MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	JPST000090 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220617\20220617210722678855^127.0.0.1^jpost@jpost.jpost\Psearch.ProteinPilotExecV5\06-120627mi-GEN-ERLIC-3.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20200318.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_SPECIAL_FACTOR=Phosphorylation emphasis
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_20200318
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=200
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_20200318
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q27J81|INF2_HUMAN	Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	51.0	null	1147-UNIMOD:21	0.02	51.0	1	1	1
PRT	sp|Q6P2E9|EDC4_HUMAN	Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	50.0	null	729-UNIMOD:21	0.02	50.0	2	1	0
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	46.0	null	804-UNIMOD:21	0.03	46.0	5	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	45.0	null	111-UNIMOD:4,102-UNIMOD:35	0.06	45.0	2	1	0
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	45.0	null		0.06	45.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	45.0	null		0.03	45.0	7	1	0
PRT	sp|Q9P0K7|RAI14_HUMAN	Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	42.0	null	327-UNIMOD:21,340-UNIMOD:21	0.03	42.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	40.0	null	125-UNIMOD:21,104-UNIMOD:4	0.11	40.0	3	1	0
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	40.0	null		0.02	40.0	1	1	1
PRT	sp|P13929|ENOB_HUMAN	Beta-enolase OS=Homo sapiens OX=9606 GN=ENO3 PE=1 SV=5	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	40.0	null	389-UNIMOD:4	0.05	40.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	39.0	null	61-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	39.0	null	154-UNIMOD:21,164-UNIMOD:21	0.04	39.0	2	1	0
PRT	sp|Q7Z309|F122B_HUMAN	Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	38.0	null	25-UNIMOD:21	0.10	38.0	2	1	0
PRT	sp|Q9P013|CWC15_HUMAN	Spliceosome-associated protein CWC15 homolog OS=Homo sapiens OX=9606 GN=CWC15 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	38.0	null	110-UNIMOD:21,121-UNIMOD:21	0.18	38.0	1	1	1
PRT	sp|Q9H813|PACC1_HUMAN	Proton-activated chloride channel OS=Homo sapiens OX=9606 GN=PACC1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	37.0	null	9-UNIMOD:21,7-UNIMOD:21	0.08	37.0	2	1	0
PRT	sp|Q8IWZ3|ANKH1_HUMAN	Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ANKHD1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	37.0	null	95-UNIMOD:21,101-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0	null	774-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	null	111-UNIMOD:4	0.06	34.0	1	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	33.0	null	1552-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q99956|DUS9_HUMAN	Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	32.0	null	328-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0	null	101-UNIMOD:21,104-UNIMOD:21	0.16	31.0	25	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	30.0	null	2610-UNIMOD:21,2606-UNIMOD:21,2607-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q13596|SNX1_HUMAN	Sorting nexin-1 OS=Homo sapiens OX=9606 GN=SNX1 PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	null	32-UNIMOD:21,39-UNIMOD:21,41-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|Q5VZ89|DEN4C_HUMAN	DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	27.0	null	999-UNIMOD:21,1000-UNIMOD:21,1003-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	null	53-UNIMOD:21,59-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q15942|ZYX_HUMAN	Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	null	143-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	null	511-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q99638|RAD9A_HUMAN	Cell cycle checkpoint control protein RAD9A OS=Homo sapiens OX=9606 GN=RAD9A PE=1 SV=1	null	null	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0	null	375-UNIMOD:21,387-UNIMOD:21	0.08	21.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DPTSLLGVLQAEADSTSEGLEDAVHSR	1	sp|Q27J81|INF2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	51.0	15-UNIMOD:21	ms_run[1]:scan=1.1.344.2	5.090633	4	2876.3596941913206	2876.307691338949	K	G	1133	1160
PSM	TRSPDVISSASTALSQDIPEIASEALSR	2	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	50.0	3-UNIMOD:21	ms_run[1]:scan=1.1.36.2	0.5497667	4	2980.4944941913204	2980.4390398616697	R	G	727	755
PSM	TRSPDVISSASTALSQDIPEIASEALSR	3	sp|Q6P2E9|EDC4_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	48.0	3-UNIMOD:21	ms_run[1]:scan=1.1.2.2	0.03613333	4	2980.4944941913204	2980.4390398616697	R	G	727	755
