G	71	93
PSM	TLSPTPSAEGYQDVRDR	1520	tr|E9Q9Q7|E9Q9Q7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=10844	36.73	3	1970.8735	1970.8735	R	M	87	104
PSM	TVSDNSLSSSKEGKPELR	1521	sp|Q80TY0-5|FNBP1-5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=5986	22.931	3	2012.9416	2012.9416	R	F	294	312
PSM	TVSEPNLKLR	1522	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=9431	32.6	3	1235.6275	1235.6275	K	Y	176	186
PSM	VLLHSPGRPSSPR	1523	tr|E9Q996|E9Q996_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	10-UNIMOD:21	ms_run[2]:scan=4190	17.563	3	1481.7504	1481.7504	R	F	195	208
PSM	VLLHSPGRPSSPR	1524	tr|E9Q996|E9Q996_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	10-UNIMOD:21	ms_run[2]:scan=4242	17.735	3	1481.7504	1481.7504	R	F	195	208
PSM	VMTIPYQPMPASSPVICAGGQDR	1525	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=21758	68.282	3	2554.142	2554.1420	R	C	178	201
PSM	VRGWSPPPEVRR	1526	tr|D6RHA7|D6RHA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=9069	31.567	3	1514.7507	1514.7507	R	S	26	38
PSM	VSSSPGIKGGAATILKPGNSK	1527	tr|A0A2I3BPX9|A0A2I3BPX9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=9291	32.144	3	2048.0667	2048.0667	R	A	294	315
PSM	WGSQGNRTLSVNSSEQK	1528	sp|Q8C2K1-2|DEFI6-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:21	ms_run[2]:scan=8995	31.4	3	1956.8691	1956.8691	R	S	215	232
PSM	YHGHSMSDPGVSYR	1529	sp|P35486|ODPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:21	ms_run[2]:scan=5568	21.593	3	1671.6501	1671.6501	R	T	289	303
PSM	YQKSTELLIR	1530	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6935	25.734	3	1249.703	1249.7030	R	K	55	65
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1531	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20943	65.985361	4	4270.8681	4270.8667	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	1532	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20923	65.912755	4	4132.778979	4131.792616	K	R	104	142
PSM	MQASIEKGGSLPKVEAK	1533	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=8768	30.868324	3	1851.915424	1851.916551	K	F	249	266
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	1534	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	21-UNIMOD:21	ms_run[1]:scan=19550	61.875198	3	3092.408327	3090.400547	K	S	1028	1055
PSM	KASGPPVSELITK	1535	sp|P15864|H12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=11168	37.642976	2	1405.722996	1405.721798	R	A	34	47
PSM	SETAPAAPAAPAPAEKTPVK	1536	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10638	36.165347	2	2024.9813	2024.9815	M	K	2	22
PSM	RKTSGPPVSELITK	1537	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=7826	28.168388	3	1591.833841	1591.833473	K	A	33	47
PSM	KTSGPPVSELITK	1538	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:21	ms_run[1]:scan=11605	38.907772	3	1435.733093	1435.732362	R	A	34	47
PSM	CDVDIRKDLYANTVLSGGTTMYPGIADR	1539	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=24453	77.748572	3	3083.4697	3083.4687	K	M	285	313
PSM	IDISPSTFR	1540	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=17706	56.426413	2	1114.506637	1114.505991	R	K	676	685
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1541	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20337	64.096024	4	3913.648310	3913.648853	R	I	245	277
PSM	SGVSITIDDPVRTAQVPSPPRGK	1542	sp|Q9JIX8|ACINU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:21	ms_run[1]:scan=15363	50.166253	4	2456.243850	2456.242453	K	I	986	1009
PSM	SASPDDDLGSSNWEAADLGNEER	1543	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=20493	64.60225	3	2513.981294	2513.982001	R	K	15	38
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	1544	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=25873	83.059023	3	3764.795037	3763.786332	R	V	592	630
PSM	LQEKLSPPYSSPQEFAQDVGR	1545	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=19524	61.801228	3	2456.142728	2455.142071	R	M	747	768
PSM	HASAAGFPLSGTATWTLGR	1546	tr|D3Z7R7|D3Z7R7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=21685	68.063871	2	1980.928377	1979.925476	R	G	81	100
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1547	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	24-UNIMOD:21	ms_run[1]:scan=23188	73.323162	4	3492.543806	3491.560570	R	T	545	573
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1548	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=19223	60.945567	3	3086.393363	3085.389387	K	S	157	186
PSM	GRADGDWDDQEVLDYFSDKESAK	1549	sp|Q8K019|BCLF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=20314	64.032354	3	2725.118431	2725.118100	K	Q	367	390
PSM	RIDISPSALR	1550	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=13062	43.057186	3	1206.612276	1206.612187	R	K	652	662
PSM	IDISPSALR	1551	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=16456	52.97339	2	1050.511644	1050.511076	R	K	653	662
PSM	RADALTSSPGRDLPPFEDESEGLLGTEGPMEEEEDGEELIGDGMER	1552	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=26748	85.924751	4	5041.1683	5041.1637	R	D	34	80
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	1553	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=21847	68.579362	4	3060.465200	3059.461764	R	L	162	189
PSM	QPSIELPSMAVASTK	1554	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=20737	65.319223	2	1638.776620	1637.773575	R	T	241	256
PSM	DNIQGITKPAIR	1555	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8010	28.688014	3	1324.748376	1324.746299	R	R	25	37
PSM	RYSPPIQR	1556	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=4732	19.320969	2	1095.523272	1095.522644	R	R	614	622
PSM	SETAPVAQAASTATEKPAAAK	1557	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=13441	44.36117	3	2120.9994	2120.9986	M	K	2	23
PSM	SPFLSTPPLPPMPAGTPPPQPPAK	1558	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:21	ms_run[1]:scan=23613	74.636106	3	2502.247856	2501.242971	K	S	401	425
PSM	ASGVAVSDGVIKVFNDMK	1559	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=24006	76.072155	2	1973.9170	1973.9164	M	V	2	20
PSM	ASGVAVSDGVIKVFNDMKVR	1560	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24790	79.051239	3	2213.0912	2213.0910	M	K	2	22
PSM	SSPKEEVASEPEEAASPTTPK	1561	sp|Q9D6Z1|NOP56_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=7647	27.673754	3	2249.996290	2249.994069	K	K	528	549
PSM	RAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	1562	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=3584	15.517957	4	3140.385482	3140.385674	K	R	197	233
PSM	ALSEEMGDTLEEGSASPTSPDCSLDSPGPEK	1563	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=20972	66.074604	3	3272.327977	3272.326181	K	M	95	126
PSM	RASVCAEAYNPDEEEDDAESR	1564	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=10313	35.330173	3	2491.944305	2491.943507	R	I	110	131
PSM	HVSPEPVKMK	1565	sp|E9PVX6|KI67_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=2620	11.900936	3	1230.582921	1230.583196	R	H	2978	2988
PSM	TQSCETKLLDEKASK	1566	sp|O54824|IL16_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=6013	23.041242	3	1816.827659	1816.827796	R	L	965	980
PSM	AGGQAPSSPSYENSLHSLQSR	1567	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=11363	38.230179	3	2252.976399	2251.985904	R	M	209	230
PSM	LSSESHHGGSPIHWVLPAGMSAK	1568	sp|E9Q5K9|YTDC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=14766	48.431387	3	2464.137228	2464.135880	R	M	416	439
PSM	MDRGVSMPNMLEPK	1569	sp|Q8K4G5|ABLM1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=16618	53.415684	3	1684.722940	1683.718385	R	I	784	798
PSM	SHHAPMSPGSSGGGGQPLAR	1570	sp|A2BH40|ARI1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=4427	18.301098	3	1966.847619	1966.846908	R	T	359	379
PSM	ALGSPTKQLLPCEMACNEKLGK	1571	sp|Q99J77|SIAS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=15309	50.031317	3	2525.189088	2524.188904	R	S	272	294
PSM	ALGSPTKQLLPCEMACNEKLGK	1572	sp|Q99J77|SIAS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=15450	50.3934	3	2524.189239	2524.188904	R	S	272	294
PSM	DSQDTSAEQSDHDDEVASLASASGGFGSK	1573	sp|Q3UJB9|EDC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=18150	57.637528	3	2979.180868	2977.173443	R	I	875	904
PSM	TTSFAESCKPVQQPSAFGSMK	1574	sp|Q9WV60|GSK3B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=14208	46.845686	3	2367.027596	2367.027635	R	V	7	28
PSM	RILSDVTHSAVFGVPASK	1575	sp|Q3UHJ0|AAK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=18657	59.146451	3	1962.994188	1962.992828	R	S	632	650
PSM	KGGEFDEFVNDDTDDDLPVSK	1576	sp|Q62018|CTR9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=19368	61.385451	3	2420.991463	2420.989712	K	K	913	934
PSM	MEIQSGPQPGSPGRAER	1577	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=12545	41.605077	3	1917.8403	1917.8399	-	L	1	18
PSM	KPIKYLEESDDDDDLF	1578	sp|Q01320|TOP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:21	ms_run[1]:scan=20063	63.305565	2	2020.854197	2020.855450	R	-	1513	1529
PSM	TFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIK	1579	sp|Q9CSU0|RPR1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	17-UNIMOD:21	ms_run[1]:scan=27596	88.42388	3	3918.727133	3918.724837	R	A	149	183
PSM	SASSDTSEELNSQDSPKRQVSTEPSSTSSSSSDPILDLNISLAVAK	1580	sp|P70441|NHRF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=22208	69.814808	4	4831.238891	4831.240802	R	E	283	329
PSM	IIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELR	1581	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	13-UNIMOD:21,29-UNIMOD:4,42-UNIMOD:4	ms_run[1]:scan=28426	90.03547	4	5213.4299	5213.4245	K	L	104	149
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	1582	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=13203	43.488038	4	5183.9652	5182.9782	R	K	34	79
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	1583	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=14300	47.125245	4	5182.9632	5182.9782	R	K	34	79
PSM	RPHTPTPGIYMGRPTYGSSR	1584	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:21	ms_run[1]:scan=8298	29.560598	4	2310.074896	2310.072886	K	R	198	218
PSM	ARTELESPEESGPPEDEEDAEDFVIDGGPEEAAAKEEEQR	1585	sp|Q64697|PTCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:21	ms_run[1]:scan=21348	67.163462	4	4465.873699	4465.871848	R	C	93	133
PSM	SDNDDIEVESDADKRAHHNALER	1586	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9092	31.612821	3	2757.1573	2757.1622	M	K	2	25
PSM	SDNDDIEVESDADKRAHHNALER	1587	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9531	32.890757	4	2758.1472	2757.1622	M	K	2	25
PSM	SQSLRSFQGAGSWASR	1588	sp|Q8C2K5|RASL3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=17656	56.285424	3	1883.772934	1883.771692	K	R	811	827
PSM	QAVDFLCNEGHIYSTVDDDHFKSTDAE	1589	sp|Q62193|RFA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=18532	58.739318	4	3112.337159	3112.335624	K	-	244	271
PSM	ATSPPHLDGTSNPESTVPEKK	1590	sp|Q60953|PML_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=7880	28.31006	3	2271.042407	2271.042022	K	I	526	547
PSM	SKSEEAHAEDSVMDHHFR	1591	sp|Q9CY58|PAIRB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=7160	26.352047	4	2190.875679	2190.878996	K	K	327	345
PSM	SKSEEAHAEDSVMDHHFR	1592	sp|Q9CY58|PAIRB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=7177	26.400603	4	2190.875679	2190.878996	K	K	327	345
PSM	QISQDVKLEPDILLR	1593	sp|Q9DBT5|AMPD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=26614	85.4876	2	1828.9346	1828.9331	R	A	85	100
PSM	SKFSFLASDTEEEEENSSAGPGAR	1594	sp|E9PYH6|SET1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=17189	54.984632	3	2625.093696	2624.091551	R	D	514	538
PSM	KFPDRLADDEGDSDSESVGQSR	1595	sp|Q9Z277|BAZ1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	13-UNIMOD:21	ms_run[1]:scan=10270	35.228995	3	2489.035060	2489.034371	R	G	1452	1474
PSM	NLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALR	1596	sp|Q60787|LCP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=27078	87.029619	4	4736.283570	4736.279968	R	K	397	438
PSM	SIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCSGDDKAR	1597	sp|Q9Z1F9|SAE2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	28-UNIMOD:21,39-UNIMOD:4	ms_run[1]:scan=16874	54.058615	4	4820.949681	4819.963594	K	K	563	609
PSM	SNSAPLIHGLSDSSPVFQAEAPSAR	1598	sp|Q9DB52|F122A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=20730	65.299165	3	2617.221177	2617.217361	R	R	32	57
PSM	KFSLKEFGETTSEQTEVAAR	1599	sp|Q8K4L3|SVIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=15826	51.325561	3	2337.094827	2337.088973	R	K	1009	1029
PSM	RYSDGWCEGVSSEGTGFFPGNYVEPSC	1600	sp|Q8BYZ1|ABI3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21,7-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=26334	84.579443	3	3123.205553	3123.205218	R	-	341	368
PSM	ARGSVSDEEMMELR	1601	sp|Q61233|PLSL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,4-UNIMOD:21	ms_run[1]:scan=18133	57.588702	2	1730.6996	1730.7000	M	E	2	16
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1602	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=21297	67.050854	3	2685.103128	2685.104090	K	M	106	130
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1603	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=21633	67.921149	3	2685.105014	2685.104090	K	M	106	130
PSM	KGDRSPEPGQTWTHEVFSSR	1604	tr|E9Q616|E9Q616_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:21	ms_run[1]:scan=11673	39.103319	4	2380.060938	2380.059738	R	S	90	110
PSM	VGQQAIVLCISPSKPNPVFK	1605	sp|Q9WU00|NRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=19876	62.744481	3	2262.166836	2261.164327	R	V	126	146
PSM	IFPDRLSGDTSPPTTPSFPR	1606	sp|Q8BLB7|LMBL3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=18846	59.764088	3	2267.062255	2267.062364	R	S	595	615
PSM	IFPDRLSGDTSPPTTPSFPR	1607	sp|Q8BLB7|LMBL3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=18863	59.817059	3	2267.062255	2267.062364	R	S	595	615
PSM	EFITGDVEPTDAESAWHSENEEEDKLAGDMK	1608	sp|Q78ZA7|NP1L4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:21	ms_run[1]:scan=21131	66.598009	4	3558.464970	3558.465786	R	N	108	139
PSM	EFITGDVEPTDAESAWHSENEEEDKLAGDMKNK	1609	sp|Q78ZA7|NP1L4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:21	ms_run[1]:scan=19492	61.705639	4	3800.605797	3800.603676	R	V	108	141
PSM	IGLSLKLGASNSPGQPNSVKR	1610	sp|B2RY56|RBM25_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=12733	42.145813	3	2202.153068	2202.152182	K	K	661	682
PSM	VLQKPSVFGSDSDDDETSVSESLQR	1611	sp|Q5NCR9|NSRP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:21	ms_run[1]:scan=17856	56.836483	3	2806.245247	2804.238944	R	E	22	47
PSM	ATPPKRFCPSPSTSSEGTR	1612	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=8804	30.946284	3	2183.9667	2183.9666	M	I	2	21
