MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	PXD018117 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220821\20220821021939579274^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\qx017091.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220821\20220821021939579274^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\qx017091.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.corona-human-egfp-20220819
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.corona-human-egfp-20220819
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.corona-human-egfp-20220819
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	Q3562R	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	81.0	null	3408-UNIMOD:4,3419-UNIMOD:4,3423-UNIMOD:4,3425-UNIMOD:35,3428-UNIMOD:35,3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35,3307-UNIMOD:4,3312-UNIMOD:35,3279-UNIMOD:4,3280-UNIMOD:35,3285-UNIMOD:4,3301-UNIMOD:4,3533-UNIMOD:27	0.04	81.0	54	7	1
PRT	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	R207C,P2965L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	68.0	null	3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35,3307-UNIMOD:4,3312-UNIMOD:35,3279-UNIMOD:4,3285-UNIMOD:4,3301-UNIMOD:4,3280-UNIMOD:35,3528-UNIMOD:4,4299-UNIMOD:4,4326-UNIMOD:4,4327-UNIMOD:4,4330-UNIMOD:4,3527-UNIMOD:35,4356-UNIMOD:4,3498-UNIMOD:35,3348-UNIMOD:4,3345-UNIMOD:35,4294-UNIMOD:4,4213-UNIMOD:4,3269-UNIMOD:35,3539-UNIMOD:35,4381-UNIMOD:4,4383-UNIMOD:4	0.08	68.0	497	28	8
PRT	cov|corona00001|ORF1a_Wuhan/WH01/2019	L2235I,N3833K	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	63.0	null	3528-UNIMOD:4,3307-UNIMOD:4,3312-UNIMOD:35,3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35,3279-UNIMOD:4,3285-UNIMOD:4,3301-UNIMOD:4,3527-UNIMOD:35,4154-UNIMOD:4,4163-UNIMOD:4,3280-UNIMOD:35,3498-UNIMOD:35,4213-UNIMOD:4,3348-UNIMOD:4,3345-UNIMOD:35,3269-UNIMOD:35,3539-UNIMOD:35	0.06	63.0	270	16	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	61.0	null	363-UNIMOD:4,370-UNIMOD:4,111-UNIMOD:4,411-UNIMOD:4,276-UNIMOD:35	0.57	61.0	36	16	7
PRT	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	C3419F	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	57.0	null	3408-UNIMOD:4,3423-UNIMOD:4,3425-UNIMOD:35,3428-UNIMOD:35	0.01	57.0	7	1	0
PRT	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	I3522V,G4177E	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	56.0	null	3528-UNIMOD:4,3527-UNIMOD:35	0.01	56.0	29	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	54.0	null		0.10	54.0	5	3	1
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	53.0	null	106-UNIMOD:4,46-UNIMOD:4,53-UNIMOD:4,26-UNIMOD:35,134-UNIMOD:35	0.67	53.0	21	11	5
PRT	sp|Q71UI9|H2AV_HUMAN	Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	52.0	null		0.23	52.0	1	1	0
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	51.0	null	97-UNIMOD:4,134-UNIMOD:4	0.73	51.0	18	15	12
PRT	sp|P11498|PYC_HUMAN	Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	50.0	null	752-UNIMOD:4,131-UNIMOD:4,850-UNIMOD:4,78-UNIMOD:28,622-UNIMOD:4,739-UNIMOD:4	0.49	50.0	52	37	26
PRT	sp|Q71UI9-2|H2AV_HUMAN	Isoform 2 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	null		0.26	50.0	1	1	0
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	43-UNIMOD:4,95-UNIMOD:4	0.78	49.0	18	11	6
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	49.0	null	2-UNIMOD:1,125-UNIMOD:4,460-UNIMOD:4,109-UNIMOD:4	0.41	49.0	20	14	7
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	49.0	null	45-UNIMOD:4,81-UNIMOD:35,82-UNIMOD:4,85-UNIMOD:4,87-UNIMOD:4,94-UNIMOD:4,212-UNIMOD:385,212-UNIMOD:4,215-UNIMOD:4,280-UNIMOD:4,283-UNIMOD:4,292-UNIMOD:4	0.30	49.0	9	6	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	48.0	null	201-UNIMOD:4,158-UNIMOD:4,109-UNIMOD:4,137-UNIMOD:35	0.31	48.0	9	5	3
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	null	505-UNIMOD:4,506-UNIMOD:4,509-UNIMOD:4	0.09	47.0	2	2	2
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	null	478-UNIMOD:4	0.17	47.0	10	8	5
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	603-UNIMOD:4,574-UNIMOD:4,306-UNIMOD:4,87-UNIMOD:35	0.46	47.0	34	19	9
PRT	sp|Q9Y383|LC7L2_HUMAN	Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	47.0	null	43-UNIMOD:4,44-UNIMOD:4,190-UNIMOD:4,193-UNIMOD:4,15-UNIMOD:35,177-UNIMOD:35,348-UNIMOD:4,59-UNIMOD:4,2-UNIMOD:1	0.42	47.0	29	15	10
PRT	sp|Q8WVK2|SNR27_HUMAN	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP27 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	103-UNIMOD:35,104-UNIMOD:35	0.31	46.0	7	4	2
PRT	sp|Q15366-4|PCBP2_HUMAN	Isoform 4 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	null	109-UNIMOD:4,54-UNIMOD:4	0.34	46.0	9	7	5
PRT	sp|Q96RQ3|MCCA_HUMAN	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	null	190-UNIMOD:4	0.11	46.0	5	4	3
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	295-UNIMOD:4,376-UNIMOD:4,315-UNIMOD:4,316-UNIMOD:4	0.52	46.0	23	17	11
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	46.0	null	634-UNIMOD:4,1769-UNIMOD:4,500-UNIMOD:4,1297-UNIMOD:4	0.25	46.0	49	38	28
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	null	448-UNIMOD:4	0.30	46.0	8	7	5
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	17-UNIMOD:4,61-UNIMOD:35,549-UNIMOD:35,93-UNIMOD:35	0.43	45.0	29	20	14
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null		0.38	45.0	12	9	6
PRT	sp|O75940|SPF30_HUMAN	Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.17	44.0	2	2	2
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	28-UNIMOD:4,60-UNIMOD:35	0.37	44.0	10	5	3
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	null	74-UNIMOD:4,80-UNIMOD:35	0.43	44.0	8	5	2
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	246-UNIMOD:4,69-UNIMOD:4	0.13	44.0	6	6	6
PRT	sp|P26368|U2AF2_HUMAN	Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0	null	429-UNIMOD:4	0.17	44.0	4	3	1
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null	90-UNIMOD:35,63-UNIMOD:35	0.52	43.0	12	8	4
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	43.0	null		0.07	43.0	6	4	3
PRT	sp|O95232|LC7L3_HUMAN	Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	null	1-UNIMOD:1,40-UNIMOD:4,43-UNIMOD:4	0.28	43.0	12	10	8
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	null	425-UNIMOD:4,2-UNIMOD:1,460-UNIMOD:4	0.42	43.0	17	12	6
PRT	sp|O75955|FLOT1_HUMAN	Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	209-UNIMOD:4,305-UNIMOD:4	0.36	43.0	20	13	7
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	152-UNIMOD:4,156-UNIMOD:4,247-UNIMOD:4	0.25	42.0	6	5	4
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	2-UNIMOD:1,69-UNIMOD:4,106-UNIMOD:4,108-UNIMOD:4,50-UNIMOD:4,56-UNIMOD:4,60-UNIMOD:35,92-UNIMOD:4	0.67	41.0	8	6	4
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	2	2	2
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	null	2-UNIMOD:1,637-UNIMOD:4	0.22	41.0	10	10	10
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	44-UNIMOD:4	0.51	41.0	16	11	7
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.29	41.0	11	10	9
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	295-UNIMOD:4,298-UNIMOD:4,311-UNIMOD:4,2-UNIMOD:1,890-UNIMOD:35	0.41	41.0	44	28	19
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.36	41.0	10	7	5
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.07	40.0	3	3	3
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	null	296-UNIMOD:4	0.21	40.0	5	4	3
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	35-UNIMOD:4	0.61	40.0	11	8	5
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.08	40.0	1	1	1
PRT	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	Y3074H,P3371S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	null	3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35	0.01	40.0	8	2	1
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	null	121-UNIMOD:4,126-UNIMOD:4,132-UNIMOD:35,144-UNIMOD:4,145-UNIMOD:4,149-UNIMOD:4	0.22	39.0	4	2	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	357-UNIMOD:4	0.26	39.0	8	7	6
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	696-UNIMOD:4,501-UNIMOD:4	0.09	39.0	9	6	3
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	1-UNIMOD:1,3-UNIMOD:4	0.60	39.0	8	4	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	290-UNIMOD:4,22-UNIMOD:4	0.25	39.0	7	6	4