PSM	AALGLQDSDDEDAAVDIDEQIESMFNSK	4	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	46.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1761.3	23.4178	4	3105.3572941913203	3105.3009512759995	K	K	797	825
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	5	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	45.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3333.2	40.28185	4	2908.4848941913206	2908.4310446532595	K	N	101	130
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	6	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	45.0		ms_run[1]:scan=1.1.3433.2	41.57689	4	2934.5400941913203	2934.486233667489	R	D	133	163
PSM	TLVLSNLSYSATEETLQEVFEK	7	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	45.0		ms_run[1]:scan=1.1.77.2	1.217417	3	2500.30777064349	2500.258465578789	K	A	487	509
PSM	TLVLSNLSYSATEETLQEVFEK	8	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	44.0		ms_run[1]:scan=1.1.44.2	0.70705	3	2500.30777064349	2500.258465578789	K	A	487	509
PSM	AALGLQDSDDEDAAVDIDEQIESMFNSK	9	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	43.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1764.2	23.474	4	3105.3572941913203	3105.3009512759995	K	K	797	825
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	10	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	42.0	2-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=1.1.2330.2	30.71917	4	2924.4812941913206	2924.4259596532597	K	N	101	130
PSM	DRLSDSTTGADSLLDISSEADQQDLLSLLQAK	11	sp|Q9P0K7|RAI14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	42.0	4-UNIMOD:21	ms_run[1]:scan=1.1.711.2	10.47588	4	3484.7148941913206	3484.6457977222694	K	V	324	356
PSM	AALGLQDSDDEDAAVDIDEQIESMFNSK	12	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	41.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1801.2	23.92613	4	3105.3572941913203	3105.3009512759995	K	K	797	825
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	13	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	40.0	22-UNIMOD:21,1-UNIMOD:4	ms_run[1]:scan=1.1.3176.2	38.32665	4	3459.4924941913205	3459.42973387885	K	L	104	135
PSM	NNNIDAAIENIENMLTSENK	14	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	40.0		ms_run[1]:scan=1.1.1323.2	18.58457	3	2246.08717064349	2246.048489895889	K	V	1190	1210
PSM	SGETEDTFIADLVVGLCTGQIK	15	sp|P13929|ENOB_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	40.0	17-UNIMOD:4	ms_run[1]:scan=1.1.1744.2	23.22055	3	2352.19897064349	2352.151892614699	R	T	373	395
PSM	DRLSDSTTGADSLLDISSEADQQDLLSLLQAK	16	sp|Q9P0K7|RAI14_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	39.0	4-UNIMOD:21,17-UNIMOD:21	ms_run[1]:scan=1.1.708.3	10.39988	4	3564.68009419132	3564.6121287222695	K	V	324	356
PSM	GDSETDLEALFNAVMNPK	17	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	39.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3100.2	37.63508	3	2029.90327064349	2029.87038850833	R	T	59	77
PSM	ALENGDADEPSFSDPEDFVDDVSEEELLGDVLK	18	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	39.0	13-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.1038.3	14.60247	5	3754.5881177391498	3754.5223702280095	R	D	142	175
PSM	SSSAPLIHGLSDLSQVFQPYTLR	19	sp|Q7Z309|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	38.0	3-UNIMOD:21	ms_run[1]:scan=1.1.635.2	9.251	4	2595.3132941913204	2595.2734185370596	R	T	23	46
PSM	LDQIPAANLDADDPLTDEEDEDFEEESDDDDTAALLAELEK	20	sp|Q9P013|CWC15_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	38.0	16-UNIMOD:21,27-UNIMOD:21	ms_run[1]:scan=1.1.587.2	8.536867	6	4693.97834128698	4693.889270109961	R	I	95	136
PSM	STSYQELSEELVQVVENSELADEQDK	21	sp|Q9H813|PACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	37.0	3-UNIMOD:21	ms_run[1]:scan=1.1.1115.2	15.62583	4	3048.3812941913206	3048.3336313032696	R	E	7	33
PSM	TGGGGGASGSDEDEVSEVESFILDQEDLDNPVLK	22	sp|Q8IWZ3|ANKH1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	37.0	10-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=1.1.1762.2	23.43475	4	3624.5620941913203	3624.49173880607	R	T	86	120
PSM	AALGLQDSDDEDAAVDIDEQIESMFNSK	23	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	36.0	8-UNIMOD:21	ms_run[1]:scan=1.1.1887.2	24.96042	4	3105.3560941913206	3105.3009512759995	K	K	797	825
PSM	TLVLSNLSYSATEETLQEVFEK	24	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0		ms_run[1]:scan=1.1.120.2	1.723383	3	2500.28827064349	2500.258465578789	K	A	487	509
PSM	LVLEQVVTSIASVADTAEEK	25	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0		ms_run[1]:scan=1.1.1038.2	14.59413	3	2101.1487706434905	2101.1154301735596	K	F	507	527