PSM	ATPPKRFCPSPSTSSEGTR	1613	sp|P43346|DCK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1,2-UNIMOD:21,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=11149	37.589089	3	2263.9319	2263.9329	M	I	2	21
PSM	KLSVGGDSDPPLKR	1614	sp|Q6NZF1|ZC11A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=6168	23.62243	3	1547.772166	1547.770873	R	S	287	301
PSM	AASLNYLNQPNAAPLQVSR	1615	sp|Q9DBS5|KLC4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:21	ms_run[1]:scan=19711	62.290631	3	2107.030221	2106.025919	R	G	588	607
PSM	SAEDLTDGSYDDILNAEQLKK	1616	sp|Q9D0L7|ARM10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:21	ms_run[1]:scan=20971	66.073077	3	2406.075261	2404.068297	R	L	43	64
PSM	RPYSPEKAFSSNQVVR	1617	sp|Q8BZR9|NCBP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:21	ms_run[1]:scan=10268	35.225976	3	1944.931602	1943.925476	K	R	492	508
PSM	KQPEVWESRDASQHFQAEQR	1618	sp|Q8BJS4|SUN2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=8213	29.308564	4	2535.129908	2535.129215	R	V	270	290
PSM	ISDPLTSSPGR	1619	sp|P97310|MCM2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:21	ms_run[1]:scan=11775	39.457721	2	1210.542638	1208.543833	R	S	20	31
PSM	AASLRGGVGAPGSPSTPPTRFFTEK	1620	sp|Q3UYC0-2|PPM1H-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=15161	49.629	3	2567.2534	2567.2534	R	K	208	233
PSM	AASPPASASDLIEQQQKR	1621	sp|Q8C079-2|STRP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=12222	40.798	3	1975.9364	1975.9364	R	G	333	351
PSM	AGDSDEESRTDDKGVMDYYLK	1622	tr|D3Z4C3|D3Z4C3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=14873	48.771	3	2472.9992	2472.9992	R	Y	328	349
PSM	AGDVLEDSPKRPK	1623	tr|E0CXA0|E0CXA0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	8-UNIMOD:21	ms_run[2]:scan=3535	15.338	3	1490.713	1490.7130	R	E	126	139
PSM	ALSPDPLLR	1624	sp|O54824-2|IL16-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=16583	53.314	2	1060.5318	1060.5318	K	L	230	239
PSM	ALSPDPLLR	1625	sp|O54824-2|IL16-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=16647	53.486	2	1060.5318	1060.5318	K	L	230	239
PSM	ANSFVGTAQYVSPELLTEK	1626	tr|F2Z3Z9|F2Z3Z9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=23215	73.383	3	2133.0031	2133.0031	R	S	115	134
PSM	ATSPSSSVSGDFDDGHHSVPTPGPSR	1627	tr|D6RIL0|D6RIL0_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:21	ms_run[2]:scan=11065	37.359	3	2660.114	2660.1140	R	K	8	34
PSM	AVFPSIVGRPR	1628	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11112	37.484	3	1197.6982	1197.6982	R	H	29	40
PSM	AVFPSIVGRPR	1629	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11172	37.656	3	1197.6982	1197.6982	R	H	29	40
PSM	AWSSTDSDSSNRNLKPTMTK	1630	sp|Q9DCB4-5|ARP21-5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=7392	26.965	3	2305.0046	2305.0046	R	T	326	346
PSM	CSVIRDSLLQDGEFTMDLR	1631	tr|Q5SX49|Q5SX49_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=22005	69.126	3	2254.0722	2254.0722	K	T	71	90
PSM	DNLTLWTSDQQDDDGGEGNN	1632	sp|P61982|1433G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21015	66.219	2	2192.873	2192.8730	R	-	228	248
PSM	DRGGDTSDTESSIIIR	1633	sp|O35892|SP100_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:21	ms_run[2]:scan=11600	38.891	2	1800.7891	1800.7891	R	R	308	324
PSM	DVYLSPRDDGYSTKDSYSSR	1634	tr|S4R1F6|S4R1F6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:21	ms_run[2]:scan=11431	38.421	3	2390.0064	2390.0064	R	E	76	96
PSM	EALVEPASESPRPALAR	1635	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	10-UNIMOD:21	ms_run[2]:scan=11417	38.382	3	1871.9142	1871.9142	R	S	266	283
PSM	EALVEPASESPRPALAR	1636	sp|P70441|NHRF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	10-UNIMOD:21	ms_run[2]:scan=11480	38.551	3	1871.9142	1871.9142	R	S	266	283
PSM	EKSPELPEPSVR	1637	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=8858	31.082	3	1446.6756	1446.6756	K	M	218	230
PSM	EKSPELPEPSVR	1638	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=8944	31.278	2	1446.6756	1446.6756	K	M	218	230
PSM	ERASSPPDRIDIFGR	1639	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=13682	45.35	3	1794.8414	1794.8414	R	T	53	68
PSM	FHDSEGDDTEETEDYRQFR	1640	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=11239	37.86	3	2454.9238	2454.9238	K	K	105	124
PSM	FNTGSNPTEEAATSSRPFKVAGQSSPSGIQSR	1641	sp|O35601-2|FYB1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	13-UNIMOD:21	ms_run[2]:scan=13225	43.559	4	3374.5528	3374.5528	K	K	4	36
PSM	FSFKKSFK	1642	sp|P26645|MARCS_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:21	ms_run[2]:scan=7278	26.663	3	1097.5311	1097.5311	R	L	151	159
PSM	FVSEGDGGRLKPESY	1643	sp|Q61823|PDCD4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=11914	39.951	3	1719.7505	1719.7505	R	-	455	470
PSM	GEEPDVRYDFEPYVSNNSWSPIMR	1644	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	20-UNIMOD:21	ms_run[2]:scan=24894	79.445	3	2966.2582	2966.2582	R	T	549	573
PSM	GLLYDSSEEDEERPARK	1645	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:21	ms_run[2]:scan=8986	31.381	3	2072.9052	2072.9052	R	R	134	151
PSM	GPPDFSSDEEREPTPVLGSGASVGR	1646	sp|Q61033-2|LAP2A-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:21	ms_run[2]:scan=15771	51.187	3	2622.1599	2622.1599	K	G	61	86
PSM	GPQAPTGRRDSDICLNAP	1647	tr|S4R2F6|S4R2F6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	11-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=11145	37.578	3	2003.8884	2003.8884	R	-	76	94
PSM	GRLSPVPVPR	1648	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=8294	29.546	2	1156.6118	1156.6118	R	A	116	126
PSM	GRLSPVPVPR	1649	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=8348	29.714	2	1156.6118	1156.6118	R	A	116	126
PSM	GSYRGGSISVQVNSVKFDSE	1650	tr|A0A286YDA2|A0A286YDA2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	19-UNIMOD:21	ms_run[2]:scan=16066	51.956	3	2194.9896	2194.9896	R	-	681	701
PSM	HLQLAIRNDEELNKLLGK	1651	sp|Q64523|H2A2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16427	52.887	3	2103.18	2103.1800	R	V	83	101
PSM	HLQLAIRNDEELNKLLGR	1652	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18659	59.15	4	2131.1862	2131.1862	R	V	83	101
PSM	HLSHPEPEQQHVIQR	1653	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=3751	16.083	3	1913.8898	1913.8898	R	L	654	669
PSM	IDISPSTFRK	1654	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=12606	41.776	3	1242.601	1242.6010	R	H	676	686
PSM	IDISPSTFRK	1655	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=12922	42.661	2	1242.601	1242.6010	R	H	676	686
PSM	IFPDRLSGDTSPPTTPSFPR	1656	sp|Q8BLB7-2|LMBL3-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:21	ms_run[2]:scan=19025	60.331	3	2267.0624	2267.0624	R	S	570	590
PSM	IGEGTYGVVYKGR	1657	tr|D3Z2T9|D3Z2T9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:21	ms_run[2]:scan=8588	30.401	3	1477.6966	1477.6966	K	H	10	23
PSM	ISDPLTSSPGRSSR	1658	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	12-UNIMOD:21	ms_run[2]:scan=8203	29.273	3	1538.709	1538.7090	R	R	20	34
PSM	ISSKSPGHMVILNQTK	1659	tr|A0A1L1STF9|A0A1L1STF9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=7998	28.665	3	1818.9063	1818.9063	R	G	548	564
PSM	KEVKYFAESDEEEDVDFAMFN	1660	sp|Q64511|TOP2B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:21	ms_run[2]:scan=23881	75.59	3	2621.0557	2621.0557	R	-	1592	1613
PSM	KKNLQYYDISAK	1661	tr|Q14AA6|Q14AA6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4754	19.395	3	1469.7878	1469.7878	R	S	141	153
PSM	KLEKEEEEGISQESSEEEQ	1662	sp|P17095-1|HMGA1-1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5715	22.03	3	2235.9867	2235.9867	K	-	78	97
PSM	KPIKYLEESDDDDDLF	1663	sp|Q01320|TOP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:21	ms_run[2]:scan=20149	63.569	3	2020.8554	2020.8554	R	-	1513	1529
PSM	KRSASADNLILPR	1664	sp|Q8BGU5-2|CCNY-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=7624	27.612	3	1519.7872	1519.7872	R	W	297	310
PSM	KTSFDQDSDVDIFPSDFTSEPPALPR	1665	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:21	ms_run[2]:scan=25095	80.171	3	2990.3223	2990.3223	K	T	1561	1587
PSM	LASNSPVLPQAFAR	1666	tr|A0A0G2JGN6|A0A0G2JGN6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:21	ms_run[2]:scan=18214	57.825	2	1549.7654	1549.7654	R	V	78	92
PSM	LLEGEEERLKLSPSPSSR	1667	sp|P14733|LMNB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	12-UNIMOD:21	ms_run[2]:scan=12770	42.256	3	2106.0358	2106.0358	K	V	381	399
PSM	LRELAGNSSTPPPVSPGRGNPMHR	1668	sp|Q99PV8-2|BC11B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	15-UNIMOD:21	ms_run[2]:scan=8592	30.41	4	2606.2537	2606.2537	R	L	295	319
PSM	LSGFSFKK	1669	sp|P26645|MARCS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:21	ms_run[2]:scan=11028	37.26	2	992.47323	992.4732	K	S	159	167
PSM	LSSLERLR	1670	tr|E9PUI4|E9PUI4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=8664	30.622	2	1052.538	1052.5380	R	L	792	800
PSM	LVREIAQDFKTDLR	1671	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14064	46.397	3	1702.9366	1702.9366	R	F	71	85
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1672	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	19-UNIMOD:21	ms_run[2]:scan=15876	51.465	4	3318.5816	3318.5816	R	S	2386	2416
PSM	NKAITSLLGGGSPK	1673	sp|Q6KCD5-2|NIPBL-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	12-UNIMOD:21	ms_run[2]:scan=12757	42.224	2	1421.7279	1421.7279	R	N	2641	2655
PSM	NSSPSISPNTSFASDGSPSPLGGIKR	1674	sp|Q9DBR1-2|XRN2-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=17417	55.633	3	2639.2228	2639.2228	R	K	469	495
PSM	NSSPSPVPGSQNVPAPAVK	1675	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:21	ms_run[2]:scan=11596	38.878	2	1911.9092	1911.9092	R	K	130	149
PSM	QICLVMLETLSQSPQGR	1676	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=25574	81.958	3	2038.9581	2038.9581	K	V	161	178
PSM	QISPVKFNDADSVLPHKK	1677	tr|B8JJC1|B8JJC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=12180	40.685	4	2102.0562	2102.0562	R	Q	59	77
PSM	QKHSQAVEELADQLEQTKR	1678	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11444	38.452	4	2237.14	2237.1400	R	V	1192	1211
PSM	QLFHPEQLITGKEDAANNYAR	1679	sp|P68373|TBA1C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15185	49.7	4	2414.1979	2414.1979	R	G	85	106
PSM	QPSIELPSMAVASTK	1680	sp|P19973-2|LSP1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=20212	63.75	2	1637.7736	1637.7736	R	T	239	254
PSM	REGSYDRYLR	1681	tr|B7ZC24|B7ZC24_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21	ms_run[2]:scan=6822	25.465	3	1393.614	1393.6140	R	V	123	133
PSM	RIDISPSTFR	1682	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:21	ms_run[2]:scan=14043	46.339	2	1270.6071	1270.6071	R	K	675	685
PSM	RKATGPPVSELITK	1683	sp|P43276|H15_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5862	22.493	3	1495.8722	1495.8722	K	A	33	47
PSM	RKTSDANETEDHLESLICK	1684	sp|Q3UYV9|NCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=13265	43.696	3	2325.0308	2325.0308	R	V	19	38
PSM	RQSLEVAAPEGPKMER	1685	tr|Q9D3Q7|Q9D3Q7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=8656	30.605	3	1876.8866	1876.8866	R	Q	37	53
PSM	SASRPSSLIEQEKQR	1686	sp|E9Q394-2|AKP13-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=5394	21.059	3	1794.8625	1794.8625	R	S	2503	2518
PSM	SLSPGGAALGYR	1687	sp|Q0VBL3-2|RBM15-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=13932	46.037	2	1227.5649	1227.5649	R	D	291	303
PSM	SLSPLSGTTDTKAESPAGR	1688	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=10102	34.841	2	1953.9045	1953.9045	R	V	423	442
PSM	SPFLSTPPLPPMPAGTPPPQPPAK	1689	sp|Q99PV8-2|BC11B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	16-UNIMOD:21	ms_run[2]:scan=23481	74.121	3	2501.243	2501.2430	K	S	329	353
PSM	SPFLSTPPLPPMPAGTPPPQPPAK	1690	sp|Q99PV8-2|BC11B-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	16-UNIMOD:21	ms_run[2]:scan=23526	74.292	3	2501.243	2501.2430	K	S	329	353
PSM	SSSLGDFSWSQR	1691	sp|Q91VY6|CYTIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:21	ms_run[2]:scan=19346	61.336	2	1435.5769	1435.5769	R	K	64	76
PSM	TKGHLDAELDAYMAQTDPETND	1692	sp|Q9CY57-5|CHTOP-5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17797	56.679	3	2434.0594	2434.0594	K	-	156	178
PSM	TTAVEIDYDSLKR	1693	sp|O35601-2|FYB1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	10-UNIMOD:21	ms_run[2]:scan=12539	41.587	3	1589.7338	1589.7338	K	K	552	565
PSM	TVSEPNLKLR	1694	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=9412	32.538	2	1235.6275	1235.6275	K	Y	176	186
PSM	TVSEPNLKLR	1695	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:21	ms_run[2]:scan=9470	32.716	2	1235.6275	1235.6275	K	Y	176	186
PSM	TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK	1696	tr|Q5SQB0|Q5SQB0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	25-UNIMOD:21	ms_run[2]:scan=26463	85.001	3	3734.8842	3734.8842	R	M	46	81
PSM	VMSSSNPDLTGSHCAADEEVKNIMSSK	1697	sp|Q8C147-2|DOCK8-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=17304	55.309	3	2973.2555	2973.2555	R	I	535	562
PSM	VRGWSPPPEVRR	1698	tr|D6RHA7|D6RHA7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:21	ms_run[2]:scan=9210	31.916	3	1514.7507	1514.7507	R	S	26	38
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1699	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20389	64.256919	4	4270.8698	4270.8667	K	S	104	143
PSM	VGLFSSQKVSSPVLETVQQR	1700	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=18846	59.764088	3	2268.154490	2268.151513	K	T	1350	1370
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1701	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	19-UNIMOD:21	ms_run[1]:scan=15754	51.145177	4	3320.589865	3318.581639	R	S	2386	2416
PSM	SETAPAAPAAPAPAEKTPVK	1702	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10606	36.08419	3	2025.9842	2024.9812	M	K	2	22
PSM	SETAPAAPAAPAPAEKTPVKK	1703	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=7673	27.750155	3	2153.0771	2153.0764	M	K	2	23
PSM	RKTSGPPVSELITK	1704	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=8184	29.206136	3	1591.833841	1591.833473	K	A	33	47
PSM	HQGVMVGMGQKDSYVGDEAQSKR	1705	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:35	ms_run[1]:scan=4343	18.059564	4	2522.163702	2522.164206	R	G	40	63
PSM	CDVDIRKDLYANTVLSGGTTMYPGIADR	1706	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=24495	77.919261	3	3083.4692	3083.4687	K	M	285	313
PSM	RIDISPSTFR	1707	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=13829	45.776105	3	1270.606986	1270.607102	R	K	675	685
PSM	IDISPSTFR	1708	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=17573	56.085596	2	1114.506637	1114.505991	R	K	676	685
PSM	IDISPSTFR	1709	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=17765	56.594187	2	1114.506637	1114.505991	R	K	676	685
PSM	IDISPSTFR	1710	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=17641	56.254443	2	1114.506637	1114.505991	R	K	676	685