PRT	sp|P61513|RL37A_HUMAN	60S ribosomal protein L37a OS=Homo sapiens OX=9606 GN=RPL37A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	39.0	null	57-UNIMOD:4,60-UNIMOD:4	0.53	39.0	6	4	3
PRT	sp|P32121|ARRB2_HUMAN	Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	252-UNIMOD:4,270-UNIMOD:4,126-UNIMOD:4,409-UNIMOD:4	0.29	38.0	6	6	6
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	51-UNIMOD:4	0.46	38.0	12	6	2
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	608-UNIMOD:4	0.31	38.0	21	15	9
PRT	sp|Q96EY4|TMA16_HUMAN	Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	162-UNIMOD:4	0.25	38.0	6	4	3
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	140-UNIMOD:35	0.45	38.0	19	10	5
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1-UNIMOD:1	0.14	38.0	5	5	5
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	132-UNIMOD:35	0.32	38.0	18	7	2
PRT	sp|Q7L7L0|H2A3_HUMAN	Histone H2A type 3 OS=Homo sapiens OX=9606 GN=H2AW PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.29	38.0	6	3	1
PRT	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	T350I,F1979L,S2900L,L3313F	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	3307-UNIMOD:4,3312-UNIMOD:35	0.00	38.0	13	2	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	115-UNIMOD:4	0.53	38.0	12	8	5
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.10	37.0	3	2	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	181-UNIMOD:4,41-UNIMOD:4	0.59	37.0	20	16	13
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null	452-UNIMOD:4,282-UNIMOD:4	0.22	37.0	10	10	10
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.21	37.0	5	4	3
PRT	sp|P05204|HMGN2_HUMAN	Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.36	37.0	5	3	2
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	170-UNIMOD:4,234-UNIMOD:4,253-UNIMOD:35,200-UNIMOD:4	0.36	37.0	24	20	15
PRT	sp|Q01081|U2AF1_HUMAN	Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null	2-UNIMOD:1,169-UNIMOD:4,18-UNIMOD:4,163-UNIMOD:4	0.33	37.0	8	6	4
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	37.0	null		0.20	37.0	7	4	2
PRT	sp|Q86Y79|PTH_HUMAN	Probable peptidyl-tRNA hydrolase OS=Homo sapiens OX=9606 GN=PTRH1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	null		0.12	37.0	1	1	1
PRT	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	S3384T	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	null	3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35	0.01	37.0	8	2	0
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	59-UNIMOD:4,1-UNIMOD:1,1-UNIMOD:35	0.66	36.0	7	4	2
PRT	sp|Q96EP5-2|DAZP1_HUMAN	Isoform 2 of DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.18	36.0	10	9	8
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	160-UNIMOD:4,161-UNIMOD:4	0.22	36.0	7	6	5
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.54	36.0	9	9	9
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.27	36.0	2	1	0
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	2-UNIMOD:1	0.19	36.0	5	4	2
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	73-UNIMOD:35,239-UNIMOD:4,354-UNIMOD:4,330-UNIMOD:35	0.47	36.0	19	13	7
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	null	303-UNIMOD:4	0.06	36.0	2	2	2
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.49	36.0	15	11	8
PRT	sp|Q9BQ69|MACD1_HUMAN	ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	584-UNIMOD:4,247-UNIMOD:4,447-UNIMOD:4	0.16	35.0	10	8	5
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	null	151-UNIMOD:4	0.16	35.0	4	2	1
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	null	127-UNIMOD:4,129-UNIMOD:4	0.08	35.0	1	1	1
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	null	199-UNIMOD:4	0.08	35.0	1	1	1
PRT	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	N3405S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	35.0	null	3408-UNIMOD:4,3419-UNIMOD:4,3423-UNIMOD:4,3425-UNIMOD:35	0.01	35.0	7	1	0
PRT	cov|corona01611|ORF1a_Bulgaria/24/2020	S2151G,Y3502C	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	3502-UNIMOD:4,3528-UNIMOD:4	0.01	35.0	8	1	0
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	35.0	null	121-UNIMOD:4,128-UNIMOD:4	0.13	35.0	3	3	3
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1,281-UNIMOD:4,299-UNIMOD:35	0.27	34.0	15	12	9
PRT	sp|Q66PJ3-2|AR6P4_HUMAN	Isoform 2 of ADP-ribosylation factor-like protein 6-interacting protein 4 OS=Homo sapiens OX=9606 GN=ARL6IP4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.42	34.0	4	3	2
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.08	34.0	2	2	2
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.23	34.0	6	6	5
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	25-UNIMOD:4	0.55	34.0	11	5	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.11	34.0	7	6	5
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=H1-4 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.35	34.0	12	10	6
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.24	34.0	7	5	3
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.23	34.0	7	6	5
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.09	34.0	4	3	2
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	54-UNIMOD:4	0.41	34.0	3	3	2
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	34.0	null	32-UNIMOD:4,35-UNIMOD:4,73-UNIMOD:4	0.69	34.0	11	6	4
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.30	34.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	60-UNIMOD:35	0.38	33.0	12	5	2
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.10	33.0	2	2	2
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.14	33.0	2	2	2
PRT	sp|Q9HCC0|MCCB_HUMAN	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	48-UNIMOD:28,49-UNIMOD:35	0.19	33.0	10	8	6
PRT	sp|O00763-3|ACACB_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	5	5	4
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	13-UNIMOD:35,23-UNIMOD:4,132-UNIMOD:35	0.32	33.0	14	7	2
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	92-UNIMOD:4,52-UNIMOD:4	0.45	33.0	10	6	4
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	73-UNIMOD:4	0.26	33.0	4	3	2
PRT	sp|P60002|ELOF1_HUMAN	Transcription elongation factor 1 homolog OS=Homo sapiens OX=9606 GN=ELOF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	26-UNIMOD:4,29-UNIMOD:4	0.23	33.0	2	1	0
PRT	sp|A6NMY6|AXA2L_HUMAN	Putative annexin A2-like protein OS=Homo sapiens OX=9606 GN=ANXA2P2 PE=5 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q9NQ29-2|LUC7L_HUMAN	Isoform 2 of Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:4,44-UNIMOD:4,59-UNIMOD:4	0.13	33.0	4	3	2
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	222-UNIMOD:4,229-UNIMOD:4	0.28	33.0	11	7	4
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.32	33.0	4	3	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	0
PRT	sp|P84103|SRSF3_HUMAN	Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	null		0.13	33.0	1	1	0
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.10	32.0	2	2	2
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null	12-UNIMOD:4	0.04	32.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	83-UNIMOD:4	0.52	32.0	5	3	1
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.17	32.0	5	3	1
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	159-UNIMOD:4,205-UNIMOD:4	0.40	32.0	14	11	8
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.27	32.0	2	2	2
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.51	32.0	11	8	6
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	139-UNIMOD:4,2-UNIMOD:1,39-UNIMOD:4	0.51	32.0	7	6	5
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null	703-UNIMOD:4,617-UNIMOD:4,720-UNIMOD:4	0.17	32.0	9	9	8
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.32	32.0	4	4	4
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	439-UNIMOD:4	0.03	32.0	2	1	0
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.52	32.0	4	4	4
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.18	32.0	3	3	3
PRT	sp|P00747|PLMN_HUMAN	Plasminogen OS=Homo sapiens OX=9606 GN=PLG PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	null	426-UNIMOD:4,316-UNIMOD:4	0.03	32.0	2	2	2
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.18	32.0	4	2	0
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	1	0