PSM	TLVLSNLSYSATEETLQEVFEK	26	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0		ms_run[1]:scan=1.1.10.2	0.2068833	3	2500.30777064349	2500.258465578789	K	A	487	509
PSM	LSSSDSIGPDVTDILSDIAEEASK	27	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	35.0	6-UNIMOD:21	ms_run[1]:scan=1.1.3417.2	41.27193	3	2528.1900706434903	2528.1418548004694	R	L	769	793
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	28	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:4	ms_run[1]:scan=1.1.3446.2	41.86475	4	2911.462494	2908.431045	K	N	101	130
PSM	SPSQDFSFIEDTEILDSAMYR	29	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	33.0	1-UNIMOD:21	ms_run[1]:scan=1.1.592.2	8.654083	3	2530.1106706434903	2530.0611023819692	R	S	1552	1573
PSM	SNISPNFNFMGQLLDFER	30	sp|Q99956|DUS9_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	32.0	4-UNIMOD:21	ms_run[1]:scan=1.1.1694.2	22.53695	3	2208.0117706434903	2207.9711056091096	K	S	325	343
PSM	KEESEESDDDMGFGLFD	31	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1645.2	21.99288	3	2108.72047064349	2108.68469511068	K	-	98	115
PSM	TLVLSNLSYSATEETLQEVFEK	32	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0		ms_run[1]:scan=1.1.76.3	1.184133	4	2500.2908941913206	2500.258465578789	K	A	487	509
PSM	GDSETDLEALFNAVMNPK	33	sp|P46937|YAP1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3054.2	37.1292	3	2029.90327064349	2029.87038850833	R	T	59	77
PSM	DASIVGFFDDSFSEAHSEFLK	34	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0		ms_run[1]:scan=1.1.68.2	1.063883	3	2347.11037064349	2347.0644572298593	K	A	153	174
PSM	TLVLSNLSYSATEETLQEVFEK	35	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0		ms_run[1]:scan=1.1.213.2	3.286767	3	2500.30597064349	2500.258465578789	K	A	487	509
PSM	TLVLSNLSYSATEETLQEVFEK	36	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0		ms_run[1]:scan=1.1.189.2	2.7312	3	2500.30627064349	2500.258465578789	K	A	487	509
PSM	STSYQELSEELVQVVENSELADEQDK	37	sp|Q9H813|PACC1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	31.0	1-UNIMOD:21	ms_run[1]:scan=1.1.1118.2	15.69283	3	3048.3921706434903	3048.3336313032696	R	E	7	33
PSM	SSSFSDTLEESSPIAAIFDTENLEK	38	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	30.0	5-UNIMOD:21	ms_run[1]:scan=1.1.646.2	9.442833	4	2796.2728941913206	2796.2266470535897	R	I	2606	2631
PSM	SSSFSDTLEESSPIAAIFDTENLEK	39	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	30.0	1-UNIMOD:21,2-UNIMOD:21	ms_run[1]:scan=1.1.2134.2	28.47708	4	2876.2460941913205	2876.1929780535897	R	I	2606	2631
PSM	AALGLQDSDDEDAAVDIDEQIESMFNSK	40	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	29.0	8-UNIMOD:21	ms_run[1]:scan=1.1.3428.4	41.45292	4	3105.3572941913203	3105.3009512759995	K	K	797	825
PSM	SSSAPLIHGLSDLSQVFQPYTLR	41	sp|Q7Z309|F122B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	29.0	3-UNIMOD:21	ms_run[1]:scan=1.1.647.2	9.4688	3	2595.32467064349	2595.2734185370596	R	T	23	46
PSM	LVLEQVVTSIASVADTAEEK	42	sp|O00410|IPO5_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	29.0		ms_run[1]:scan=1.1.1074.2	15.10903	3	2101.1487706434905	2101.1154301735596	K	F	507	527
PSM	KEESEESDDDMGFGLFD	43	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	29.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.282.2	4.278767	3	2108.72047064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	44	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	29.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1961.2	25.85485	3	2108.71987064349	2108.68469511068	K	-	98	115
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	45	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	22-UNIMOD:21,1-UNIMOD:4	ms_run[1]:scan=1.1.3117.2	37.7593	4	3459.4924941913205	3459.42973387885	K	L	104	135
PSM	KEESEESDDDMGFGLFD	46	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1104.2	15.40455	3	2108.71867064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	47	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.320.2	4.788417	3	2108.71987064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	48	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3426.3	41.4104	3	2108.72137064349	2108.68469511068	K	-	98	115
PSM	ALENGDADEPSFSDPEDFVDDVSEEELLGDVLK	49	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	13-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=1.1.1171.4	16.56113	4	3754.5884941913205	3754.5223702280095	R	D	142	175
PSM	LPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSK	50	sp|Q13596|SNX1_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	28.0	19-UNIMOD:21,26-UNIMOD:21,28-UNIMOD:21	ms_run[1]:scan=1.1.8.4	0.1449	5	4352.871117739151	4352.785217582869	R	H	14	56
PSM	KEESEESDDDMGFGLFD	51	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	27.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.825.2	12.05532	3	2108.71687064349	2108.68469511068	K	-	98	115