PSM	IDISPSTFR	1711	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=17830	56.766494	2	1114.506637	1114.505991	R	K	676	685
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISR	1712	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21096	66.496143	4	4269.866215	4269.866056	R	D	245	280
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1713	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20686	65.147987	4	3913.649089	3913.648853	R	I	245	277
PSM	SLSPLSGTTDTKAESPAGRVSDESVLPLAQK	1714	sp|Q9JIX8|ACINU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:21	ms_run[1]:scan=18131	57.585666	3	3220.587899	3220.586433	R	S	477	508
PSM	KISVVSATKGVQAGNSDTEGGQPGR	1715	sp|Q9JIX8|ACINU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=8524	30.20709	3	2524.219074	2522.212610	R	K	823	848
PSM	SASPDDDLGSSNWEAADLGNEER	1716	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:21	ms_run[1]:scan=20565	64.813278	3	2513.982361	2513.982001	R	K	15	38
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1717	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	24-UNIMOD:21	ms_run[1]:scan=23126	73.147369	4	3492.543806	3491.560570	R	T	545	573
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1718	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	24-UNIMOD:21	ms_run[1]:scan=23023	72.811027	4	3492.548362	3491.560570	R	T	545	573
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1719	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=17472	55.785342	3	3007.438353	3005.423056	K	S	157	186
PSM	NSSPAVPAPTPEGVQAVNTTK	1720	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=13684	45.355872	3	2144.014743	2144.015079	R	K	851	872
PSM	LKELFDYSPPLHK	1721	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=16563	53.26293	4	1665.816394	1665.816761	K	S	503	516
PSM	RADALTSSPGRDLPPFEDESEGLLGTEGPMEEEEDGEELIGDGMER	1722	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=26523	85.203372	4	5041.1683	5041.1637	R	D	34	80
PSM	LRELAGNSSTPPPVSPGRGNPMHR	1723	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=8534	30.235863	4	2606.255591	2606.253704	R	L	367	391
PSM	APKEELASDLEEMATSSAK	1724	sp|Q9D6Z1|NOP56_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=21055	66.346719	3	2086.918910	2085.917733	K	R	506	525
PSM	NSSPSPVPGSQNVPAPAVK	1725	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:21	ms_run[1]:scan=11574	38.82101	3	1911.909851	1911.909158	R	K	130	149
PSM	RCPNLAVKEADDDEEADDDVSEMPSPK	1726	sp|P13864|DNMT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,25-UNIMOD:21	ms_run[1]:scan=12360	41.134579	4	3111.268280	3111.268606	R	K	693	720
PSM	SGEDEQQEQTIAEDLVVTKYK	1727	sp|P50580|PA2G4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=23367	73.755478	3	2569.0792	2569.0869	M	M	2	23
PSM	AADVSVTHRPPLSPEAEAEAETPETVDR	1728	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=17569	56.076665	3	3095.4095	3095.4079	M	R	2	30
PSM	HLQLAIRNDEELNKLLGK	1729	sp|Q64523|H2A2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16325	52.627459	4	2103.180394	2103.180037	R	V	83	101
PSM	TRSEPLPPSATASPLLAPLQPR	1730	sp|Q8C2B3|HDAC7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=20274	63.91768	3	2378.236412	2378.235912	R	Q	342	364
PSM	LMHPIEPGDKRPTTSSSFTGFQPPPLAR	1731	sp|Q8C2K1|DEFI6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=16409	52.83932	4	3143.526894	3143.526356	R	R	550	578
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	1732	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:35	ms_run[1]:scan=21853	68.593591	3	3466.459639	3466.459047	R	-	226	256
PSM	AAAVLSGASAGSPAGAPGGPGGLSAVGSGPR	1733	sp|Q9DBD5|PELP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=24000	76.045241	3	2625.2554	2625.2543	M	L	2	33
PSM	AAAAAAAAAAGDSDSWDADTFSMEDPVRK	1734	sp|Q3UGC7|EI3JA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=26067	83.722271	3	2991.2472	2989.2432	M	V	2	31
PSM	FGSSPQRDPNWIGDR	1735	sp|Q8K3W3|CASC3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=13140	43.282273	3	1810.779885	1810.778812	R	S	260	275
PSM	KHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTIDLK	1736	sp|Q99K48|NONO_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=8123	29.018847	6	5223.5162	5223.5342	R	N	18	63
PSM	RPHTPTPGIYMGRPTYGSSR	1737	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=8415	29.908148	4	2310.074896	2310.072886	K	R	198	218
PSM	ALIQTCLNSPDSPPRSDPTTDQR	1738	sp|Q9JM73|SRF_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4,12-UNIMOD:21	ms_run[1]:scan=13971	46.144209	3	2649.194311	2648.190160	K	M	209	232
PSM	ATSAHLEEMEEGNSLDSSTQQVVGSGGQR	1739	sp|P81069|GABP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	17-UNIMOD:21	ms_run[1]:scan=14635	48.065339	3	3083.323834	3083.313917	K	V	205	234
PSM	RLDEEEEDNEGGEWER	1740	sp|Q8R1B4|EIF3C_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8709	30.736085	3	1991.814988	1990.814057	K	V	286	302
PSM	ATWGDGGDNSPSNVVSKQPSR	1741	sp|O09044|SNP23_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:21	ms_run[1]:scan=10262	35.209985	3	2237.971825	2237.970254	K	I	101	122
PSM	KGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIR	1742	sp|Q9CW03|SMC3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	25-UNIMOD:21	ms_run[1]:scan=16272	52.487973	4	4191.812641	4191.810192	K	V	1059	1100
PSM	KAAVVASPLLDQQR	1743	sp|E9Q784|ZC3HD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:21	ms_run[1]:scan=10523	35.886701	3	1575.821038	1574.818158	R	N	236	250
PSM	KQSVFGASSLPAGVGVPEQLDR	1744	sp|P70227|ITPR3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=20306	64.003144	3	2321.142015	2321.141677	R	S	932	954
PSM	PGETEEPRSPEQQDQEGGPAAAADAASEELRPGAAAAPAAPAETASSR	1745	sp|Q62511|ZFP91_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	9-UNIMOD:21	ms_run[1]:scan=16545	53.211497	4	4778.1346	4778.1324	M	V	2	50
PSM	YGGSVGSRSSPPATDPGPVPSSPSQEPPTKR	1746	sp|Q922Y1|UBXN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=8779	30.892571	4	3158.468516	3158.466987	K	E	179	210
PSM	FMVTPTKIDDIPGLSDTSPDLSSR	1747	sp|Q924N4|S12A6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=23171	73.284379	3	2671.246643	2671.245215	R	S	15	39
PSM	RYSDGWCEGVSSEGTGFFPGNYVEPSC	1748	sp|Q8BYZ1|ABI3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21,7-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=26279	84.406754	3	3123.205553	3123.205218	R	-	341	368
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1749	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	14-UNIMOD:21	ms_run[1]:scan=21759	68.284317	3	2686.107182	2685.104090	K	M	106	130
PSM	NKQEDLNSEALSPSITCDLSSR	1750	sp|Q7TT18|MCAF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=17113	54.747788	3	2545.131009	2543.121078	K	V	101	123
PSM	MEVAEANSPTEEEEEEEEEGEETISEPRPHTR	1751	sp|Q3UI43|BABA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=19143	60.697649	3	3822.5442	3820.5412	-	S	1	33
PSM	NLGSINTELQDVQR	1752	sp|O08547|SC22B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=19436	61.559529	2	1666.7922	1665.7722	R	I	134	148
PSM	YAHQQPPSPLPVYSSSAK	1753	sp|Q8VI36|PAXI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=10724	36.39144	3	2035.940449	2035.940458	R	N	76	94
PSM	LTQYHGGSLPNVSQLR	1754	sp|Q91X84|CRTC3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=15290	49.980998	3	1850.895501	1848.888362	R	N	55	71
PSM	KTPEGRASPALGSGHHDGSGDSLEMSSLDR	1755	sp|Q9CZW5|TOM70_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=8701	30.712681	4	3130.375565	3130.377520	R	A	87	117
PSM	RKGAILSEEELAAMSPTAAAVAK	1756	sp|F6ZDS4|TPR_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	15-UNIMOD:21	ms_run[1]:scan=15879	51.46947	3	2394.211348	2393.202563	K	I	439	462
PSM	RGSKGHMNYEGPGMAR	1757	sp|P83741|WNK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=3313	14.535463	4	1826.770609	1826.770572	R	K	2263	2279
PSM	GHREEEQEDLTKDMDEPSPVPNVEEVTLPK	1758	sp|Q6PDG5|SMRC2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:21	ms_run[1]:scan=17597	56.148981	4	3528.590255	3526.581090	R	T	330	360
PSM	RPYSPEKAFSSNQVVR	1759	sp|Q8BZR9|NCBP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:21	ms_run[1]:scan=10195	35.054988	3	1945.933029	1943.925476	K	R	492	508
PSM	STSPAPADVAPAQEDLRTFSWASVTSK	1760	sp|P97855|G3BP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=22644	71.480825	3	2899.346153	2898.343684	K	N	229	256
PSM	SDNDDIEVESDEEQPRFQSAADKR	1761	sp|P28574|MAX_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1,1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=15206	49.757854	3	2982.1592	2981.1592	M	A	2	26
PSM	SRSPLGFYVHLK	1762	sp|Q66JV4|R12BB_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=14462	47.607165	3	1482.736607	1482.738451	R	N	277	289
PSM	KLLDEALSPSSKK	1763	sp|Q8K327|CHAP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:21	ms_run[1]:scan=7008	25.924666	3	1494.770508	1494.769476	K	L	596	609
PSM	RPHTPTPGIYMGRPTYGSSR	1764	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21	ms_run[1]:scan=8348	29.714464	4	2310.074896	2310.072886	K	R	198	218
PSM	KFSLKEFGETTSEQTEVAAR	1765	sp|Q8K4L3|SVIL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=15890	51.500408	3	2338.072528	2337.088973	R	K	1009	1029
PSM	GVDFESDEDDDDDPFMSSSCPRR	1766	sp|Q61216|MRE11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=19042	60.392324	3	2759.985435	2756.984386	K	N	681	704
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1767	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:21	ms_run[1]:scan=21697	68.095994	3	2685.105014	2685.104090	K	M	106	130
PSM	AQVDDPPEPVYANVERQPR	1768	sp|A2AB59-2|RHG27-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	11-UNIMOD:21	ms_run[2]:scan=11346	38.174	3	2259.0321	2259.0321	R	A	18	37
PSM	ASGQAFELILSPR	1769	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	11-UNIMOD:21	ms_run[2]:scan=22367	70.414	3	1467.7123	1467.7123	R	S	15	28
PSM	ASGSPPLLPAPDPVSLESEPIAEDGALGPPEPIQGTAQPVKR	1770	sp|Q8VBT9-3|ASPC1-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	2-UNIMOD:21	ms_run[2]:scan=24637	78.492	4	4264.1304	4264.1304	R	S	395	437
PSM	ATAQPIIEILDEQPSPSPR	1771	sp|Q8BVK9|SP110_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	15-UNIMOD:21	ms_run[2]:scan=23852	75.485	3	2141.0406	2141.0406	R	A	161	180
PSM	CDVDIRKDLYANTVLSGGTTMYPGIADR	1772	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	1-UNIMOD:4	ms_run[2]:scan=21256	66.947	4	3100.4958	3100.4958	K	M	285	313
PSM	CSGPGLSPGMVR	1773	tr|B7FAV1|B7FAV1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	1-UNIMOD:4,7-UNIMOD:21	ms_run[2]:scan=12864	42.498	2	1296.5356	1296.5356	K	A	1429	1441
PSM	DGQVINETSQHHDDLE	1774	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=6995	25.897	2	1835.7922	1835.7922	R	-	451	467
PSM	DGQVINETSQHHDDLE	1775	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=7067	26.091	2	1835.7922	1835.7922	R	-	451	467
PSM	DKFSPTQDRPESSTVLK	1776	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=9188	31.858	3	2013.9409	2013.9409	R	V	1148	1165
PSM	DKFSPTQDRPESSTVLK	1777	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=9252	32.028	3	2013.9409	2013.9409	R	V	1148	1165
PSM	DKSPVREPIDNLTPEER	1778	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=10817	36.658	3	2073.9732	2073.9732	K	D	134	151
PSM	DLVHSNKKEQEFR	1779	tr|Q8BZN7|Q8BZN7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=2831	12.73	4	1628.8271	1628.8271	R	S	593	606
PSM	GLSEDTTEETLKESFEGSVR	1780	sp|P09405|NUCL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=18507	58.669	3	2213.0336	2213.0336	K	A	575	595
PSM	GRLSPVPVPR	1781	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=8406	29.888	2	1156.6118	1156.6118	R	A	116	126
PSM	HIAEEADRKYEEVAR	1782	tr|E9Q7Q3|E9Q7Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=4700	19.199	3	1814.8911	1814.8911	K	K	117	132
PSM	HLYTKDIDIHEVR	1783	sp|Q8VEK3|HNRPU_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=6868	25.568	4	1637.8526	1637.8526	R	I	324	337
PSM	HQGVMVGMGQKDSYVGDEAQSK	1784	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=7899	28.361	3	2350.0682	2350.0682	R	R	40	62
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVK	1785	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	12-UNIMOD:21	ms_run[2]:scan=10471	35.746	4	2758.3916	2758.3916	R	K	123	149
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVK	1786	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	12-UNIMOD:21	ms_run[2]:scan=10480	35.77	4	2758.3916	2758.3916	R	K	123	149
PSM	IDISPSALRK	1787	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=11824	39.637	3	1178.606	1178.6060	R	H	366	376
PSM	IDISPSTFRK	1788	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=12910	42.63	3	1242.601	1242.6010	R	H	676	686
PSM	IGLPHSIKLSR	1789	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	6-UNIMOD:21	ms_run[2]:scan=12494	41.464	3	1299.7064	1299.7064	K	R	112	123
PSM	ISDPLTSSPGRSSR	1790	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	6-UNIMOD:21	ms_run[2]:scan=8259	29.442	3	1538.709	1538.7090	R	R	20	34
PSM	ITNYLTVPAHKLDSPTLSR	1791	sp|Q61165|SL9A1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	14-UNIMOD:21	ms_run[2]:scan=15272	49.933	3	2205.1195	2205.1195	K	A	684	703
PSM	KITISDCGQL	1792	tr|A0A1L1SST0|A0A1L1SST0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	7-UNIMOD:4	ms_run[2]:scan=10815	36.65	2	1133.5751	1133.5751	K	-	147	157
PSM	LLLLERSSPVRDR	1793	sp|Q0VBL3-2|RBM15-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	7-UNIMOD:21	ms_run[2]:scan=10720	36.383	3	1632.8713	1632.8713	R	R	694	707
PSM	LSQSSYQDSESLSPPRKVPR	1794	sp|Q61033|LAP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	11-UNIMOD:21	ms_run[2]:scan=9731	33.588	3	2340.1111	2340.1111	R	L	410	430
PSM	LSQSSYQDSESLSPPRKVPR	1795	sp|Q61033|LAP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	13-UNIMOD:21	ms_run[2]:scan=9778	33.758	3	2340.1111	2340.1111	R	L	410	430
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIR	1796	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=16261	52.457	4	4149.8409	4149.8409	R	A	373	410
PSM	NRGLKEGINPGYDDYADSDEDQHDAYLER	1797	tr|A2AW05|A2AW05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	18-UNIMOD:21	ms_run[2]:scan=13549	44.813	4	3434.4325	3434.4325	K	M	427	456
PSM	NRTPSDVKELVLDNCK	1798	sp|O35381|AN32A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11887	39.847	3	1966.9183	1966.9183	R	S	13	29
PSM	NSSPAVPAPTPEGVQAVNTTKK	1799	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=10819	36.663	3	2272.11	2272.1100	R	A	851	873
PSM	NSSPAVPAPTPEGVQAVNTTKK	1800	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=10993	37.171	3	2272.11	2272.1100	R	A	851	873
PSM	NSSPSPVPGSQNVPAPAVK	1801	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	5-UNIMOD:21	ms_run[2]:scan=11475	38.537	2	1911.9092	1911.9092	R	K	130	149