PRT	cov|corona03602|ORF1a_USA/FL-BPHL-0381/2020	T265I,T3308I	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	3307-UNIMOD:4,3312-UNIMOD:35,3279-UNIMOD:4,3285-UNIMOD:4,3301-UNIMOD:4	0.01	32.0	5	3	2
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	5	4	3
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.39	31.0	5	4	3
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.21	31.0	5	2	0
PRT	sp|Q8TA86|RP9_HUMAN	Retinitis pigmentosa 9 protein OS=Homo sapiens OX=9606 GN=RP9 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.29	31.0	10	6	3
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1,504-UNIMOD:4,505-UNIMOD:4	0.09	31.0	7	4	2
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.20	31.0	7	6	5
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.07	31.0	3	2	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	100-UNIMOD:4	0.26	31.0	4	4	4
PRT	sp|P29372-4|3MG_HUMAN	Isoform 3 of DNA-3-methyladenine glycosylase OS=Homo sapiens OX=9606 GN=MPG	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	217-UNIMOD:4,56-UNIMOD:4	0.32	31.0	7	7	6
PRT	sp|P82912-3|RT11_HUMAN	Isoform 3 of 28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	2	2	2
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	3	3	2
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.32	31.0	7	6	5
PRT	sp|O00244|ATOX1_HUMAN	Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	41-UNIMOD:4	0.41	31.0	4	2	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	93-UNIMOD:4	0.09	31.0	2	2	2
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.24	31.0	6	4	2
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	null	758-UNIMOD:4	0.05	31.0	3	3	2
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|Q8N9Q2|SR1IP_HUMAN	Protein SREK1IP1 OS=Homo sapiens OX=9606 GN=SREK1IP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	18-UNIMOD:4,28-UNIMOD:4,2-UNIMOD:1,6-UNIMOD:4,18-UNIMOD:385	0.31	31.0	9	5	4
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.23	30.0	8	5	3
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.27	30.0	5	4	3
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	167-UNIMOD:4,122-UNIMOD:4	0.41	30.0	9	7	5
PRT	sp|Q8IWS0-3|PHF6_HUMAN	Isoform 3 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	82-UNIMOD:4,85-UNIMOD:4,87-UNIMOD:4,94-UNIMOD:4,304-UNIMOD:4,279-UNIMOD:4,282-UNIMOD:4,291-UNIMOD:4,107-UNIMOD:4,211-UNIMOD:4,214-UNIMOD:4,128-UNIMOD:4,28-UNIMOD:4	0.43	30.0	17	12	5
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.56	30.0	14	9	5
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	30.0	null	161-UNIMOD:4	0.22	30.0	10	8	6
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.32	30.0	3	3	3
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	15-UNIMOD:4	0.15	30.0	6	6	6
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	96-UNIMOD:4	0.11	30.0	4	3	2
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.05	30.0	3	2	1
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.36	30.0	3	3	3
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	85-UNIMOD:35	0.59	30.0	14	8	5
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.21	30.0	2	2	2
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	null		0.07	30.0	2	2	2
PRT	sp|P05165|PCCA_HUMAN	Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	null	363-UNIMOD:4	0.03	30.0	2	1	0
PRT	sp|P20671|H2A1D_HUMAN	Histone H2A type 1-D OS=Homo sapiens OX=9606 GN=H2AC7 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	null		0.09	30.0	1	1	1
PRT	sp|Q9UI43|MRM2_HUMAN	rRNA methyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MRM2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:4	0.26	30.0	7	4	1
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.14	29.0	3	3	2
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	2	2
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.15	29.0	6	4	2
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	131-UNIMOD:4,60-UNIMOD:4,116-UNIMOD:4	0.44	29.0	6	6	6
PRT	sp|P62906|RL10A_HUMAN	60S ribosomal protein L10a OS=Homo sapiens OX=9606 GN=RPL10A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	66-UNIMOD:4,74-UNIMOD:4	0.20	29.0	3	3	3
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.34	29.0	5	4	3
PRT	sp|Q9Y237|PIN4_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens OX=9606 GN=PIN4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.44	29.0	4	4	4
PRT	sp|P63173|RL38_HUMAN	60S ribosomal protein L38 OS=Homo sapiens OX=9606 GN=RPL38 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.56	29.0	16	5	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.25	29.0	7	5	3
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q92769-3|HDAC2_HUMAN	Isoform 2 of Histone deacetylase 2 OS=Homo sapiens OX=9606 GN=HDAC2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	3	3	3
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	147-UNIMOD:4	0.13	29.0	2	2	2
PRT	sp|Q01130|SRSF2_HUMAN	Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.08	29.0	3	1	0
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.15	29.0	3	3	3
PRT	sp|Q5VTL8|PR38B_HUMAN	Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	113-UNIMOD:4	0.15	29.0	9	7	5
PRT	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	L730F,I3369S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	null	3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35	0.01	29.0	7	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	651-UNIMOD:4,781-UNIMOD:35	0.12	29.0	9	7	5
PRT	sp|O43684|BUB3_HUMAN	Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	3	1	0
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	257-UNIMOD:4	0.24	28.0	8	6	4
PRT	sp|P62854|RS26_HUMAN	40S ribosomal protein S26 OS=Homo sapiens OX=9606 GN=RPS26 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	74-UNIMOD:4,77-UNIMOD:4	0.25	28.0	2	2	2
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	27-UNIMOD:4	0.36	28.0	2	2	2
PRT	sp|Q9BYB4|GNB1L_HUMAN	Guanine nucleotide-binding protein subunit beta-like protein 1 OS=Homo sapiens OX=9606 GN=GNB1L PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.14	28.0	3	3	3
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.20	28.0	5	3	2
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	141-UNIMOD:4,162-UNIMOD:4	0.38	28.0	5	4	3
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	2	2	2
PRT	sp|Q9NP64-2|NO40_HUMAN	Isoform 2 of Nucleolar protein of 40 kDa OS=Homo sapiens OX=9606 GN=ZCCHC17	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	109-UNIMOD:4	0.21	28.0	4	4	4
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.25	28.0	8	4	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.23	28.0	5	5	5
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	96-UNIMOD:4,139-UNIMOD:4	0.30	28.0	7	7	7
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	2-UNIMOD:1	0.23	28.0	2	2	2
PRT	sp|P36969-2|GPX4_HUMAN	Isoform Cytoplasmic of Phospholipid hydroperoxide glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.29	28.0	3	3	3
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	172-UNIMOD:4,66-UNIMOD:4	0.13	28.0	3	2	1
PRT	sp|P62913|RL11_HUMAN	60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	2-UNIMOD:1,21-UNIMOD:4,25-UNIMOD:4,150-UNIMOD:4,72-UNIMOD:4	0.51	28.0	12	10	8
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.40	28.0	7	6	5
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null		0.29	28.0	6	5	4
PRT	sp|Q15417|CNN3_HUMAN	Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	null		0.06	28.0	2	1	0
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	4	2	1
PRT	sp|Q9NS86|LANC2_HUMAN	LanC-like protein 2 OS=Homo sapiens OX=9606 GN=LANCL2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1	0.03	27.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	6-UNIMOD:4	0.29	27.0	5	4	3
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	115-UNIMOD:4,115-UNIMOD:385	0.23	27.0	7	3	2
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	2	1	0
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	47-UNIMOD:4	0.14	27.0	2	2	2
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.32	27.0	6	6	6
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	72-UNIMOD:4,77-UNIMOD:4,88-UNIMOD:4	0.30	27.0	6	5	4
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	3	1	0
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.19	27.0	5	2	1