PSM	KSSTGSISNVLFSTQDPVEDAVFGEATNLK	52	sp|Q5VZ89|DEN4C_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	27.0	2-UNIMOD:21,3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=1.1.643.3	9.378883	4	3380.5112941913203	3380.450346105189	R	K	998	1028
PSM	KEESEESDDDMGFGLFD	53	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	26.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.864.2	12.56777	3	2108.71927064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	54	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	26.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1592.2	21.46108	3	2108.72347064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	55	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	25.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3212.2	38.74518	3	2108.71627064349	2108.68469511068	K	-	98	115
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	56	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	25.0	22-UNIMOD:21,1-UNIMOD:4	ms_run[1]:scan=1.1.35.2	0.5343	4	3459.4808941913207	3459.42973387885	K	L	104	135
PSM	KEESEESDDDMGFGLFD	57	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	25.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.354.2	5.304033	3	2108.71957064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	58	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1541.2	20.84287	3	2108.71987064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	59	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1917.3	25.23603	3	2108.7210706434903	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	60	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1731.2	23.01795	3	2108.71657064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	61	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1001.2	14.0821	3	2108.7174706434903	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	62	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1870.2	24.65552	3	2108.72347064349	2108.68469511068	K	-	98	115
PSM	DASIVGFFDDSFSEAHSEFLK	63	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	24.0		ms_run[1]:scan=1.1.36.3	0.5547667	3	2347.11037064349	2347.0644572298593	K	A	153	174
PSM	KEESEESDDDMGFGLFD	64	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.648.3	9.494333	3	2108.71087064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	65	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1441.2	19.8133	3	2108.72137064349	2108.68469511068	K	-	98	115
PSM	DLPPFEDESEGLLGTEGPLEEEEDGEELIGDGMER	66	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	9-UNIMOD:21,15-UNIMOD:21	ms_run[1]:scan=1.1.251.3	3.826	4	3991.6752941913205	3991.6006972016994	R	D	45	80
PSM	KEESEESDDDMGFGLFD	67	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.75.3	1.157617	3	2108.71807064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	68	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.209.3	3.217817	3	2108.7210706434903	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	69	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3141.2	38.03785	3	2108.7228706434903	2108.68469511068	K	-	98	115
PSM	VSSIDLEIDSLSSLLDDMTK	70	sp|Q15942|ZYX_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	3-UNIMOD:21	ms_run[1]:scan=1.1.3438.3	41.70508	3	2260.08637064349	2260.0433270595095	K	N	141	161
PSM	INALTAASEAACLIVSVDETIK	71	sp|Q99832|TCPH_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	23.0	12-UNIMOD:4	ms_run[1]:scan=1.1.3433.3	41.58022	3	2288.23777064349	2288.1933635038595	R	N	500	522
PSM	KEESEESDDDMGFGLFD	72	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1776.2	23.58763	3	2108.71987064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	73	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.1392.2	19.30627	3	2108.72047064349	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	74	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.3067.2	37.26517	3	2108.7237706434903	2108.68469511068	K	-	98	115
PSM	KEESEESDDDMGFGLFD	75	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	22.0	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=1.1.390.2	5.843517	3	2108.71957064349	2108.68469511068	K	-	98	115
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	76	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0		ms_run[1]:scan=1.1.3436.3	41.65387	4	2867.6268941913204	2867.5743203958996	R	D	527	555
PSM	SLFFGSILAPVRSPQGPSPVLAEDSEGEG	77	sp|Q99638|RAD9A_HUMAN	1	userFasta.sprot_human_20200318	userFasta.sprot_human_20200318	[MS, MS:1000663, ProteinPilot, ]	21.0	13-UNIMOD:21,25-UNIMOD:21	ms_run[1]:scan=1.1.183.2	2.581733	4	3102.4500941913207	3102.39882892925	R	-	363	392