PSM	NSSPSPVPGSQNVPAPAVK	1802	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	2-UNIMOD:21	ms_run[2]:scan=11498	38.604	3	1911.9092	1911.9092	R	K	130	149
PSM	PGPTPSGTNVGSSGRSPSKAVAAR	1803	sp|Q9CQS8|SC61B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	12-UNIMOD:21	ms_run[2]:scan=4958	19.925	3	2317.1176	2317.1176	M	A	2	26
PSM	QKFHDSEGDDTEETEDYRQFR	1804	tr|A0A087WRN1|A0A087WRN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	6-UNIMOD:21	ms_run[2]:scan=9232	31.965	4	2711.0773	2711.0773	K	K	103	124
PSM	RASGQAFELILSPR	1805	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	12-UNIMOD:21	ms_run[2]:scan=18648	59.12	3	1623.8134	1623.8134	K	S	14	28
PSM	RASVCAEAYNPDEEEDDAESRIIHPK	1806	sp|P31324|KAP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=13688	45.365	4	3080.3183	3080.3183	R	T	110	136
PSM	RDSDICLNAP	1807	tr|S4R2F6|S4R2F6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=12564	41.649	2	1239.4955	1239.4955	R	-	84	94
PSM	RKSFDASDTLALPR	1808	sp|A2A7Y5|MIIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=12026	40.289	3	1655.8032	1655.8032	R	H	305	319
PSM	RVPSPTPVPKEAIR	1809	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	4-UNIMOD:21	ms_run[2]:scan=6840	25.505	3	1625.8654	1625.8654	K	E	2532	2546
PSM	SFSPGDFRTDKNIVHQTK	1810	tr|H3BJH7|H3BJH7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=11100	37.452	4	2156.0052	2156.0052	R	Q	149	167
PSM	SGVSITIDDPVRTAQVPSPPRGK	1811	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	18-UNIMOD:21	ms_run[2]:scan=15152	49.604	3	2456.2425	2456.2425	K	I	920	943
PSM	SLSPSHLTEDRQGR	1812	sp|E9Q784|ZC3HD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=5331	20.871	3	1661.7523	1661.7523	R	W	951	965
PSM	STELLIR	1813	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=8448	29.998	2	830.48617	830.4862	K	K	58	65
PSM	STELLIR	1814	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=8507	30.167	2	830.48617	830.4862	K	K	58	65
PSM	STITSREIQTAVR	1815	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=7247	26.589	3	1460.7947	1460.7947	R	L	88	101
PSM	TVTAMDVVYALKR	1816	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0		ms_run[2]:scan=18888	59.913	3	1465.7963	1465.7963	K	Q	81	94
PSM	VGQQAIVLCISPSKPNPVFK	1817	tr|D3YV66|D3YV66_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=19816	62.572	3	2261.1643	2261.1643	R	V	138	158
PSM	YLSFTPPEKDGFPSGTPALNTK	1818	sp|Q8CIN4|PAK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=21100	66.505	3	2446.1458	2446.1458	K	G	139	161
PSM	YRSPYSGPKFNSAIR	1819	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	15.0	3-UNIMOD:21	ms_run[2]:scan=9661	33.321	3	1821.8563	1821.8563	R	G	95	110
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1820	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:4,35-UNIMOD:35,36-UNIMOD:21	ms_run[1]:scan=17008	54.415284	4	4303.890406	4303.888642	K	S	104	143
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1821	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=20354	64.145609	4	4270.8698	4270.8667	K	S	104	143
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	1822	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	21-UNIMOD:21	ms_run[1]:scan=19636	62.094641	3	3090.407672	3090.400547	K	S	1028	1055
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1823	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:35,19-UNIMOD:21	ms_run[1]:scan=15336	50.098035	4	3334.577794	3334.576554	R	S	2386	2416
PSM	SETAPAAPAAPAPAEKTPVKK	1824	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=7798	28.098899	3	2153.0771	2153.0764	M	K	2	23
PSM	SETAPAAPAAPAPAEKTPVK	1825	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=10565	35.982501	2	2025.9852	2024.9812	M	K	2	22
PSM	KTSGPPVSELITK	1826	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=11485	38.565474	2	1435.732871	1435.732362	R	A	34	47
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1827	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=22004	69.123719	4	3914.635345	3913.648853	R	I	245	277
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	1828	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=20449	64.459237	4	3913.649089	3913.648853	R	I	245	277
PSM	HAVSEGTKAVTKYTSSK	1829	sp|P10853|H2B1F_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=2460	11.24639	3	1792.931810	1792.931927	K	-	110	127
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1830	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	24-UNIMOD:21	ms_run[1]:scan=22853	72.196594	4	3492.550077	3491.560570	R	T	545	573
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	1831	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=8680	30.661492	4	3401.445292	3400.459335	R	G	575	609
PSM	KGSFNPGDASGPEAAGSPPEEGGTSEAAPNKDHR	1832	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=7671	27.744597	4	3400.460301	3400.459335	R	G	575	609
PSM	RKLSGDLEAGAPK	1833	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=4301	17.929992	3	1420.707611	1420.707544	K	N	1188	1201
PSM	RRISDPLTSSPGR	1834	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=6018	23.062846	3	1520.747081	1520.746055	R	S	18	31
PSM	AETLSGLGDASAAGAAAVSSAASETGTRR	1835	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=23228	73.415561	3	2756.2636	2756.2609	M	L	2	31
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	1836	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=21902	68.751356	4	3060.465200	3059.461764	R	L	162	189
PSM	QPSIELPSMAVASTK	1837	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=20791	65.495149	2	1637.774716	1637.773575	R	T	241	256
PSM	QPSIELPSMAVASTK	1838	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=20958	66.032998	2	1637.774716	1637.773575	R	T	241	256
PSM	QPSIELPSMAVASTK	1839	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=25427	81.443889	2	1620.7467	1620.7465	R	T	241	256
PSM	QKHSQAVEELADQLEQTKR	1840	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=11506	38.627487	4	2237.140819	2237.140023	R	V	1192	1211
PSM	EMEAELEDERKQR	1841	sp|Q8VDD5|MYH9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=4462	18.404167	4	1661.767775	1661.767899	R	S	1593	1606
PSM	VSEPVEIGIQVTPDEDDHLLSPTKGICPK	1842	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	23-UNIMOD:21,27-UNIMOD:4	ms_run[1]:scan=21383	67.24348	3	3252.564171	3252.562527	R	Q	108	137
PSM	GLKEGINPGYDDYADSDEDQHDAYLER	1843	sp|Q08943|SSRP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21	ms_run[1]:scan=15321	50.063344	3	3165.295113	3164.288413	R	M	429	456
PSM	ASGVAVSDGVIKVFNDMKVR	1844	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=25990	83.47675	3	2213.0911	2213.0910	M	K	2	22
PSM	ASGVAVSDGVIKVFNDMKVR	1845	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=26485	85.077527	3	2213.0915	2213.0910	M	K	2	22
PSM	SGVAVSDGVIKVFNDMKVR	1846	sp|P18760|COF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=25517	81.762512	3	2142.0540	2142.0539	A	K	3	22
PSM	APKEELASDLEEMATSSAKR	1847	sp|Q9D6Z1|NOP56_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=18955	60.120632	3	2243.023213	2242.018844	K	K	506	526
PSM	RAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGR	1848	tr|A0A0N4SVC2|A0A0N4SVC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=3736	16.032217	4	3140.385482	3140.385674	K	R	197	233
PSM	EVDQDDEENSEEDEMDSGTMVR	1849	sp|Q9JI11|STK4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=14499	47.69831	3	2637.921713	2637.920782	R	A	311	333
PSM	LYKEELEQTYHAKLENAR	1850	sp|P14733|LMNB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=10085	34.790054	4	2234.133190	2234.133147	R	L	260	278
PSM	RHSVNLDEGESAQAVHK	1851	sp|E9PVX6|KI67_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=3988	16.913913	4	1955.886126	1955.885068	R	T	335	352
PSM	TQPDGTSVPGEPASPISQRLPPKVESLESLYFTPTPAR	1852	sp|E9Q7G0|NUMA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	17-UNIMOD:21	ms_run[1]:scan=23395	73.836465	4	4130.048484	4129.040907	R	G	1726	1764
PSM	LREQGTESRSSTPLPTVSSSAENTR	1853	sp|Q61033|LAP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=8841	31.032535	4	2849.260190	2849.259376	K	Q	148	173
PSM	HKMSPPPSSFNEPR	1854	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=6193	23.705557	3	1689.733755	1689.733442	R	S	623	637
PSM	HLQLAIRNDEELNKLLGK	1855	sp|Q64523|H2A2C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=16517	53.134752	4	2103.180394	2103.180037	R	V	83	101
PSM	SDAAVDTSSEITTKDLK	1856	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=14654	48.118285	2	1901.8522	1901.8502	M	E	2	19
PSM	SGDEMIFDPTMSK	1857	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=23976	75.945166	2	1594.5916	1594.5927	M	K	2	15
PSM	KTSDANETEDHLESLICK	1858	sp|Q3UYV9|NCBP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=15878	51.46796	3	2168.930067	2168.929695	R	V	20	38
PSM	TDSREDEISPPPPNPVVK	1859	sp|Q9DBC7|KAP0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=11273	37.960991	3	2055.952039	2055.951416	R	G	75	93
PSM	MEIQSGPQPGSPGRAERLNAR	1860	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=10068	34.750219	3	2388.1008	2388.1000	-	L	1	22
PSM	QKYLSFTPPEKDGFPSGTPALNTK	1861	sp|Q8CIN4|PAK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	7-UNIMOD:21	ms_run[1]:scan=18526	58.72443	3	2704.307343	2702.299300	K	G	137	161
PSM	SDFDEFER	1862	sp|P26369|U2AF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=22210	69.822218	2	1165.3966	1165.3960	M	Q	2	10
PSM	TFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIK	1863	sp|Q9CSU0|RPR1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=27583	88.396615	3	3918.727133	3918.724837	R	A	149	183
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	1864	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=21967	68.985465	4	4196.889433	4195.899841	R	D	224	260
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	1865	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=22997	72.713959	4	4195.902842	4195.899841	R	D	224	260
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	1866	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=22129	69.514975	4	4195.900577	4195.899841	R	D	224	260
PSM	TFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIK	1867	sp|Q9CSU0|RPR1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	18-UNIMOD:21	ms_run[1]:scan=27725	88.70212	4	3918.726967	3918.724837	R	A	149	183
PSM	SLAALDALNTDDENDEEEYEAWKVR	1868	sp|C0HKD8|MFA1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	10-UNIMOD:21	ms_run[1]:scan=23583	74.516471	3	2975.254212	2975.270972	R	E	258	283
PSM	HLSSTSDDEPLSSVNHAAK	1869	sp|Q9DBC3|CMTR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=7126	26.254802	3	2073.900379	2073.900443	R	A	25	44
PSM	LKQLSVPASDEEDEVPAPIPR	1870	sp|Q6P542|ABCF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=17293	55.271289	3	2371.142177	2369.151573	R	G	99	120
PSM	RDSFDDRGPSLNPVLDYDHGSR	1871	sp|Q8K310|MATR3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=14826	48.616098	4	2597.130708	2597.129609	R	S	186	208
PSM	KKEVVEEEENGAEEEEEETAEDGEDDDEGDEEDEEEEEEDEGPVR	1872	sp|Q9D0J8|PTMS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0		ms_run[1]:scan=13874	45.886686	4	5182.9652	5182.9782	R	K	34	79
PSM	RPHTPTPGIYMGRPTYGSSR	1873	sp|P62996|TRA2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=8406	29.887684	4	2310.074896	2310.072886	K	R	198	218
PSM	RGRASFPDQAYANSQPAPS	1874	sp|Q8C503|SIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=9913	34.229588	3	2098.917635	2098.922182	R	-	162	181
PSM	GRLSPVPVPR	1875	sp|Q64012|RALY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=8390	29.838484	2	1156.612679	1156.611793	R	A	132	142
PSM	GRLSPVPVPR	1876	sp|Q64012|RALY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21	ms_run[1]:scan=8415	29.908148	2	1156.612679	1156.611793	R	A	132	142
PSM	QISPVKFNDADSVLPHKK	1877	sp|Q8BJ37|TYDP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=12325	41.046263	3	2104.064435	2102.056156	R	Q	59	77
PSM	QISPVKFNDADSVLPHKK	1878	sp|Q8BJ37|TYDP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=12245	40.856392	4	2102.056978	2102.056156	R	Q	59	77
PSM	AACEQLHQQQQQQQEETTAATLLLQGEEEGEED	1879	sp|P42669|PURA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:4	ms_run[1]:scan=21732	68.209737	3	3770.656652	3768.665685	R	-	289	322
PSM	SPGSNSKVPEIEVTVEGPNNSSPQTSAVR	1880	sp|Q9ESZ8|GTF2I_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	1-UNIMOD:21	ms_run[1]:scan=15937	51.612874	3	3047.430036	3046.424453	R	T	674	703
PSM	NLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALR	1881	sp|Q60787|LCP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=27186	87.370524	4	4736.283570	4736.279968	R	K	397	438
PSM	STRSVENLPECGITHEQR	1882	sp|Q8BKC8|PI4KB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	4-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=8498	30.134709	3	2191.969281	2191.968146	R	A	425	443
PSM	KQQHVISTEEGDMMETNSTDDEKSAAK	1883	sp|Q8BIH0|SP130_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	16-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=8492	30.117964	4	3168.269284	3168.266571	R	S	847	874
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1884	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	14-UNIMOD:21	ms_run[1]:scan=21865	68.626674	3	2686.107012	2685.104090	K	M	106	130
PSM	TLSVAAAFNEDEDSEPEEMPPEAK	1885	sp|Q6P8I4|PCNP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=22043	69.241476	3	2687.109855	2685.104090	K	M	106	130
PSM	KGDRSPEPGQTWTHEVFSSR	1886	tr|E9Q616|E9Q616_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=11712	39.241141	4	2380.061511	2380.059738	R	S	90	110
PSM	GVGDLRESKVNGDDHHEEDMDMSD	1887	tr|E9Q6E5|E9Q6E5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	23-UNIMOD:21	ms_run[1]:scan=10561	35.973899	4	2767.038493	2766.053468	K	-	488	512
PSM	LVDSLSQRSPKPSLR	1888	sp|Q80UG5|SEPT9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=7911	28.40267	3	1761.914851	1761.913849	R	R	77	92
PSM	MQEMNLLPTPESPVTRQEK	1889	sp|O88685|PRS6A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	15.0	1-UNIMOD:1,12-UNIMOD:21	ms_run[1]:scan=23412	73.887412	3	2349.0744	2349.0741	-	M	1	20
PSM	QADVADQQTTELPAENGETENQSPASEEEKEAKSD	1890	sp|P18608|HMGN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	26-UNIMOD:21	ms_run[1]:scan=13031	42.978033	3	3855.601063	3854.612720	K	-	62	97
PSM	IMEETSGIEEEEEEENTTAVHGR	1891	sp|Q91YE5|BAZ2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	6-UNIMOD:21	ms_run[1]:scan=14031	46.307152	3	2698.093953	2698.095316	R	R	1037	1060
PSM	DNLTLWTSDQQDDDGGEGNN	1892	sp|P61982|1433G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0		ms_run[1]:scan=21028	66.258897	2	2192.875371	2192.873028	R	-	228	248
PSM	KTPEGRASPALGSGHHDGSGDSLEMSSLDR	1893	sp|Q9CZW5|TOM70_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	8-UNIMOD:21	ms_run[1]:scan=8780	30.89408	4	3130.375565	3130.377520	R	A	87	117