PRT	sp|P05165-3|PCCA_HUMAN	Isoform 3 of Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	4	4	4
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.12	27.0	3	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	328-UNIMOD:4	0.24	27.0	10	9	8
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	99-UNIMOD:4,102-UNIMOD:4,108-UNIMOD:4	0.17	27.0	4	4	4
PRT	sp|Q86WX3|AROS_HUMAN	Active regulator of SIRT1 OS=Homo sapiens OX=9606 GN=RPS19BP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P35030-5|TRY3_HUMAN	Isoform 5 of Trypsin-3 OS=Homo sapiens OX=9606 GN=PRSS3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	0
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	164-UNIMOD:4	0.09	27.0	3	2	1
PRT	sp|Q99986|VRK1_HUMAN	Serine/threonine-protein kinase VRK1 OS=Homo sapiens OX=9606 GN=VRK1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	123-UNIMOD:4,133-UNIMOD:4,94-UNIMOD:4,102-UNIMOD:4,105-UNIMOD:4,40-UNIMOD:4,141-UNIMOD:4	0.34	26.0	5	5	5
PRT	sp|Q9H2K0|IF3M_HUMAN	Translation initiation factor IF-3, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	25-UNIMOD:4	0.52	26.0	15	9	3
PRT	sp|Q70Z53-2|F10C1_HUMAN	Isoform 2 of Protein FRA10AC1 OS=Homo sapiens OX=9606 GN=FRA10AC1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	2	2	2
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	198-UNIMOD:4	0.09	26.0	4	4	4
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.26	26.0	4	3	2
PRT	sp|Q9P016|THYN1_HUMAN	Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	118-UNIMOD:4	0.17	26.0	2	2	2
PRT	sp|P49458-2|SRP09_HUMAN	Isoform 2 of Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:4	0.27	26.0	2	2	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	RNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.35	26.0	9	7	5
PRT	sp|P61956-2|SUMO2_HUMAN	Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.18	26.0	1	1	1
PRT	sp|Q9UM13|APC10_HUMAN	Anaphase-promoting complex subunit 10 OS=Homo sapiens OX=9606 GN=ANAPC10 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.18	26.0	2	2	2
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.18	26.0	4	3	2
PRT	sp|P15531-2|NDKA_HUMAN	Isoform 2 of Nucleoside diphosphate kinase A OS=Homo sapiens OX=9606 GN=NME1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	cov|corona06418|ORF1a_Russia/Krasnodar-80902/2020	P3395L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null	3380-UNIMOD:4,3391-UNIMOD:4,3393-UNIMOD:35	0.01	26.0	4	1	0
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null	145-UNIMOD:4	0.06	26.0	2	2	1
PRT	sp|P38159|RBMX_HUMAN	RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.09	26.0	3	3	1
PRT	sp|Q02978|M2OM_HUMAN	Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.05	26.0	1	1	1
PRT	cov|corona02321|ORF1a_Canada/NB-233/2020	G3278S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null	3279-UNIMOD:4,3285-UNIMOD:4,3301-UNIMOD:4,3280-UNIMOD:35	0.01	26.0	3	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	311-UNIMOD:4	0.06	25.0	2	2	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.15	25.0	3	3	3
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	109-UNIMOD:4	0.14	25.0	2	2	2
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	110-UNIMOD:4	0.19	25.0	7	3	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	126-UNIMOD:4	0.16	25.0	4	4	4
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q07666-3|KHDR1_HUMAN	Isoform 3 of KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	2	2	2
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.36	25.0	8	6	4
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.17	25.0	2	2	2
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q15560-2|TCEA2_HUMAN	Isoform 2 of Transcription elongation factor A protein 2 OS=Homo sapiens OX=9606 GN=TCEA2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	234-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q02539|H11_HUMAN	Histone H1.1 OS=Homo sapiens OX=9606 GN=H1-1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	1	1	0
PRT	sp|P29372|3MG_HUMAN	DNA-3-methyladenine glycosylase OS=Homo sapiens OX=9606 GN=MPG PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	39-UNIMOD:4	0.66	25.0	5	4	3
PRT	sp|P42766|RL35_HUMAN	60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.20	25.0	3	2	1
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null	251-UNIMOD:4,255-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|Q6P1X5|TAF2_HUMAN	Transcription initiation factor TFIID subunit 2 OS=Homo sapiens OX=9606 GN=TAF2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P22102|PUR2_HUMAN	Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null	62-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q5MNZ6|WIPI3_HUMAN	WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P62913-2|RL11_HUMAN	Isoform 2 of 60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1	0.07	24.0	2	1	0
PRT	sp|Q8N5F7|NKAP_HUMAN	NF-kappa-B-activating protein OS=Homo sapiens OX=9606 GN=NKAP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	3	3	3
PRT	sp|Q15637-4|SF01_HUMAN	Isoform 4 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,279-UNIMOD:4	0.09	24.0	5	4	3
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	2	2	2
PRT	sp|P26196|DDX6_HUMAN	Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens OX=9606 GN=DDX6 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q96E11-8|RRFM_HUMAN	Isoform 8 of Ribosome-recycling factor, mitochondrial OS=Homo sapiens OX=9606 GN=MRRF	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.16	24.0	3	3	3
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.30	24.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	438-UNIMOD:4	0.05	24.0	5	5	5
PRT	sp|Q3MHD2|LSM12_HUMAN	Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	2	1	0
PRT	sp|Q9BRJ7|TIRR_HUMAN	Tudor-interacting repair regulator protein OS=Homo sapiens OX=9606 GN=NUDT16L1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.18	24.0	3	3	3
PRT	sp|O15042|SR140_HUMAN	U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.09	24.0	10	7	4
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	2	2	2
PRT	sp|A6NHQ2|FBLL1_HUMAN	rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1 OS=Homo sapiens OX=9606 GN=FBLL1 PE=3 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null	129-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q5BKY9|F133B_HUMAN	Protein FAM133B OS=Homo sapiens OX=9606 GN=FAM133B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.21	24.0	5	4	3
PRT	sp|P17066|HSP76_HUMAN	Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q6P5R6|RL22L_HUMAN	60S ribosomal protein L22-like 1 OS=Homo sapiens OX=9606 GN=RPL22L1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|P13797|PLST_HUMAN	Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|A0A0U1RRE5|NBDY_HUMAN	Negative regulator of P-body association OS=Homo sapiens OX=9606 GN=NBDY PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.41	24.0	1	1	1
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null	347-UNIMOD:4	0.09	24.0	3	3	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9Y388|RBMX2_HUMAN	RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	3	2	1
PRT	sp|Q16630|CPSF6_HUMAN	Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null	30-UNIMOD:4	0.10	24.0	1	1	1
PRT	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	I3512T	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null	3528-UNIMOD:4,3527-UNIMOD:35	0.01	24.0	6	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	2	2	2
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1	0.04	23.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q07955|SRSF1_HUMAN	Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	148-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9BSH4|TACO1_HUMAN	Translational activator of cytochrome c oxidase 1 OS=Homo sapiens OX=9606 GN=TACO1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|P18124|RL7_HUMAN	60S ribosomal protein L7 OS=Homo sapiens OX=9606 GN=RPL7 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q6P087-2|RUSD3_HUMAN	Isoform 2 of Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.10	23.0	2	2	2
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	12-UNIMOD:4	0.22	23.0	8	5	2
PRT	sp|Q9UBV8|PEF1_HUMAN	Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	2	2	2
PRT	sp|Q96EI5|TCAL4_HUMAN	Transcription elongation factor A protein-like 4 OS=Homo sapiens OX=9606 GN=TCEAL4 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	2	2	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	244-UNIMOD:4	0.21	23.0	6	6	6
PRT	sp|P63208|SKP1_HUMAN	S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9NSD9-2|SYFB_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.15	23.0	5	5	5
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.26	23.0	2	2	2
PRT	cov|corona11687|ORF1a_USA/OR-PROV-075/2020	V3298A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null	3279-UNIMOD:4,3285-UNIMOD:4,3301-UNIMOD:4	0.01	23.0	3	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	211-UNIMOD:4	0.05	23.0	2	2	2
PRT	sp|Q6KC79|NIPBL_HUMAN	Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.00	23.0	1	1	0
PRT	sp|Q6DCA0|AMERL_HUMAN	AMMECR1-like protein OS=Homo sapiens OX=9606 GN=AMMECR1L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null	153-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|O75694|NU155_HUMAN	Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null	1344-UNIMOD:4	0.01	23.0	1	1	1
PRT	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	E269D,Y1418N,Y1700*,H3304P,L3313H,K3630T,L3679I	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	3307-UNIMOD:4,3312-UNIMOD:35	0.00	23.0	27	2	0
PRT	sp|Q86UK7-2|ZN598_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P35080-2|PROF2_HUMAN	Isoform IIb of Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|Q8WXX5|DNJC9_HUMAN	DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	2	1	0
PRT	sp|P49674|KC1E_HUMAN	Casein kinase I isoform epsilon OS=Homo sapiens OX=9606 GN=CSNK1E PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.24	22.0	7	7	6
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	258-UNIMOD:4	0.06	22.0	2	2	2
PRT	sp|P48730-2|KC1D_HUMAN	Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O14757-2|CHK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	2	1	0
PRT	sp|Q99729-3|ROAA_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein A/B OS=Homo sapiens OX=9606 GN=HNRNPAB	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9UNZ5|L10K_HUMAN	Leydig cell tumor 10 kDa protein homolog OS=Homo sapiens OX=9606 GN=C19orf53 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	2	2	2
PRT	sp|Q2NL82|TSR1_HUMAN	Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9NXE8|CWC25_HUMAN	Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens OX=9606 GN=CWC25 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	2	2	2
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	299-UNIMOD:4,176-UNIMOD:4	0.16	22.0	7	7	7
PRT	sp|Q59GN2|R39L5_HUMAN	Putative 60S ribosomal protein L39-like 5 OS=Homo sapiens OX=9606 GN=RPL39P5 PE=5 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.22	22.0	1	1	1
PRT	sp|P56270-3|MAZ_HUMAN	Isoform 3 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	316-UNIMOD:4,319-UNIMOD:4	0.10	22.0	5	3	1
PRT	cov|corona10526|ORF1a_Switzerland/180003_484_B08/2020	G3334S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	2	2	2
PRT	sp|Q9Y421-3|FA32A_HUMAN	Isoform 3 of Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.11	22.0	1	1	0
PRT	sp|P54652|HSP72_HUMAN	Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P56270|MAZ_HUMAN	Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	0
PRT	sp|P68036|UB2L3_HUMAN	Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null	86-UNIMOD:4	0.12	22.0	1	1	0
PRT	sp|O00541|PESC_HUMAN	Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	0
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	2	2	2
PRT	sp|O75340|PDCD6_HUMAN	Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null	69-UNIMOD:4	0.22	22.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.15	22.0	2	1	0
PRT	sp|Q9P0P8|MRES1_HUMAN	Mitochondrial transcription rescue factor 1 OS=Homo sapiens OX=9606 GN=MTRES1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	0
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P53350|PLK1_HUMAN	Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.22	21.0	3	3	3
PRT	sp|Q9BU76-2|MMTA2_HUMAN	Isoform 2 of Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	58-UNIMOD:4	0.20	21.0	2	2	2
PRT	sp|Q92499-3|DDX1_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y2S6|TMA7_HUMAN	Translation machinery-associated protein 7 OS=Homo sapiens OX=9606 GN=TMA7 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	22-UNIMOD:35	0.34	21.0	5	3	1
PRT	sp|P62993|GRB2_HUMAN	Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.11	21.0	2	2	2
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|O14965|AURKA_HUMAN	Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.09	21.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.18	21.0	3	2	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	3	3	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	2	2	2
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.08	21.0	2	2	2
PRT	sp|Q9HD42|CHM1A_HUMAN	Charged multivesicular body protein 1a OS=Homo sapiens OX=9606 GN=CHMP1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	1-UNIMOD:1	0.10	21.0	2	2	2
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.23	21.0	5	4	3
PRT	sp|Q9Y6V7|DDX49_HUMAN	Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens OX=9606 GN=DDX49 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	2	2	2
PRT	cov|corona04688|ORF1a_India/GBRC25/2020	L3338F	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.00	21.0	1	1	0
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	4	3	2
PRT	sp|Q15717|ELAV1_HUMAN	ELAV-like protein 1 OS=Homo sapiens OX=9606 GN=ELAVL1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	2	1	0
PRT	sp|Q9NSD9|SYFB_HUMAN	Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.02	21.0	1	1	0
PRT	sp|Q6P087|RUSD3_HUMAN	Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null	172-UNIMOD:4	0.07	21.0	1	1	1
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null	1828-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q96J01|THOC3_HUMAN	THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,25-UNIMOD:4	0.09	21.0	1	1	1
PRT	cov|corona07730|ORF1a_Croatia/8U-S17new/2020	V3276I	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null	3279-UNIMOD:4,3285-UNIMOD:4,3301-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|P62995-3|TRA2B_HUMAN	Isoform 3 of Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	3	3	3
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O75531|BAF_HUMAN	Barrier-to-autointegration factor OS=Homo sapiens OX=9606 GN=BANF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.15	20.0	1	1	1
PRT	sp|O75475-3|PSIP1_HUMAN	Isoform 3 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	tr|C5MKY7|C5MKY7_HCMV	Enhanced green fluorescent protein OS=Human cytomegalovirus OX=10359 GN=egfp PE=4 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.07	20.0	2	1	0
PRT	sp|P53007|TXTP_HUMAN	Tricarboxylate transport protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P62861|RS30_HUMAN	40S ribosomal protein S30 OS=Homo sapiens OX=9606 GN=FAU PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.37	20.0	4	4	4
PRT	sp|Q5T440|CAF17_HUMAN	Putative transferase CAF17, mitochondrial OS=Homo sapiens OX=9606 GN=IBA57 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	259-UNIMOD:4	0.06	20.0	2	2	2
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P16104|H2AX_HUMAN	Histone H2AX OS=Homo sapiens OX=9606 GN=H2AX PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	2	2	1
PRT	sp|P18621-2|RL17_HUMAN	Isoform 2 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.14	20.0	2	2	2
PRT	sp|P56545-2|CTBP2_HUMAN	Isoform 2 of C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8N6N3-3|CA052_HUMAN	Isoform 3 of UPF0690 protein C1orf52 OS=Homo sapiens OX=9606 GN=C1orf52	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.15	20.0	1	1	1
PRT	sp|P08579|RU2B_HUMAN	U2 small nuclear ribonucleoprotein B'' OS=Homo sapiens OX=9606 GN=SNRPB2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null	84-UNIMOD:35	0.05	20.0	1	1	1
PRT	sp|Q96L21|RL10L_HUMAN	60S ribosomal protein L10-like OS=Homo sapiens OX=9606 GN=RPL10L PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	1	1	0