PSM	RGSKGHMNYEGPGMAR	1894	sp|P83741|WNK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=3324	14.575098	4	1826.770609	1826.770572	R	K	2263	2279
PSM	RPMDSLDARLSPPAGLFTSAR	1895	sp|P42230|STA5A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	5-UNIMOD:21	ms_run[1]:scan=20259	63.872007	4	2337.131272	2337.130066	R	S	769	790
PSM	VLSPQKPTITLSAYQR	1896	sp|Q8CEC0|NUP88_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=15640	50.872834	3	1880.977395	1880.976115	K	K	708	724
PSM	SNSISKSPGPSSPKEPLLLSR	1897	sp|O54785|LIMK2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	3-UNIMOD:21	ms_run[1]:scan=11449	38.468315	3	2260.145672	2260.146428	R	D	287	308
PSM	GAKEEHGGLIRSPR	1898	sp|P26369|U2AF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	12-UNIMOD:21	ms_run[1]:scan=2100	9.7154739	4	1585.772554	1585.772604	R	H	68	82
PSM	RYPSSISSSPQKDLTQAK	1899	sp|Q80X50|UBP2L_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	15.0	9-UNIMOD:21	ms_run[1]:scan=8986	31.381112	3	2071.993682	2071.993950	R	N	621	639
PSM	ATAPQTQHVSPMRQVEPPTKK	1900	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	10-UNIMOD:21	ms_run[2]:scan=5802	22.298	4	2410.1828	2410.1828	R	G	124	145
PSM	AVFPSIVGRPR	1901	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=11227	37.827	3	1197.6982	1197.6982	R	H	29	40
PSM	CDKEVYFAER	1902	sp|P63254|CRIP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	1-UNIMOD:4	ms_run[2]:scan=6187	23.686	3	1315.5867	1315.5867	K	V	7	17
PSM	DNIQGITKPAIRR	1903	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=5707	22.007	3	1480.8474	1480.8474	R	L	25	38
PSM	DNIQGITKPAIRR	1904	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=5764	22.178	3	1480.8474	1480.8474	R	L	25	38
PSM	DNLTLWTSDQQDEEAGEGN	1905	sp|P68510|1433F_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=21253	66.939	2	2120.8771	2120.8771	R	-	228	247
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1906	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=21790	68.401	3	2407.9888	2407.9888	R	-	223	246
PSM	DNLTLWTSDTQGDEAEAGEGGEN	1907	sp|P63101|1433Z_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=21900	68.746	3	2407.9888	2407.9888	R	-	223	246
PSM	DQKKTQEQLASEMAELTAR	1908	sp|P26041|MOES_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=16734	53.73	4	2176.0794	2176.0794	R	I	409	428
PSM	EAQVNVRMDSFDEDLARPSGLLAQER	1909	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	10-UNIMOD:21	ms_run[2]:scan=21581	67.763	4	3025.3965	3025.3965	R	K	563	589
PSM	EGITPWASFKK	1910	sp|Q9WTQ5-2|AKA12-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	8-UNIMOD:21	ms_run[2]:scan=16162	52.202	2	1342.6323	1342.6323	R	M	486	497
PSM	EKSPELPEPSVR	1911	tr|A2A8V8|A2A8V8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=8786	30.908	3	1446.6756	1446.6756	K	M	218	230
PSM	ERASSPPDRIDIFGR	1912	sp|Q3UL36-2|ARGL1-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	4-UNIMOD:21	ms_run[2]:scan=13992	46.206	3	1794.8414	1794.8414	R	T	53	68
PSM	ESYSVYVYK	1913	sp|Q8CGP2|H2B1P_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=11681	39.134	2	1136.539	1136.5390	K	V	36	45
PSM	GISPIVFDR	1914	tr|D6RG95|D6RG95_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=18988	60.212	2	1082.5162	1082.5162	R	S	319	328
PSM	GPPSPPAPVMHSPSR	1915	tr|A0A0B4J1E2|A0A0B4J1E2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	4-UNIMOD:21	ms_run[2]:scan=8790	30.918	3	1592.7171	1592.7171	R	K	221	236
PSM	GRHLSHPEPEQQHVIQR	1916	tr|F6RJ39|F6RJ39_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	5-UNIMOD:21	ms_run[2]:scan=3187	14.079	4	2127.0123	2127.0123	R	L	652	669
PSM	GRTWTLCGTPEYLAPEIILSK	1917	sp|P05132-2|KAPCA-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=25546	81.86	3	2484.2124	2484.2124	K	G	186	207
PSM	GSAEGTSDLEQEGLGEIEPTEIRGSTAR	1918	sp|A6H619-2|PHRF1-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	2-UNIMOD:21	ms_run[2]:scan=19809	62.554	3	2968.3299	2968.3299	K	T	754	782
PSM	HHRREELAPYPK	1919	tr|A2AER8|A2AER8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=1603	7.7068	4	1531.8008	1531.8008	R	N	176	188
PSM	HTSLNDLSLTRDEQEIEFLR	1920	sp|Q8BVL9|JKIP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=21795	68.414	3	2495.1693	2495.1693	R	L	380	400
PSM	IILDLISESPIKGR	1921	tr|H3BLP7|H3BLP7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	9-UNIMOD:21	ms_run[2]:scan=20786	65.485	3	1632.8852	1632.8852	K	A	5	19
PSM	ILSDVTHSAVFGVPASK	1922	tr|A0A571BDM4|A0A571BDM4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=21657	67.989	3	1806.8917	1806.8917	R	S	97	114
PSM	ISSFENFGSSQLPDRGVQR	1923	sp|O54824-2|IL16-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=16862	54.031	3	2203.0059	2203.0059	R	L	139	158
PSM	KCEPIAMTVPR	1924	tr|G3UYK8|G3UYK8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	2-UNIMOD:4	ms_run[2]:scan=7814	28.135	3	1300.6632	1300.6632	R	K	344	355
PSM	KESYSVYVYK	1925	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=7770	28.019	3	1264.634	1264.6340	R	V	35	45
PSM	KHHEDEIDHHSKEIER	1926	tr|E9PV44|E9PV44_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=1224	5.9686	4	2037.9617	2037.9617	R	L	40	56
PSM	KHPDASVNFSEFSK	1927	sp|P63158|HMGB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=8722	30.765	3	1591.7631	1591.7631	K	K	30	44
PSM	KIQVLQQQADDAEERAER	1928	tr|E9Q7Q3|E9Q7Q3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=8906	31.194	4	2126.0716	2126.0716	R	L	13	31
PSM	KSSLDLNSSEMAIMMGADAK	1929	tr|E9Q449|E9Q449_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	2-UNIMOD:21	ms_run[2]:scan=21734	68.217	3	2177.9408	2177.9408	K	I	1105	1125
PSM	LFDYRGRLSPVPVPR	1930	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	9-UNIMOD:21	ms_run[2]:scan=16473	53.021	4	1850.9557	1850.9557	R	A	111	126
PSM	LFDYRGRLSPVPVPR	1931	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	9-UNIMOD:21	ms_run[2]:scan=16476	53.028	4	1850.9557	1850.9557	R	A	111	126
PSM	LFMAQALQEYNN	1932	sp|Q91WK2|EIF3H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=22245	69.956	2	1440.6708	1440.6708	K	-	341	353
PSM	LGSYLIR	1933	sp|O35892|SP100_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=17324	55.369	2	900.44702	900.4470	R	N	336	343
PSM	LQQENNHQETYPLSVSPVENNHCLPSSPWQESTR	1934	tr|E9Q8J8|E9Q8J8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	16-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=18969	60.157	4	4084.8011	4084.8011	R	V	136	170
PSM	LSESQLSFRRSPTK	1935	sp|Q8C2Q3|RBM14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	7-UNIMOD:21	ms_run[2]:scan=7391	26.964	3	1714.8403	1714.8403	R	S	617	631
PSM	LSESQLSFRRSPTK	1936	sp|Q8C2Q3|RBM14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	7-UNIMOD:21	ms_run[2]:scan=7884	28.319	3	1714.8403	1714.8403	R	S	617	631
PSM	LVDSLSQRSPKPSLR	1937	tr|A2A6U3|A2A6U3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	6-UNIMOD:21	ms_run[2]:scan=7775	28.032	3	1761.9138	1761.9138	R	R	59	74
PSM	MVQASSQSLLPPAQDRPRSPVPSAFSDQSR	1938	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	19-UNIMOD:21	ms_run[2]:scan=15974	51.715	3	3318.5816	3318.5816	R	S	2386	2416
PSM	NKPLSPIKLTPTSVLDYFGTESVQR	1939	tr|A0A0N5E9G7|A0A0N5E9G7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	5-UNIMOD:21	ms_run[2]:scan=24978	79.761	3	2869.4627	2869.4627	K	S	151	176
PSM	NSSPAVPAPTPEGVQAVNTTK	1940	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	2-UNIMOD:21	ms_run[2]:scan=13637	45.187	3	2144.0151	2144.0151	R	K	851	872
PSM	NSSPSPVPGSQNVPAPAVKK	1941	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=9064	31.557	3	2040.0041	2040.0041	R	I	130	150
PSM	NSSPSPVPGSQNVPAPAVKK	1942	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=9204	31.902	3	2040.0041	2040.0041	R	I	130	150
PSM	QKSLDSDLSDGPVTVQEFMEVK	1943	tr|F6SLJ2|F6SLJ2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=24386	77.499	3	2531.1503	2531.1503	R	S	76	98
PSM	QLFHPEQLITGKEDAANNYAR	1944	sp|P68373|TBA1C_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=15119	49.52	4	2414.1979	2414.1979	R	G	85	106
PSM	QLSVPASDEEDEVPAPIPR	1945	tr|G3V012|G3V012_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	7-UNIMOD:21	ms_run[2]:scan=19137	60.683	2	2127.9725	2127.9725	K	G	6	25
PSM	RASGQAFELILSPR	1946	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=22120	69.489	3	1703.7797	1703.7797	K	S	14	28
PSM	RHSVNLDEGESAQAVHKTVTPGK	1947	sp|E9PVX6-2|KI67-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=5844	22.429	4	2539.218	2539.2180	R	L	335	358
PSM	RIDISPSTFR	1948	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	5-UNIMOD:21	ms_run[2]:scan=13722	45.473	2	1270.6071	1270.6071	R	K	675	685
PSM	RKASGPPVSELITK	1949	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=5364	20.971	3	1481.8566	1481.8566	K	A	34	48
PSM	RKGSVDQYLLR	1950	sp|E9Q7F2|RN169_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	4-UNIMOD:21	ms_run[2]:scan=8226	29.347	3	1413.713	1413.7130	R	S	676	687
PSM	RKSFDASDTLALPR	1951	sp|A2A7Y5|MIIP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=11956	40.08	3	1655.8032	1655.8032	R	H	305	319
PSM	RLASNSPVLPQAFAR	1952	tr|A0A0G2JGN6|A0A0G2JGN6_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	6-UNIMOD:21	ms_run[2]:scan=14432	47.522	3	1705.8665	1705.8665	R	V	77	92
PSM	RRHSGQDVHVVLK	1953	sp|Q9CZ44-2|NSF1C-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	4-UNIMOD:21	ms_run[2]:scan=1770	8.3979	4	1609.8202	1609.8202	R	L	175	188
PSM	RVPSPTPVPK	1954	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	4-UNIMOD:21	ms_run[2]:scan=4136	17.392	2	1156.6006	1156.6006	K	E	2532	2542
PSM	SHSLPNSLDYAQASERGR	1955	tr|A3KGH5|A3KGH5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=10310	35.321	3	2066.9171	2066.9171	R	Q	44	62
PSM	SLSPGGAALGYRDYR	1956	sp|Q0VBL3-2|RBM15-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=13645	45.214	3	1661.7563	1661.7563	R	L	291	306
PSM	SLSPGGAALGYRDYR	1957	sp|Q0VBL3-2|RBM15-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=13694	45.386	3	1661.7563	1661.7563	R	L	291	306
PSM	SLSPSHLTEDRQGR	1958	sp|E9Q784|ZC3HD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=5390	21.046	3	1661.7523	1661.7523	R	W	951	965
PSM	SPYGSRSPFEHSAEHR	1959	sp|P40201|CHD1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	5-UNIMOD:21	ms_run[2]:scan=4227	17.675	4	1922.8061	1922.8061	R	S	1684	1700
PSM	SQRDREEALHQFR	1960	sp|P16381|DDX3L_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=3311	14.528	4	1670.8237	1670.8237	R	S	475	488
PSM	SQSFAGFSGLQERR	1961	sp|Q80U16-4|RIPR2-4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=14771	48.444	3	1648.7359	1648.7359	R	S	44	58
PSM	SYELPDGQVITIGNER	1962	sp|P60710|ACTB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=20490	64.595	2	1789.8846	1789.8846	K	F	239	255
PSM	TAMRVSPHHPAPTPNPR	1963	tr|G3UWD2|G3UWD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	1-UNIMOD:21	ms_run[2]:scan=3649	15.754	4	1944.9142	1944.9142	R	A	207	224
PSM	TGIRTDSREDEISPPPPNPVVK	1964	tr|A2AI69|A2AI69_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	13-UNIMOD:21	ms_run[2]:scan=11251	37.894	4	2483.2057	2483.2057	K	G	71	93
PSM	TGSPGAKIPFSVPEVPLVFQGQTK	1965	sp|Q9D8C4|IN35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	1-UNIMOD:21	ms_run[2]:scan=25374	81.229	3	2563.3087	2563.3087	R	Q	34	58
PSM	TRSEPLPPSATASPLLAPLQPR	1966	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	1-UNIMOD:21	ms_run[2]:scan=20388	64.255	3	2378.2359	2378.2359	R	Q	342	364
PSM	TVETRDGQVINETSQHHDDLE	1967	sp|P20152|VIME_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=7292	26.7	3	2422.0997	2422.0997	K	-	446	467
PSM	TVSEPNLKLR	1968	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=9360	32.37	2	1235.6275	1235.6275	K	Y	176	186
PSM	VAQPKEVYQQQQYGSGGRGNR	1969	sp|Q99020|ROAA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=4216	17.638	4	2349.1574	2349.1574	K	N	233	254
PSM	VEKEEAGGGGGGGISEEEAAQYDR	1970	sp|Q9R1T2-2|SAE1-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=8367	29.768	3	2394.0571	2394.0571	M	Q	2	26
PSM	VLKQVHPDTGISSK	1971	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=2985	13.352	3	1507.8358	1507.8358	K	A	45	59
PSM	VLSPLIIK	1972	sp|E9Q7F2|RN169_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=19872	62.736	2	961.56132	961.5613	R	S	388	396
PSM	VPLSAYDRVSGRTSPLMLDR	1973	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	13-UNIMOD:21	ms_run[2]:scan=16021	51.833	3	2312.1348	2312.1348	R	A	2338	2358
PSM	VSGRTSPLMLDR	1974	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	5-UNIMOD:21	ms_run[2]:scan=8942	31.271	3	1410.669	1410.6691	R	A	2346	2358
PSM	YGKIETIEVMEDR	1975	tr|A2AL12|A2AL12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0		ms_run[2]:scan=12881	42.55	3	1581.7709	1581.7709	K	Q	149	162
PSM	YMAENPTAGVVQEEEEDNLEYDSDGNPIAPSKK	1976	sp|Q810A7-2|DDX42-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	7-UNIMOD:21	ms_run[2]:scan=19757	62.414	3	3718.587	3718.5870	R	I	44	77
PSM	YRSPYSGPKFNSAIR	1977	tr|E9Q8F0|E9Q8F0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	14.0	3-UNIMOD:21	ms_run[2]:scan=9613	33.147	3	1821.8563	1821.8563	R	G	95	110
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKR	1978	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=18182	57.735199	4	4287.895561	4287.893727	K	S	104	143
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	1979	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	21-UNIMOD:21	ms_run[1]:scan=19505	61.741501	3	3092.407895	3090.400547	K	S	1028	1055
PSM	GHTQTWPDTSSPEVMQTQVESPLLQSK	1980	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=20548	64.767858	3	3092.410165	3090.400547	K	S	1028	1055
PSM	SGMSPEQSKTKPDSSIYPLVDSK	1981	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=12377	41.180567	3	2560.177951	2560.176801	K	S	1094	1117
PSM	SETAPAAPAAPAPVEKTPVK	1982	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12220	40.792094	3	2053.0141	2053.0128	M	K	2	22
PSM	SETAPAAPAAPAPVEKTPVK	1983	sp|P43277|H13_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12038	40.323707	2	2053.0145	2053.0128	M	K	2	22
PSM	ERSPALKSPLQSVVVR	1984	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=12637	41.868327	3	1844.988460	1844.987348	R	R	246	262
PSM	RIDISPSTFRK	1985	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=9858	34.044667	3	1398.702699	1398.702065	R	H	675	686
PSM	HLSHPEPEQQHVIQR	1986	sp|Q9JIX8|ACINU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=3770	16.135378	4	1913.890567	1913.889759	R	L	708	723
PSM	SGVSITIDDPVRTAQVPSPPRGK	1987	sp|Q9JIX8|ACINU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	18-UNIMOD:21	ms_run[1]:scan=15232	49.826468	4	2456.243850	2456.242453	K	I	986	1009
PSM	SASPDDDLGSSNWEAADLGNEERKQK	1988	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=15324	50.070425	3	2899.215078	2898.230505	R	F	15	41
PSM	QGSGSSQPMEVQEGYGFGSDDPYSSAEPHVSGMKR	1989	sp|Q62318|TIF1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=17638	56.247014	4	3767.551872	3767.550535	K	S	436	471
PSM	LASPSGSTSSGLEVVAPEVTSAPVSGPGILDDSATICR	1990	sp|Q62318|TIF1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,37-UNIMOD:4	ms_run[1]:scan=25950	83.335632	4	3763.789106	3763.786332	R	V	592	630
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	1991	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	24-UNIMOD:21,27-UNIMOD:35	ms_run[1]:scan=20924	65.914607	4	3507.551378	3507.555485	R	T	545	573
PSM	KSAEPLANTVLASETEEEGNAQALGPTAK	1992	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=18199	57.782088	3	3006.409343	3005.423056	K	S	157	186
PSM	HQVRTPSPLALEDTVELSSPPLSPTTK	1993	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=21641	67.936193	3	3060.465032	3059.461764	R	L	162	189
PSM	TPSPLALEDTVELSSPPLSPTTK	1994	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=24766	78.966198	3	2459.209334	2459.208419	R	L	166	189
PSM	QPSIELPSMAVASTK	1995	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=20899	65.840924	2	1637.774716	1637.773575	R	T	241	256
PSM	RYSPPIQR	1996	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=4712	19.25347	3	1095.522787	1095.522644	R	R	614	622
PSM	RYSPPIQR	1997	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=4763	19.423929	3	1095.522787	1095.522644	R	R	614	622
PSM	RYSPPIQR	1998	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=4686	19.152527	2	1095.523272	1095.522644	R	R	614	622
PSM	RYSPPIQR	1999	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=4821	19.59712	3	1095.522787	1095.522644	R	R	614	622
PSM	LRELAGNSSTPPPVSPGRGNPMHR	2000	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=9800	33.847941	4	2686.220372	2686.220035	R	L	367	391
PSM	SGTASGGSTPHLGGPGPGRPSSKEGR	2001	sp|Q99PV8|BC11B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=3576	15.494841	4	2470.135654	2470.135028	R	R	758	784
PSM	ASGVAVSDGVIKVFNDMKVR	2002	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=24235	76.957281	3	2213.0913	2213.0910	M	K	2	22
PSM	KKNEPEDEEEEEEEEEEEDDEEEEEDEE	2003	sp|P30681|HMGB2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=10743	36.444467	3	3526.258953	3526.255817	K	-	183	211
PSM	ELEKRASGQAFELILSPR	2004	sp|P54227|STMN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=17819	56.736165	4	2123.078786	2123.077620	K	S	10	28
PSM	SSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPK	2005	tr|B1AZ85|B1AZ85_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=10505	35.83946	4	3595.548885	3594.562874	K	K	114	150
PSM	ALSEEMGDTLEEGSASPTSPDCSLDSPGPEK	2006	sp|Q8K352|SASH3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21,22-UNIMOD:4	ms_run[1]:scan=19604	62.011973	3	3272.328530	3272.326181	K	M	95	126
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIR	2007	sp|P70288|HDAC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=16213	52.329036	5	4149.840812	4149.840904	R	A	373	410
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIR	2008	sp|P70288|HDAC2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=16850	54.002999	4	4133.848360	4133.845989	R	A	373	410
PSM	CLSDPGPHPEPGEGEPFIPKGQ	2009	sp|Q61165|SL9A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=16296	52.546353	3	2426.052119	2424.045728	R	-	799	821
PSM	HKMSPPPSSFNEPR	2010	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=6247	23.876202	3	1689.731739	1689.733442	R	S	623	637
PSM	AGGQAPSSPSYENSLHSLQSR	2011	tr|Q3UXQ3|Q3UXQ3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=11764	39.424032	3	2253.988239	2251.985904	R	M	209	230
PSM	VMTIPYQPMPASSPVICAGGQDR	2012	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	9-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=21692	68.081773	3	2571.1682	2570.1362	R	C	178	201
PSM	RATSPSSSVSGDFDDGHHSVPTPGPSR	2013	sp|Q8BSQ9|PB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=9109	31.660385	4	2816.215349	2816.215129	R	K	7	34
PSM	LCDFGSASHVADNDITPYLVSR	2014	sp|Q61136|PRP4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	2-UNIMOD:4,18-UNIMOD:21	ms_run[1]:scan=20238	63.817639	3	2517.090948	2516.104305	K	F	832	854
PSM	SDAAVDTSSEITTKDLKEK	2015	sp|P26350|PTMA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=12852	42.460671	3	2159.9902	2158.9882	M	K	2	21
PSM	QSLGESPRTLSPTPSAEGYQDVRDR	2016	sp|Q8K4G5|ABLM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=12131	40.5749	4	2825.297815	2825.298131	R	M	465	490
PSM	TVSEPNLKLR	2017	sp|Q8C2B3|HDAC7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=9377	32.426156	3	1235.627476	1235.627503	K	Y	176	186
PSM	SGDEMIFDPTMSKKK	2018	sp|Q99L45|IF2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=17325	55.370034	2	1834.7911	1834.7877	M	K	2	17
PSM	MEIQSGPQPGSPGRAERLNAR	2019	sp|Q3UDE2|TTL12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,11-UNIMOD:21	ms_run[1]:scan=13260	43.683622	3	2372.1074	2372.1051	-	L	1	22
PSM	LKGFDTSPEHSLDLGISGR	2020	sp|Q8CHI8|EP400_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=17460	55.747048	3	2107.994899	2107.993950	R	K	917	936
PSM	SRASGSYEEQDVANGINQNVALAIAGNHFNLK	2021	sp|Q8C147|DOCK8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=21940	68.885208	4	3467.612408	3466.626675	R	T	1241	1273
PSM	SDFDEFER	2022	sp|P26369|U2AF2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=22156	69.617899	2	1165.3966	1165.3960	M	Q	2	10
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	2023	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=21923	68.816173	4	4196.889433	4195.899841	R	D	224	260
PSM	AAKPCPTEASPPAASPSGDSSPPATAPYDPR	2024	sp|Q6ZPZ3|ZC3H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:4,21-UNIMOD:21	ms_run[1]:scan=11631	38.994672	3	3129.376586	3129.375061	R	V	1095	1126
PSM	ERTSSLTHSEEKSSGFR	2025	sp|Q9CT10|RANB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=3615	15.63559	3	2016.890221	2016.890213	R	L	54	71
PSM	TSSLTHSEEKSSGFR	2026	sp|Q9CT10|RANB3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=3772	16.142791	3	1731.746604	1731.746509	R	L	56	71
PSM	SQDATVSPGSEQSEKSPGPIVSR	2027	sp|Q80YV2|NIPA_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=8520	30.198515	3	2422.101937	2422.101328	R	T	328	351
PSM	AELASVNSQEVEDEGEEEGVDGEEAPDYENLQELN	2028	sp|O54957|LAT_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	8-UNIMOD:21	ms_run[1]:scan=25485	81.649554	3	3915.587718	3915.585503	R	-	208	243
PSM	ERTGSPGAKIPFSVPEVPLVFQGQTK	2029	sp|Q9D8C4|IN35_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=22985	72.666768	4	2849.455666	2848.452446	R	Q	32	58
PSM	TGSPGAKIPFSVPEVPLVFQGQTK	2030	sp|Q9D8C4|IN35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:21	ms_run[1]:scan=25288	80.88758	3	2563.310015	2563.308742	R	Q	34	58
PSM	GAPDPRVDDDSLGEFPVSNSR	2031	sp|Q61103|REQU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=16172	52.222878	3	2308.997164	2308.996135	R	A	132	153
PSM	ARTELESPEESGPPEDEEDAEDFVIDGGPEEAAAKEEEQR	2032	sp|Q64697|PTCA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	7-UNIMOD:21	ms_run[1]:scan=21362	67.194589	4	4465.873699	4465.871848	R	C	93	133
PSM	VLMQHCPARNPQHGDEEGLGGEEEEEEEEEEDDSAEEGGAAR	2033	sp|P59997|KDM2A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:4,34-UNIMOD:21	ms_run[1]:scan=11114	37.489823	4	4729.856753	4729.856626	R	L	835	877
PSM	ASSPPDRIDIFGR	2034	sp|Q3UL36|ARGL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=17025	54.465635	3	1509.698383	1509.697708	R	T	73	86
PSM	SDNDDIEVESDADKRAHHNALER	2035	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21,10-UNIMOD:21	ms_run[1]:scan=10371	35.478975	3	2837.1300	2837.1286	M	K	2	25
PSM	SDNDDIEVESDADKRAHHNALER	2036	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9166	31.790505	3	2757.1573	2757.1622	M	K	2	25
PSM	NAENFDRFFTRHPPVLTPPDQEVIR	2037	sp|P68404-2|KPCB-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	17-UNIMOD:21	ms_run[1]:scan=20093	63.393795	4	3074.476713	3074.476370	R	N	625	650
PSM	NRNSNVVPYDFNR	2038	sp|P06800|PTPRC_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=12352	41.113246	3	1673.731733	1673.731133	K	V	961	974
PSM	SNSVEMDWVLKHTGPNSPDTANDGFVR	2039	sp|P70333|HNRH2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=20067	63.317989	4	3053.356144	3052.338615	K	L	88	115
PSM	RQQDPSPGSNLGGGDDLKLR	2040	sp|Q08024|PEBB_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21	ms_run[1]:scan=10082	34.781135	3	2189.023930	2189.022624	R	-	168	188
PSM	AQVDDPPEPVYANVERQPR	2041	sp|A2AB59-2|RHG27-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=11381	38.284839	3	2259.033224	2259.032126	R	A	18	37
PSM	FLSHSTDSLNKICK	2042	sp|E9Q394|AKP13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=9110	31.66226	3	1728.791602	1728.790623	K	V	1888	1902
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	2043	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=18927	60.030658	3	3725.594049	3724.591003	R	I	372	405
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	2044	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	22-UNIMOD:21	ms_run[1]:scan=18908	59.974523	4	3724.589812	3724.591003	R	I	372	405
PSM	LGPGLPQDGSDEEDEEWPTLEK	2045	sp|O54825|BYST_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	10-UNIMOD:21	ms_run[1]:scan=22981	72.654364	3	2520.058434	2520.058126	R	A	88	110
PSM	QISQDVKLEPDILLR	2046	sp|Q9DBT5|AMPD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=26554	85.295484	2	1828.9346	1828.9331	R	A	85	100
PSM	RQSLELQKCEDILHK	2047	sp|Q9Z277|BAZ1B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=10205	35.075194	4	1975.955525	1975.955062	R	L	1336	1351
PSM	ANSFVGTAQYVSPELLTEK	2048	sp|Q9Z2A0|PDPK1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=23146	73.201671	3	2134.007261	2133.003118	R	S	242	261
PSM	DKQSPSQANGCSDQRPIDILEMLSR	2049	sp|Q91YD3|DCP1A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	6-UNIMOD:21,11-UNIMOD:4	ms_run[1]:scan=24704	78.733491	4	2925.300825	2924.315772	R	A	159	184
PSM	SIANGSDDGAQPSTSTAQEQDDVLIVDSDEEGPSNSTDCSGDDKAR	2050	sp|Q9Z1F9|SAE2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	28-UNIMOD:21,39-UNIMOD:4	ms_run[1]:scan=16944	54.233795	4	4820.949681	4819.963594	K	K	563	609
PSM	RLSLDASTVDKGACLPR	2051	sp|Q6P9R4|ARHGI_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=13677	45.332075	3	1937.938650	1937.939412	R	T	131	148
PSM	HQEGEIFDTEKEKYEITEQR	2052	sp|P47911|RL6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=10908	36.91953	4	2508.179597	2508.176862	R	K	235	255
PSM	AAPSSEGDSCDGVEATDAEEPGGNIVATK	2053	sp|P53564|CUX1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=14400	47.422362	3	2914.189836	2913.185922	R	S	1324	1353
PSM	RASVVSLMTWKPSK	2054	sp|Q8VD58|EVI2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=18663	59.160855	3	1748.809604	1748.808595	K	S	267	281
PSM	NFSDNQLQEGKNVIGLQMGTNR	2055	sp|Q9WVA4|TAGL2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=17470	55.777896	3	2465.190822	2462.197220	R	G	161	183
PSM	NLSLTSSAPPLPSPGR	2056	sp|Q8K1I7|WIPF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=19092	60.5503	2	1672.820101	1672.818552	R	S	328	344
PSM	HTSLNDLSLTRDEQEIEFLR	2057	sp|Q8BVL9|JKIP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=21744	68.245597	3	2495.170674	2495.169348	R	L	380	400
PSM	KLSVGGDSDPPLKR	2058	sp|Q6NZF1|ZC11A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=6335	24.131886	3	1547.772166	1547.770873	R	S	287	301
PSM	TLTRTSQETADVKASVLLGSR	2059	sp|Q8BJ71|NUP93_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	9-UNIMOD:21	ms_run[1]:scan=14041	46.333627	3	2312.175008	2312.173705	R	G	47	68
PSM	QSAPSPTRVAVVAPMSR	2060	tr|Q3UHC1|Q3UHC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=11906	39.918999	3	1832.897568	1832.896819	R	A	307	324
PSM	MGLSMDRMVPTGMGASLER	2061	sp|Q9D0E1|HNRPM_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	1-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=20635	65.013977	3	2135.930920	2133.908054	R	M	524	543
PSM	HRAEAPPLQREDSGTFSLGK	2062	sp|Q9WTX2|PRKRA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	15-UNIMOD:21	ms_run[1]:scan=9363	32.380466	4	2275.075009	2275.074660	R	M	6	26
PSM	NAFADHPHKSDGSNFANYSPPVNR	2063	sp|Q76N33|STALP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=10095	34.823133	4	2721.173683	2721.172142	R	A	224	248
PSM	RPYSPEKAFSSNQVVR	2064	sp|Q8BZR9|NCBP3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	4-UNIMOD:21	ms_run[1]:scan=10353	35.436139	3	1944.931602	1943.925476	K	R	492	508
PSM	AGACGKPHMSPASLPGKR	2065	sp|P97452|BOP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0	1-UNIMOD:1,4-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=7594	27.514255	3	1942.8909	1942.8902	M	R	2	20
PSM	KFLDGIYVSEKGTVQQADE	2066	tr|A0A140T8T4|A0A140T8T4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=15538	50.616736	3	2126.054443	2126.053165	R	-	174	193
PSM	IVTVAAISQDSNPATPNVSTNMEEF	2067	sp|Q62445|SP4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	11-UNIMOD:21	ms_run[1]:scan=26910	86.474852	3	2714.216357	2714.214643	R	-	758	783
PSM	VVHGLQETSGEVKPPSE	2068	sp|Q80X32|CE024_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	16-UNIMOD:21	ms_run[1]:scan=9626	33.183253	3	1871.867292	1871.866624	R	-	172	189
PSM	VEILDPDGVLK	2069	sp|Q8C5T4|MORN3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	14.0		ms_run[1]:scan=10131	34.910703	2	1196.6772	1196.6652	K	E	217	228
PSM	ERASSPPDRIDIFGR	2070	sp|Q3UL36|ARGL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=13738	45.521686	3	1794.842423	1794.841412	R	T	71	86
PSM	VYVGNLGNNGNKTELER	2071	sp|P84104|SRSF3_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0		ms_run[1]:scan=10302	35.301796	3	1876.928681	1875.943889	K	A	12	29
PSM	LRPRSIEVENDFLPVEK	2072	sp|Q8R550|SH3K1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	5-UNIMOD:21	ms_run[1]:scan=16639	53.465662	3	2121.052065	2120.066721	K	T	270	287
PSM	GSYRGGSISVQVNSVKFDSE	2073	sp|E9Q5C9|NOLC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	19-UNIMOD:21	ms_run[1]:scan=17078	54.624209	3	2195.974757	2194.989593	R	-	683	703
PSM	AGSPNPQSSSGELPRKDWTEAPGLEPPATSLSTVAK	2074	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	14.0	3-UNIMOD:21	ms_run[1]:scan=18467	58.547856	4	3741.789011	3741.788715	R	G	21	57
PSM	ALAAAGYDVEKNNSR	2075	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=5439	21.197	3	1577.7798	1577.7798	K	I	65	80
PSM	ALHKLQEYFSVAAGAGDH	2076	sp|Q9D892|ITPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=14627	48.04	4	1912.9432	1912.9432	R	-	181	199
PSM	ALSPDPLLR	2077	sp|O54824-2|IL16-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=16709	53.662	2	1060.5318	1060.5318	K	L	230	239