PRT	sp|Q9UNX3|RL26L_HUMAN	60S ribosomal protein L26-like 1 OS=Homo sapiens OX=9606 GN=RPL26L1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.10	20.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	2	2	2
PRT	sp|Q9NSV4|DIAP3_HUMAN	Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	2-UNIMOD:1	0.02	19.0	2	2	2
PRT	sp|Q9Y5V0|ZN706_HUMAN	Zinc finger protein 706 OS=Homo sapiens OX=9606 GN=ZNF706 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	41-UNIMOD:4,44-UNIMOD:4	0.16	19.0	1	1	1
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	cov|corona05915|ORF1a_Argentina/Heritas_HG001/2020	A1234V,N3537D	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	19.0	null	3539-UNIMOD:35,3533-UNIMOD:27	0.00	19.0	4	1	0
PRT	sp|O00541-2|PESC_HUMAN	Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	3	3	2
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q15393-3|SF3B3_HUMAN	Isoform 3 of Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.11	19.0	2	2	2
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9NZI8-2|IF2B1_HUMAN	Isoform 2 of Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens OX=9606 GN=IGF2BP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|P48507-2|GSH0_HUMAN	Isoform 2 of Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q9BVI4|NOC4L_HUMAN	Nucleolar complex protein 4 homolog OS=Homo sapiens OX=9606 GN=NOC4L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.16	19.0	2	2	2
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	165-UNIMOD:4	0.04	19.0	1	1	1
PRT	sp|P61353|RL27_HUMAN	60S ribosomal protein L27 OS=Homo sapiens OX=9606 GN=RPL27 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.16	19.0	1	1	1
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q15651-2|HMGN3_HUMAN	Isoform 2 of High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.17	19.0	1	1	1
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q13247-3|SRSF6_HUMAN	Isoform SRP55-3 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P15259|PGAM2_HUMAN	Phosphoglycerate mutase 2 OS=Homo sapiens OX=9606 GN=PGAM2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	0
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q14807-2|KIF22_HUMAN	Isoform 2 of Kinesin-like protein KIF22 OS=Homo sapiens OX=9606 GN=KIF22	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	null	257-UNIMOD:385,257-UNIMOD:4,269-UNIMOD:35,272-UNIMOD:4	0.08	19.0	1	1	1
PRT	sp|P48730|KC1D_HUMAN	Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q9Y330|ZBT12_HUMAN	Zinc finger and BTB domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZBTB12 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	338-UNIMOD:4	0.05	19.0	3	2	1
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	0
PRT	sp|Q9Y421|FA32A_HUMAN	Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.09	19.0	2	1	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q00535|CDK5_HUMAN	Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.10	19.0	1	1	1
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null	245-UNIMOD:4	0.09	19.0	1	1	1
PRT	sp|Q13642-5|FHL1_HUMAN	Isoform 5 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q7Z7K0|COXM1_HUMAN	COX assembly mitochondrial protein homolog OS=Homo sapiens OX=9606 GN=CMC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.10	18.0	1	1	1
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.20	18.0	2	2	2
PRT	sp|O43541-4|SMAD6_HUMAN	Isoform D of Mothers against decapentaplegic homolog 6 OS=Homo sapiens OX=9606 GN=SMAD6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q9Y3D2|MSRB2_HUMAN	Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|O60547-2|GMDS_HUMAN	Isoform 2 of GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|O00483|NDUA4_HUMAN	Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.14	18.0	1	1	1
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	159-UNIMOD:4	0.06	18.0	2	2	2
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O43837|IDH3B_HUMAN	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	2	2	2
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.13	18.0	2	2	2
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.10	18.0	2	2	2
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	6	5	4
PRT	sp|O75340-2|PDCD6_HUMAN	Isoform 2 of Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|P49207|RL34_HUMAN	60S ribosomal protein L34 OS=Homo sapiens OX=9606 GN=RPL34 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.09	18.0	1	1	1
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P41223|BUD31_HUMAN	Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	101-UNIMOD:4,102-UNIMOD:4	0.14	18.0	2	2	2
PRT	cov|corona08216|ORF1a_India/GBRC131/2020	L3338F	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.00	18.0	1	1	0
PRT	sp|Q8TAV0-5|FA76A_HUMAN	Isoform 5 of Protein FAM76A OS=Homo sapiens OX=9606 GN=FAM76A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.11	18.0	1	1	1
PRT	sp|Q969P6|TOP1M_HUMAN	DNA topoisomerase I, mitochondrial OS=Homo sapiens OX=9606 GN=TOP1MT PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	null	161-UNIMOD:385,161-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|P07910|HNRPC_HUMAN	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q99439|CNN2_HUMAN	Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	0
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	0
PRT	sp|P49915|GUAA_HUMAN	GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q9NVN8|GNL3L_HUMAN	Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	2	1	0
PRT	sp|Q9NQ88|TIGAR_HUMAN	Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q96DC9|OTUB2_HUMAN	Ubiquitin thioesterase OTUB2 OS=Homo sapiens OX=9606 GN=OTUB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q13421|MSLN_HUMAN	Mesothelin OS=Homo sapiens OX=9606 GN=MSLN PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	null	190-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q12906|ILF3_HUMAN	Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q6V1P9|PCD23_HUMAN	Protocadherin-23 OS=Homo sapiens OX=9606 GN=DCHS2 PE=2 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	null	1262-UNIMOD:35	0.01	18.0	1	1	1
PRT	sp|Q96JB1|DYH8_HUMAN	Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.00	18.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	390-UNIMOD:4	0.09	17.0	4	4	4
PRT	sp|O43390-3|HNRPR_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens OX=9606 GN=HNRNPR	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P80297|MT1X_HUMAN	Metallothionein-1X OS=Homo sapiens OX=9606 GN=MT1X PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	44-UNIMOD:4,48-UNIMOD:4,50-UNIMOD:4	0.15	17.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P22234|PUR6_HUMAN	Multifunctional protein ADE2 OS=Homo sapiens OX=9606 GN=PAICS PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	112-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.18	17.0	2	2	2
PRT	sp|Q9HA64|KT3K_HUMAN	Ketosamine-3-kinase OS=Homo sapiens OX=9606 GN=FN3KRP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P61254|RL26_HUMAN	60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|P27816-4|MAP4_HUMAN	Isoform 4 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|Q08945|SSRP1_HUMAN	FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|O43670-3|ZN207_HUMAN	Isoform 3 of BUB3-interacting and GLEBS motif-containing protein ZNF207 OS=Homo sapiens OX=9606 GN=ZNF207	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	2	1	0
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	81-UNIMOD:4	0.09	17.0	1	1	1
PRT	sp|Q86XR2-5|NIBA3_HUMAN	Isoform 5 of Protein Niban 3 OS=Homo sapiens OX=9606 GN=NIBAN3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P26885|FKBP2_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	2	1	0
PRT	sp|Q8IZQ5|SELH_HUMAN	Selenoprotein H OS=Homo sapiens OX=9606 GN=SELENOH PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|Q9NRW3|ABC3C_HUMAN	DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	65-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q9NWB6|ARGL1_HUMAN	Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.07	17.0	3	2	1
PRT	sp|Q14241|ELOA1_HUMAN	Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q8IWS0-2|PHF6_HUMAN	Isoform 2 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9NRX1|PNO1_HUMAN	RNA-binding protein PNO1 OS=Homo sapiens OX=9606 GN=PNO1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P63092-3|GNAS2_HUMAN	Isoform 3 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	0
PRT	sp|P49458|SRP09_HUMAN	Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	null		0.14	17.0	1	1	0
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	1
PRT	sp|Q2TBE0|C19L2_HUMAN	CWF19-like protein 2 OS=Homo sapiens OX=9606 GN=CWF19L2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q5XG87|PAPD7_HUMAN	Terminal nucleotidyltransferase 4A OS=Homo sapiens OX=9606 GN=TENT4A PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:28,22-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.09	17.0	1	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q13595|TRA2A_HUMAN	Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q13427|PPIG_HUMAN	Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|P28070|PSB4_HUMAN	Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.07	17.0	1	1	1
PRT	cov|corona02961|ORF1a_Vietnam/19-01S/2020	R3323C	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	3307-UNIMOD:4,3323-UNIMOD:4	0.00	17.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	1	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	81.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26654	58.816225	5	5732.4606	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	2	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	76.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=29822	64.390865	5	5732.4622	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	3	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	71.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26072	57.695433	5	5732.4608	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	4	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	70.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=30147	65.017806	5	5732.4585	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	5	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	70.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=27324	60.106305	5	5732.4573	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	6	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	69.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=29475	63.751688	5	5732.4622	5732.4623	K	Q	3401	3452
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	7	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	68.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=20647	47.41	3	3606.7058	3606.7058	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	8	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	68.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=28407	61.855926	5	5732.4626	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	9	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	67.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26989	59.47581	5	5732.4573	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	10	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	67.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=25721	57.06465	5	5732.4608	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	11	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	64.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=28769	62.489649	5	5732.4626	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	12	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	64.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=31186	67.537636	5	5732.4587	5732.4623	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	13	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	63.0	29-UNIMOD:4	ms_run[1]:scan=27563	60.507184	3	3634.794943	3631.790221	K	E	3500	3533
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	14	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	62.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32456	72.031225	5	5732.4536	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	15	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	62.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=31947	70.106195	5	5733.4552	5732.4622	K	Q	3401	3452
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	16	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	61.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=21378	48.833	2	2890.3201	2890.3201	R	P	3369	3395
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	17	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	61.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32114	70.736193	5	5732.4576	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	18	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	61.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=30437	65.646087	5	5732.4576	5732.4623	K	Q	3401	3452
PSM	GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK	19	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	61.0	41-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=21146	48.345571	5	5113.4592	5112.4642	R	F	323	372
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	20	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	60.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=20645	47.403	3	3606.7058	3606.7058	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	21	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	60.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=24898	55.597277	5	5748.4576	5748.4572	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	22	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	60.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=31757	69.433729	5	5732.4569	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	23	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	60.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=31591	68.803577	5	5734.4612	5732.4622	K	Q	3401	3452
PSM	HVICTSEDMLNPNYEDLLIRK	24	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	58.0	4-UNIMOD:4	ms_run[2]:scan=17827	41.827	2	2559.2461	2559.2461	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	25	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	58.0	4-UNIMOD:4	ms_run[2]:scan=17833	41.839	2	2559.2461	2559.2461	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	26	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	58.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22094	50.377	4	3590.7109	3590.7109	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	27	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	58.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,28-UNIMOD:35	ms_run[1]:scan=25750	57.11417	5	5748.4538	5748.4572	K	Q	3401	3452
PSM	HVICTSEDMLNPNYEDLLIR	28	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	57.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18196	42.604	2	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	29	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	57.0	4-UNIMOD:4	ms_run[2]:scan=20251	46.489	2	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	30	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	57.0	4-UNIMOD:4	ms_run[2]:scan=20501	47.123	2	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	31	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	57.0	4-UNIMOD:4	ms_run[2]:scan=21730	49.713	2	2431.1512	2431.1512	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	32	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	57.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=21367	48.802	2	2890.3201	2890.3201	R	P	3369	3395
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	33	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	57.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=27034	59.557478	5	5748.4559	5748.4572	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	34	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	57.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=25745	57.10691	5	5748.4538	5748.4572	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	35	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	57.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=30957	66.910116	5	5732.4574	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	36	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	57.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=29822	64.390865	5	5736.4652	5735.4952	K	Q	3401	3452