PSM	ALSPVIPIIPR	2078	tr|A0A0A0MQ73|A0A0A0MQ73_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=23205	73.362	2	1254.7101	1254.7101	R	T	4787	4798
PSM	AMLDQLMGTSRDGDTTRQR	2079	sp|Q7TNC4-2|LC7L2-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	9-UNIMOD:21	ms_run[2]:scan=13866	45.868	3	2230.9824	2230.9824	R	I	9	28
PSM	ATAPQTQHVSPMRQVEPPTKK	2080	tr|D3YUQ9|D3YUQ9_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	10-UNIMOD:21	ms_run[2]:scan=5689	21.95	4	2410.1828	2410.1828	R	G	124	145
PSM	CQSPILHSSSSASSNIPSATNQKPQPQNQNIPR	2081	sp|D0QMC3|MNDAL_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=11030	37.266	4	3652.7053	3652.7053	R	G	274	307
PSM	DMRQTVAVGVIK	2082	sp|P10126|EF1A1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=10761	36.493	3	1315.7282	1315.7282	R	A	428	440
PSM	DVKPHNVMIDHEHRK	2083	sp|Q60737|CSK21_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=1613	7.7479	4	1853.9319	1853.9319	R	L	156	171
PSM	FHDSEGDDTEETEDYRQFR	2084	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	4-UNIMOD:21	ms_run[2]:scan=11232	37.842	3	2454.9238	2454.9238	K	K	105	124
PSM	GAKEEHGGLIRSPR	2085	tr|Q80XR5|Q80XR5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	12-UNIMOD:21	ms_run[2]:scan=2079	9.6321	3	1585.7726	1585.7726	R	H	68	82
PSM	GGSLDINDGHCGLGSEVNATLMHR	2086	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18136	57.598	3	2589.1101	2589.1101	R	R	228	252
PSM	GRLDSSEMDHSENEDYTMSSPLPGKK	2087	sp|Q4VA53-2|PDS5B-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	5-UNIMOD:21	ms_run[2]:scan=11501	38.615	4	2989.2471	2989.2471	K	S	643	669
PSM	GVDFESDEDDDDDPFMSSSCPRR	2088	sp|Q61216-2|MRE11-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	6-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=18989	60.214	3	2756.9844	2756.9844	K	N	654	677
PSM	HHRREELAPYPK	2089	tr|A2AER8|A2AER8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=1566	7.5379	4	1531.8008	1531.8008	R	N	176	188
PSM	HQLVVNRNSSPSPVPGSQNVPAPAVK	2090	sp|P09838|TDT_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	9-UNIMOD:21	ms_run[2]:scan=10943	37.034	3	2758.3916	2758.3916	R	K	123	149
PSM	IDISPSALRK	2091	tr|A0A087WRN1|A0A087WRN1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	4-UNIMOD:21	ms_run[2]:scan=11778	39.47	3	1178.606	1178.6060	R	H	366	376
PSM	IDISPSTFRK	2092	tr|Q8BZN7|Q8BZN7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	4-UNIMOD:21	ms_run[2]:scan=12544	41.604	3	1242.601	1242.6010	R	H	676	686
PSM	KALAAAGYDVEKNNSR	2093	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=3590	15.543	3	1705.8747	1705.8747	K	I	64	80
PSM	KFLDGIYVSEKGTVQQADE	2094	tr|A0A0G2JES3|A0A0G2JES3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=15553	50.656	3	2126.0532	2126.0532	R	-	173	192
PSM	KLEKEEEEGISQESSEEEQ	2095	sp|P17095-1|HMGA1-1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	14-UNIMOD:21	ms_run[2]:scan=6288	23.992	3	2315.953	2315.9530	K	-	78	97
PSM	KLSGDLEAGAPK	2096	sp|O08784|TCOF_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=6902	25.655	2	1264.6064	1264.6064	R	N	1189	1201
PSM	LAQALHEMREQHDAQVR	2097	sp|P14733|LMNB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=4663	19.078	4	2031.0068	2031.0068	K	L	243	260
PSM	LFDYRGRLSPVPVPR	2098	tr|A2AU60|A2AU60_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	9-UNIMOD:21	ms_run[2]:scan=16501	53.096	3	1850.9557	1850.9557	R	A	111	126
PSM	LLEGEEERLKLSPSPSSR	2099	sp|P14733|LMNB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	12-UNIMOD:21	ms_run[2]:scan=12674	41.978	4	2106.0358	2106.0358	K	V	381	399
PSM	LSGLSFKR	2100	sp|P28667|MRP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	5-UNIMOD:21	ms_run[2]:scan=9974	34.433	2	986.49503	986.4950	K	N	100	108
PSM	MLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIR	2101	tr|A0A0R4J008|A0A0R4J008_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	22-UNIMOD:21	ms_run[2]:scan=16760	53.805	4	4133.846	4133.8460	R	A	373	410
PSM	MLPPPPMWRRSPPR	2102	sp|Q99M28-2|RNPS1-2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	11-UNIMOD:21	ms_run[2]:scan=12994	42.868	3	1796.8732	1796.8732	R	M	233	247
PSM	NDEELNKLLGR	2103	sp|C0HKE4|H2A1E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=13663	45.283	3	1299.6783	1299.6783	R	V	90	101
PSM	NSSPSISPNTSFASDGSPSPLGGIKR	2104	sp|Q9DBR1-2|XRN2-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	2-UNIMOD:21	ms_run[2]:scan=17479	55.806	3	2639.2228	2639.2228	R	K	469	495
PSM	QLQRGEEPDVRYDFEPYVSNNSWSPIMR	2105	tr|G3X9Q3|G3X9Q3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	19-UNIMOD:21	ms_run[2]:scan=22673	71.571	3	3491.5606	3491.5606	R	T	545	573
PSM	RASGQAFELILSPR	2106	tr|D3Z1Z8|D3Z1Z8_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=19642	62.111	2	1623.8134	1623.8134	K	S	14	28
PSM	RISDPLTSSPGRSSR	2107	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	7-UNIMOD:21	ms_run[2]:scan=5383	21.026	3	1694.8101	1694.8101	R	R	19	34
PSM	RISDPLTSSPGRSSR	2108	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	7-UNIMOD:21	ms_run[2]:scan=5438	21.195	3	1694.8101	1694.8101	R	R	19	34
PSM	RISDPLTSSPGRSSR	2109	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	7-UNIMOD:21	ms_run[2]:scan=5495	21.369	3	1694.8101	1694.8101	R	R	19	34
PSM	RISGLIYEETRGVLK	2110	sp|P62806|H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=19300	61.195	3	1812.9499	1812.9499	K	V	46	61
PSM	RKHVLSGTLGIPEHTYR	2111	tr|A0A1L1SUX8|A0A1L1SUX8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=6106	23.407	4	1963.0752	1963.0752	K	S	60	77
PSM	RKTSGPPVSELITK	2112	sp|P43274|H14_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=5517	21.432	3	1511.8671	1511.8671	K	A	33	47
PSM	RPPSAFFLFCSENRPK	2113	sp|P30681|HMGB2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	4-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=18222	57.848	3	2031.939	2031.9390	K	I	97	113
PSM	RVPSPTPVPK	2114	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	4-UNIMOD:21	ms_run[2]:scan=4086	17.221	2	1156.6006	1156.6006	K	E	2532	2542
PSM	SASPDDDLGSSNWEAADLGNEERK	2115	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=17195	55.005	3	2642.077	2642.0770	R	Q	15	39
PSM	SASPDDDLGSSNWEAADLGNEERKQK	2116	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=14387	47.393	3	2898.2305	2898.2305	R	F	15	41
PSM	SLSPGGAALGYR	2117	sp|Q0VBL3-2|RBM15-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=13864	45.863	2	1227.5649	1227.5649	R	D	291	303
PSM	SMGTGDSAGVEVPSSPLRR	2118	tr|H3BKM2|H3BKM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	14-UNIMOD:21	ms_run[2]:scan=12524	41.55	3	1981.8929	1981.8929	R	T	338	357
PSM	STITSREIQTAVR	2119	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=7181	26.413	3	1460.7947	1460.7947	R	L	88	101
PSM	TVSEPNLKLR	2120	tr|E9PZG4|E9PZG4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=9532	32.892	2	1235.6275	1235.6275	K	Y	176	186
PSM	VKVVEEMSE	2121	sp|Q9ESX5|DKC1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	8-UNIMOD:21	ms_run[2]:scan=9168	31.798	2	1128.4774	1128.4774	K	-	501	510
PSM	VLKQVHPDTGISSK	2122	sp|Q8CGP2|H2B1P_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=2980	13.337	4	1507.8358	1507.8358	K	A	45	59
PSM	VLSPQKPTITLSAYQR	2123	sp|Q8CEC0-3|NUP88-3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	3-UNIMOD:21	ms_run[2]:scan=15633	50.856	3	1880.9761	1880.9761	K	K	697	713
PSM	VMTIPYQPMPASSPVICAGGQDR	2124	sp|P60335|PCBP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	12-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=21640	67.935	3	2554.142	2554.1420	R	C	178	201
PSM	VSGRTSPLMLDR	2125	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	5-UNIMOD:21	ms_run[2]:scan=9017	31.449	3	1410.669	1410.6691	R	A	2346	2358
PSM	VSVSPGRTSGKVTK	2126	tr|A2A8V8|A2A8V8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0	4-UNIMOD:21	ms_run[2]:scan=2438	11.147	3	1481.7603	1481.7603	R	H	426	440
PSM	YQKSTELLIR	2127	tr|F8WI35|F8WI35_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001583, MaxQuant, ]	13.0		ms_run[2]:scan=7002	25.913	3	1249.703	1249.7030	R	K	55	65
PSM	LKCGSGPVHISGQHLVAVEEDAESEDEDEEDVK	2128	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=14026	46.290825	4	3686.596834	3686.593112	R	L	102	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGK	2129	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21,35-UNIMOD:35	ms_run[1]:scan=21119	66.556151	4	4130.7666	4130.7605	K	R	104	142
PSM	CGSGPVHISGQHLVAVEEDAESEDEDEEDVK	2130	sp|Q61937|NPM_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15293	49.989965	3	3446.418551	3445.414085	K	L	104	135
PSM	DKFSPTQDRPESSTVLK	2131	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=9042	31.506636	3	2013.9409	2013.9403	R	V	1148	1165
PSM	VGLFSSQKVSSPVLETVQQR	2132	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=18863	59.817059	3	2268.1540	2268.1510	K	T	1350	1370
PSM	VPLSAYDRVSGRTSPLMLDR	2133	sp|Q8BTI8|SRRM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=16024	51.840885	4	2312.136030	2312.134817	R	A	2338	2358
PSM	SESGHRGFVPEKNFR	2134	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=5095	20.218885	4	1825.826409	1825.826097	R	V	505	520
PSM	RIDISPSTFRK	2135	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=8959	31.313013	3	1398.702694	1398.702065	R	H	675	686
PSM	IDISPSTFR	2136	sp|Q569Z6|TR150_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=17516	55.918231	2	1114.506637	1114.505991	R	K	676	685
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	2137	sp|Q8VEK3|HNRPU_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=21634	67.922657	4	3913.644690	3913.648853	R	I	245	277
PSM	LKATVTPSPVKGK	2138	sp|Q80XU3|NUCKS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=3125	13.863211	3	1404.774676	1404.774167	R	A	174	187
PSM	SASPDDDLGSSNWEAADLGNEER	2139	sp|Q9R0P4|SMAP_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	11-UNIMOD:21	ms_run[1]:scan=20159	63.593509	3	2513.983370	2513.982001	R	K	15	38
PSM	ASPITNDGEDEFVPSDGLDKDEYAFSSGK	2140	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=21491	67.487968	3	3169.3376	3169.3284	K	S	1386	1415
PSM	SEDDSAKFDSNEEDTASVFAPSFGLK	2141	sp|Q64511|TOP2B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=23393	73.833446	3	2872.197707	2872.196410	K	Q	1444	1470
PSM	AGSPNPQSSSGELPRKDWTEAPGLEPPATSLSTVAK	2142	sp|Q3TBD2|HMHA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=18632	59.066238	4	3741.789011	3741.788715	R	G	21	57
PSM	RIDISPSALR	2143	sp|Q8K019|BCLF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=12814	42.365555	3	1206.612276	1206.612187	R	K	652	662
PSM	AETLSGLGDASAAGAAAVSSAASETGTRR	2144	sp|D3YXK2|SAFB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,19-UNIMOD:21	ms_run[1]:scan=23220	73.393615	3	2756.2636	2756.2609	M	L	2	31
PSM	LSRQPSIELPSMAVASTK	2145	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=14053	46.359775	3	2010.990316	2009.985694	K	T	238	256
PSM	QPSIELPSMAVASTK	2146	sp|P19973|LSP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=20846	65.666398	2	1637.774716	1637.773575	R	T	241	256
PSM	RYSPPIQR	2147	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=4665	19.083483	3	1095.522787	1095.522644	R	R	614	622
PSM	KETESEAEDDNLDDLER	2148	sp|Q52KI8|SRRM1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=11991	40.179256	2	2086.819431	2086.821584	R	H	911	928
PSM	SETAPVAQAASTATEKPAAAKK	2149	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1	ms_run[1]:scan=8439	29.971064	3	2169.1258	2169.1272	M	T	2	24
PSM	SETAPVAQAASTATEKPAAAK	2150	sp|P43275|H11_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=13341	43.963902	3	2120.9994	2120.9986	M	K	2	23
PSM	RVSEPVEIGIQVTPDEDDHLLSPTKGICPK	2151	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	24-UNIMOD:21,28-UNIMOD:4	ms_run[1]:scan=19429	61.541638	4	3408.664100	3408.663638	R	Q	107	137
PSM	VSEPVEIGIQVTPDEDDHLLSPTKGICPK	2152	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21,27-UNIMOD:4	ms_run[1]:scan=21409	67.295884	4	3252.565339	3252.562527	R	Q	108	137
PSM	VSEPVEIGIQVTPDEDDHLLSPTKGICPK	2153	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21,27-UNIMOD:4	ms_run[1]:scan=21447	67.385527	3	3252.564322	3252.562527	R	Q	108	137
PSM	LRELAGNSSTPPPVSPGRGNPMHR	2154	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=8634	30.536228	4	2606.255591	2606.253704	R	L	367	391
PSM	SPFLSTPPLPPMPAGTPPPQPPAK	2155	sp|Q99PV8|BC11B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=23571	74.464169	3	2502.246008	2501.242971	K	S	401	425
PSM	ASGVAVSDGVIKVFNDMK	2156	sp|P18760|COF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	2-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=29266	91.781638	3	1995.8697	1995.8773	M	V	2	20
PSM	SSPKEEVASEPEEAASPTTPK	2157	sp|Q9D6Z1|NOP56_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=7463	27.154294	3	2249.996290	2249.994069	K	K	528	549
PSM	QEAQQREVDQDDEENSEEDEMDSGTMVR	2158	sp|Q9JI11|STK4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	16-UNIMOD:21	ms_run[1]:scan=12094	40.478029	3	3378.274783	3378.277333	R	A	305	333
PSM	SETAPAETAAPAPVEKSPAKK	2159	sp|P43276|H15_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6907	25.665374	3	2201.0638	2201.0612	M	K	2	23
PSM	LLEGEEERLKLSPSPSSR	2160	sp|P14733|LMNB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=12840	42.431659	3	2107.038674	2106.035815	K	V	381	399
PSM	AASENSQDAFRVVSTSGEQLKVYK	2161	sp|Q03267|IKZF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=16277	52.498056	3	2695.274849	2693.269791	R	C	435	459
PSM	RFTPPSTALSPGKMSEALPLGAPDGGAALASK	2162	tr|A0A087WR05|A0A087WR05_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=21003	66.176374	4	3174.578183	3174.578452	R	L	26	58
PSM	DMMVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPAQLSHGSQPSVR	2163	sp|Q60611|SATB1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	37-UNIMOD:21	ms_run[1]:scan=24374	77.462578	4	5393.4213	5393.4172	K	T	248	298
PSM	LQESPAPEKGEVLGDALQLDTLKQEAAK	2164	sp|E9Q7G0|NUMA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=19565	61.915915	3	3057.528274	3057.527128	R	L	395	423
PSM	TQPDGTSVPGEPASPISQRLPPKVESLESLYFTPTPAR	2165	sp|E9Q7G0|NUMA1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=23325	73.655922	4	4129.042416	4129.040907	R	G	1726	1764
PSM	LSQSSYQDSESLSPPRKVPR	2166	sp|Q61033|LAP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=9825	33.926463	3	2340.111446	2340.111105	R	L	410	430
PSM	LSQSSYQDSESLSPPRKVPR	2167	sp|Q61033|LAP2A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=9790	33.806849	4	2340.109793	2340.111105	R	L	410	430
PSM	HKMSPPPSSFNEPR	2168	sp|Q9CW46|RAVR1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:35,4-UNIMOD:21	ms_run[1]:scan=3559	15.432931	3	1705.728353	1705.728357	R	S	623	637
PSM	NRTPSDVKELVLDNCK	2169	sp|O35381|AN32A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11860	39.763888	3	1967.918731	1966.918342	R	S	13	29
PSM	LSSESHHGGSPIHWVLPAGMSAK	2170	sp|E9Q5K9|YTDC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=14862	48.739864	4	2464.136449	2464.135880	R	M	416	439
PSM	LSSESHHGGSPIHWVLPAGMSAK	2171	sp|E9Q5K9|YTDC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=14631	48.054868	4	2464.136449	2464.135880	R	M	416	439
PSM	KTVSEPNLKLR	2172	sp|Q8C2B3|HDAC7_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=6682	25.111338	3	1363.723043	1363.722466	R	Y	175	186
PSM	AIVSPFHSPPSTPSSPGIR	2173	sp|Q3UZA1|CPZIP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=15863	51.419981	3	2013.978447	2012.972092	K	S	113	132
PSM	QVDTEEAGMVTAATASNVKASPK	2174	sp|Q99JF8|PSIP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=14050	46.352725	3	2384.092752	2384.093072	K	R	156	179
PSM	QVDTEEAGMVTAATASNVKASPK	2175	sp|Q99JF8|PSIP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=13430	44.317987	3	2384.093594	2384.093072	K	R	156	179
PSM	DGEIKKAGSDGDIMDSSTETPPISIK	2176	sp|Q3V3V9|CARL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=16145	52.1569	3	2770.264864	2770.261988	K	S	1126	1152
PSM	ALGSPTKQLLPCEMACNEKLGK	2177	sp|Q99J77|SIAS_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21,12-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=15317	50.052896	3	2524.189239	2524.188904	R	S	272	294
PSM	ALHKLQEYFSVAAGAGDH	2178	sp|Q9D892|ITPA_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=14554	47.83148	3	1913.948089	1912.943161	R	-	181	199
PSM	TASFGGITVLTRGDSTSSTR	2179	sp|Q9DCB4|ARP21_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=18015	57.262145	3	2092.981087	2092.979028	K	S	379	399
PSM	AASLRGGVGAPGSPSTPPTRFFTEK	2180	sp|Q3UYC0|PPM1H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=15123	49.530699	4	2567.255646	2567.253353	R	K	208	233
PSM	AASLRGGVGAPGSPSTPPTRFFTEK	2181	sp|Q3UYC0|PPM1H_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=15013	49.190903	4	2567.255646	2567.253353	R	K	208	233
PSM	TGIRTDSREDEISPPPPNPVVK	2182	sp|Q9DBC7|KAP0_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21	ms_run[1]:scan=11326	38.115361	3	2483.206747	2483.205734	K	G	71	93
PSM	GATPAEDDEDKDIDLFGSDEEEEDKEAAR	2183	sp|P57776|EF1D_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	18-UNIMOD:21	ms_run[1]:scan=16050	51.91608	4	3275.316897	3275.315082	K	L	145	174
PSM	SLSPGGAALGYRDYR	2184	sp|Q0VBL3|RBM15_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=13750	45.555432	3	1661.756842	1661.756286	R	L	291	306
PSM	DNLTLWTSDMQGDGEEQNKEALQDVEDENQ	2185	sp|P62259|1433E_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:35	ms_run[1]:scan=21796	68.416098	3	3466.459639	3466.459047	R	-	226	256
PSM	MSMKEVDEQMLNVQNK	2186	sp|P68372|TBB4B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35	ms_run[1]:scan=11601	38.892977	3	1940.889573	1938.884919	R	N	321	337
PSM	SQSFAGFSGLQERR	2187	sp|Q80U16|RIPR2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=14709	48.273357	3	1648.736250	1648.735885	R	S	44	58
PSM	SKSPPPPEEEAKDEEEDQTLVNLDTYTSDLHFQISK	2188	sp|Q00PI9|HNRL2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=22862	72.220806	3	4195.899187	4195.899841	R	D	224	260
PSM	AASPPASASDLIEQQQKR	2189	sp|Q8C079|STRP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=12063	40.385478	3	1976.940636	1975.936435	R	G	333	351
PSM	AAKPCPTEASPPAASPSGDSSPPATAPYDPR	2190	sp|Q6ZPZ3|ZC3H4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:4,7-UNIMOD:21,21-UNIMOD:21	ms_run[1]:scan=12890	42.572823	3	3209.340166	3209.341392	R	V	1095	1126
PSM	CKESASPTIPNLDLLEAHTKEALTK	2191	sp|Q9WTU0|PHF2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:4,4-UNIMOD:21	ms_run[1]:scan=19763	62.425935	4	2845.394217	2845.393277	K	M	531	556
PSM	LKQLSVPASDEEDEVPAPIPR	2192	sp|Q6P542|ABCF1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=19708	62.281694	3	2449.119356	2449.117904	R	G	99	120
PSM	IALALNKVDGPDVALKDSDQVAQSDGEESPAAEEQLLGER	2193	sp|Q3UPL0|SC31A_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	29-UNIMOD:21	ms_run[1]:scan=21841	68.56482	4	4257.035240	4257.032587	K	I	503	543
PSM	IIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELR	2194	sp|P61979|HNRPK_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	13-UNIMOD:21,29-UNIMOD:4,42-UNIMOD:4	ms_run[1]:scan=28230	89.680247	4	5213.4299	5213.4245	K	L	104	149
PSM	SRSPVDSPVPASMFAPEPSSPGAAR	2195	sp|O08582|GTPB1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=17672	56.330832	3	2576.173684	2576.173053	R	A	6	31
PSM	KHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTIDLKNFR	2196	sp|Q99K48|NONO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=10814	36.64838	7	5640.7272	5640.7462	R	K	18	66
PSM	KHHQHHHQQHHQQQQQQQQQQPPPPIPANGQQASSQNEGLTIDLKNFR	2197	sp|Q99K48|NONO_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0		ms_run[1]:scan=11015	37.223949	6	5641.7282	5640.7462	R	K	18	66
PSM	TAHNSEADLEESFNEHELEPSSPKTK	2198	sp|Q9D4J7|PHF6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	21-UNIMOD:21	ms_run[1]:scan=12924	42.668764	4	3005.293024	3005.292770	K	K	134	160
PSM	IAGTPGTGGRLSPENNQVLTK	2199	sp|Q8VE65|TAF12_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21	ms_run[1]:scan=11652	39.053005	3	2189.084810	2189.084162	K	K	40	61
PSM	GPPSPPAPVMHSPSR	2200	sp|Q9CSN1|SNW1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=8737	30.797359	3	1594.726612	1592.717063	R	K	221	236
PSM	GPPSPPAPVMHSPSR	2201	sp|Q9CSN1|SNW1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=8722	30.765245	3	1592.716098	1592.717063	R	K	221	236
PSM	SDNDDIEVESDADKRAHHNALER	2202	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9640	33.237538	4	2758.1472	2757.1622	M	K	2	25
PSM	SDNDDIEVESDADKRAHHNALER	2203	sp|P28574-2|MAX-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=9471	32.717975	4	2758.1472	2757.1622	M	K	2	25
PSM	RGRASFPDQAYANSQPAPS	2204	sp|Q8C503|SIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=9814	33.888168	3	2098.917635	2098.922182	R	-	162	181
PSM	RGRASFPDQAYANSQPAPS	2205	sp|Q8C503|SIT1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=9864	34.059548	3	2098.917635	2098.922182	R	-	162	181
PSM	GRLSPVPVPR	2206	sp|Q64012|RALY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	4-UNIMOD:21	ms_run[1]:scan=8219	29.324927	3	1156.611992	1156.611793	R	A	132	142
PSM	NAENFDRFFTRHPPVLTPPDQEVIR	2207	sp|P68404-2|KPCB-2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=19993	63.082864	4	3076.486206	3074.476370	R	N	625	650
PSM	SQSLRSFQGAGSWASR	2208	sp|Q8C2K5|RASL3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=14328	47.223211	3	1803.805976	1803.805361	K	R	811	827
PSM	ATSPPHLDGTSNPESTVPEKK	2209	sp|Q60953|PML_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=7994	28.652146	3	2271.042407	2271.042022	K	I	526	547
PSM	VHVQFFDDSPTRGWVSKR	2210	sp|P54276|MSH6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=15599	50.771439	4	2240.053565	2240.052802	R	M	129	147
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKR	2211	sp|O09106|HDAC1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=18390	58.30556	3	3742.594992	3740.585918	R	I	372	405
PSM	HITDEADRKYEEVAR	2212	sp|Q6IRU2|TPM4_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=5211	20.500243	4	1830.886437	1830.886040	K	K	117	132
PSM	QISQDVKLEPDILLR	2213	sp|Q9DBT5|AMPD2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=21430	67.343725	2	1845.960259	1845.960130	R	A	85	100
PSM	KAAVVASPLLDQQR	2214	sp|E9Q784|ZC3HD_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=10597	36.056917	3	1574.818811	1574.818158	R	N	236	250
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	2215	sp|Q99LI7|CSTF3_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=11414	38.374103	4	2845.256203	2845.255597	K	A	686	710
PSM	KFPDRLADDEGDSDSESVGQSR	2216	sp|Q9Z277|BAZ1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=11796	39.541777	3	2569.001046	2569.000702	R	G	1452	1474
PSM	KFPDRLADDEGDSDSESVGQSR	2217	sp|Q9Z277|BAZ1B_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=11748	39.366357	3	2569.001046	2569.000702	R	G	1452	1474
PSM	NLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALR	2218	sp|Q60787|LCP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	14-UNIMOD:21	ms_run[1]:scan=27025	86.854568	4	4736.283570	4736.279968	R	K	397	438
PSM	ARSMDSSDLSDGAVTLQEYLELKK	2219	sp|Q68FF6|GIT1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=22586	71.287424	3	2737.277466	2735.272493	R	A	417	441
PSM	SKPLDQSVEDLSKAPPSSVPK	2220	sp|Q9JL26|FMNL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:21	ms_run[1]:scan=12160	40.644972	3	2288.130783	2288.130109	K	S	178	199
PSM	TASFSESRADEVAPAKK	2221	sp|Q91V92|ACLY_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=5610	21.718438	3	1872.862719	1872.861873	R	A	453	470
PSM	QQAAYYAQTSPQGMPQHPPAPQGQ	2222	tr|A0A0G2JE55|A0A0G2JE55_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=13998	46.222436	3	2660.150361	2660.147901	R	-	119	143
PSM	AAAAALSGAGAPPAGGGAGGGGSPPGGWAVAR	2223	sp|Q3UCQ1|FOXK2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,23-UNIMOD:21	ms_run[1]:scan=24293	77.160353	3	2665.2403	2665.2393	M	L	2	34
PSM	SSPPAPGTAGPTSPSVALTNLALRR	2224	tr|E9Q6E5|E9Q6E5_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,2-UNIMOD:21	ms_run[1]:scan=23674	74.871796	3	2539.2808	2539.2790	M	N	2	27
PSM	QKSLDSDLSDGPVTVQEFMEVK	2225	tr|E9PVA6|E9PVA6_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=24331	77.298541	3	2532.154753	2531.150252	R	S	413	435
PSM	SPLYQECLLAEAEGRPLREPGSSHLGSPDTAR	2226	sp|P97492|RGS14_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	7-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=18149	57.636004	4	3572.674629	3572.671911	K	K	177	209
PSM	HTSLNDLSLTRDEQEIEFLR	2227	sp|Q8BVL9|JKIP1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=21765	68.304149	4	2495.170685	2495.169348	R	L	380	400
PSM	LAPSNRLSSSSLGAPSASVPASR	2228	sp|Q7TN58|TMC8_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=14112	46.528357	3	2373.090183	2371.093420	R	F	691	714
PSM	HISEDRRESDDSDVDLGSAVR	2229	sp|Q62187|TTF1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=8538	30.2463	4	2517.017370	2517.017021	R	Q	449	470
PSM	SAEDLTDGSYDDILNAEQLKK	2230	sp|Q9D0L7|ARM10_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21	ms_run[1]:scan=20937	65.963546	3	2406.076629	2404.068297	R	L	43	64
PSM	YMSSDTTSPELREHLAQKPVFLPR	2231	sp|Q60520|SIN3A_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=15882	51.476579	4	2881.385420	2881.383381	R	N	1106	1130
PSM	DVYLSPRDDGYSTKDSYSSR	2232	sp|Q91VM5|RMXL1_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	5-UNIMOD:21	ms_run[1]:scan=11553	38.764517	3	2390.006225	2390.006365	R	D	201	221
PSM	IGDLGLATLKRASFAK	2233	sp|P83741|WNK1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=15760	51.159689	3	1739.934843	1739.933522	K	S	366	382
PSM	ASMSEFLESEDGEVEQQR	2234	sp|Q80U70|SUZ12_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=20196	63.7024	3	2149.851364	2149.851110	K	T	540	558
PSM	SEDRPSSPQVSVAAVETK	2235	sp|P70399|TP53B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=9930	34.281428	3	1965.906526	1965.904466	R	E	262	280
PSM	SLSFEMQPDELLEKPMSPMQYAR	2236	sp|Q920Q8|NS1BP_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=25731	82.531055	3	2807.244804	2806.241727	K	S	336	359
PSM	SQGGYDRYSGGNYRDNYDN	2237	tr|Q8BG13|Q8BG13_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0		ms_run[1]:scan=7700	27.825236	3	2200.887859	2199.884202	R	-	136	155
PSM	SQGDSNPAAIPHAAEDIQGDDRWMSQHNR	2238	sp|Q61206|PA1B2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,1-UNIMOD:21	ms_run[1]:scan=17868	56.870781	4	3324.4030	3324.3999	M	F	2	31
PSM	SLSPVAAPPLREPR	2239	sp|Q6PHZ5|RB15B_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=12438	41.331537	3	1568.807587	1568.807593	R	A	261	275
PSM	QADSETKEIITEEPSEEEADMPKPK	2240	sp|Q9JIK5|DDX21_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	15-UNIMOD:21	ms_run[1]:scan=13100	43.169267	3	2912.278713	2910.272946	K	K	104	129
PSM	GIPLPTGDTSPEPELLPGDPLPPPKEVINGNIK	2241	sp|Q9Z1D1|EIF3G_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	10-UNIMOD:21	ms_run[1]:scan=24991	79.808155	3	3481.765793	3480.779320	K	T	33	66
PSM	EGSYDRYLRVDDYCR	2242	sp|Q91W39|NCOA5_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=15475	50.45835	3	2045.831348	2045.830256	R	R	124	139
PSM	FSSQLQAVSLRRPPAQAMLSGP	2243	sp|P30987|TA2R_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	9-UNIMOD:21	ms_run[1]:scan=19909	62.847384	3	2420.204271	2420.203566	R	-	320	342
PSM	DKGIPMESMHVYQTVPHPGIQGSLK	2244	sp|P51163|HEM4_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	8-UNIMOD:21	ms_run[1]:scan=11192	37.717371	4	2829.3322	2828.3382	K	S	157	182
PSM	ATEIGSPPRFFHMPR	2245	sp|Q8K4P0|WDR33_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1001476, X!Tandem, ]	13.0	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=21419	67.318334	3	1863.8488	1863.8486	M	F	2	17
PSM	FVSVVPQYQPSVSSAGSRR	2246	sp|Q6A0D4|RFTN1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	17-UNIMOD:21	ms_run[1]:scan=15036	49.273469	3	2131.027668	2130.025919	K	L	158	177
PSM	LGRSESLRVSDR	2247	tr|E9PUF7|E9PUF7_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=4238	17.721767	3	1453.704462	1453.703856	R	R	378	390
PSM	GLLYDSSEEDEERPAR	2248	sp|P97310|MCM2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	6-UNIMOD:21	ms_run[1]:scan=12504	41.488459	2	1944.810993	1944.810231	R	K	134	150
PSM	SQVEILASQLTGLMDMK	2249	sp|O88307|SORL_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	1-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=25206	80.586948	2	1958.906773	1958.909417	R	V	992	1009
PSM	VSEEWYNRVRITWDPPSGPVK	2250	sp|Q80X19|COEA1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	12-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=17455	55.736549	3	2677.212142	2674.198220	R	G	838	859
PSM	ASDVISDPPLPLTSKKPLTSSQLQR	2251	tr|A0A140LHH9|A0A140LHH9_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	13-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=16357	52.703225	4	2837.421278	2837.397708	K	L	780	805
PSM	EYVLLHESSDTSELDRKEDEDDEEEEMVSDS	2252	sp|Q8BIZ6|SNIP1_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	31-UNIMOD:21	ms_run[1]:scan=17931	57.019941	4	3738.480436	3738.477532	R	-	353	384
PSM	KLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQR	2253	sp|O89100|GRAP2_MOUSE	0	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	3-UNIMOD:21	ms_run[1]:scan=14602	47.965171	4	3956.922509	3956.922404	R	Y	184	218
PSM	AGAGLPQSAAQQSAPANGILVPNGFSKLEEPPELNRQSPNPR	2254	sp|E9Q1P8|I2BP2_MOUSE	1	userFasta.uniprot_mouse_20200318	userFasta.uniprot_mouse_20200318	[MS, MS:1002251, Comet, ]	13.0	38-UNIMOD:21	ms_run[1]:scan=21738	68.225789	4	4389.144234	4387.171027	R	R	132	174