PSM	HVICTSEDMLNPNYEDLLIR	37	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18183	42.572	2	2447.1461	2447.1461	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	38	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22108	50.401	3	3590.7109	3590.7109	R	G	3369	3401
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	39	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=26242	58.001	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	40	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=26579	58.641	3	3242.4869	3242.4869	K	H	3276	3304
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	41	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	29-UNIMOD:4	ms_run[2]:scan=27574	60.524	3	3617.7746	3617.7746	K	E	3500	3533
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	42	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	55.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=21426	48.975	2	2890.3201	2890.3201	R	P	3369	3395
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	43	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	55.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=26876	59.279	3	3242.4869	3242.4869	K	H	3276	3304
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	44	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	54.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=29119	63.122811	5	5732.4643	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	45	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	54.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=25721	57.06465	5	5736.4602	5735.4952	K	Q	3401	3452
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	46	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	54.0		ms_run[1]:scan=23600	53.163406	3	2798.340405	2797.336097	R	G	78	104
PSM	HVICTSEDMLNPNYEDLLIRK	47	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15570	37.602	2	2575.2411	2575.2411	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	48	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22998	52.097	4	3590.7109	3590.7109	R	G	3369	3401
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	49	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=25035	55.848	3	3258.4818	3258.4818	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	50	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=27227	59.923	3	3242.4869	3242.4869	K	H	3276	3304
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	51	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	53.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32283	71.407699	5	5733.4552	5732.4622	K	Q	3401	3452
PSM	KGLIAAICAGPTALLAHEIGFGSK	52	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	53.0	8-UNIMOD:4	ms_run[1]:scan=23233	52.494821	3	2394.309685	2394.309337	R	V	99	123
PSM	HVICTSEDMLNPNYEDLLIR	53	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	52.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=19298	44.714	2	2447.1461	2447.1461	R	K	3304	3324
PSM	VGATAAVYSAAILEYLTAEVLELAGNASK	54	sp|Q71UI9|H2AV_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	52.0		ms_run[1]:scan=28664	62.303759	3	2895.535161	2894.527705	R	D	47	76
PSM	FVDGLMIHSGDPVNYYVDTAVR	55	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=20886	47.887	3	2467.1842	2467.1842	K	H	152	174
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	56	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	51.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22453	51.011	4	3590.7109	3590.7109	R	G	3369	3401
PSM	QTAQAAGTDTTITVNVLAWLYAAVINGDR	57	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=28332	61.733	3	3032.5567	3032.5567	R	W	3452	3481
PSM	QTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNR	58	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	51.0		ms_run[2]:scan=28524	62.058	3	3748.9325	3748.9325	R	F	3452	3486
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	59	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	51.0	29-UNIMOD:4	ms_run[1]:scan=30252	65.218261	3	3632.783198	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	60	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	51.0	29-UNIMOD:4	ms_run[1]:scan=28057	61.295907	3	3633.788229	3631.790221	K	E	3500	3533
PSM	HVICTSEDMLNPNYEDLLIRK	61	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	4-UNIMOD:4	ms_run[2]:scan=17798	41.779	3	2559.2461	2559.2461	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	62	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22155	50.488	5	3590.7109	3590.7109	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	63	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=26834	59.202	4	3590.7109	3590.7109	R	G	3369	3401
PSM	SGNSDVYENEIPGGQYTNLHFQAHSMGLGSK	64	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=16874	40.037	4	3336.5106	3336.5106	K	F	856	887
PSM	VGATAAVYSAAILEYLTAEVLELAGNASK	65	sp|Q71UI9-2|H2AV_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0		ms_run[2]:scan=28675	62.323	4	2894.5277	2894.5277	R	D	47	76
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	66	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	29-UNIMOD:4	ms_run[2]:scan=28947	62.805	3	3631.7902	3631.7902	K	E	3500	3533
PSM	HVICTSEDMLNPNYEDLLIR	67	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	50.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18518	43.242966	2	2448.149754	2447.146097	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	68	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	50.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20768	47.681016	4	3609.709732	3606.705781	R	G	3369	3401
PSM	CNPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAK	69	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	49.0	1-UNIMOD:4	ms_run[2]:scan=25889	57.354	5	4387.05	4387.0500	K	A	43	82
PSM	IDSIPHLNNSTPLVDPSVYGYGVQK	70	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=19232	44.603	3	2712.3759	2712.3759	K	R	33	58
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	71	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	49.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22468	51.038	3	3590.7109	3590.7109	R	G	3369	3401
PSM	MLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR	72	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	49.0	3-UNIMOD:4,30-UNIMOD:4,31-UNIMOD:4,34-UNIMOD:4	ms_run[2]:scan=17212	40.731	3	3922.6511	3922.6511	K	C	4297	4332
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	73	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	49.0	11-UNIMOD:4	ms_run[2]:scan=27954	61.133	3	2908.431	2908.4310	K	N	101	130
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	74	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	49.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=21307	48.628694	3	2891.325557	2890.320055	R	P	3369	3395
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	75	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	49.0	29-UNIMOD:4	ms_run[1]:scan=30936	66.856868	3	3633.791525	3631.790221	K	E	3500	3533
PSM	CMLFSSALVSSHSDNESLGGFSIEDVQK	76	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	49.0	1-UNIMOD:4	ms_run[1]:scan=22466	51.032425	3	3044.399597	3043.390302	K	E	45	73
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	77	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:4	ms_run[2]:scan=18331	42.918	5	3944.8639	3944.8639	R	L	201	238
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	78	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0	1-UNIMOD:4	ms_run[2]:scan=18389	43.02	4	3944.8639	3944.8639	R	L	201	238
PSM	GPGTSFEFALAIVEALNGK	79	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=28087	61.346	2	1919.9993	1919.9993	R	E	157	176
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	80	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	48.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=26849	59.227511	5	5748.4559	5748.4572	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	81	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	48.0	29-UNIMOD:4	ms_run[1]:scan=32299	71.455369	3	3632.782536	3631.790221	K	E	3500	3533
PSM	EVGGQGAGNTGGLEPVHPASLPDSSLATSAPLCCTLCHER	82	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	33-UNIMOD:4,34-UNIMOD:4,37-UNIMOD:4	ms_run[2]:scan=17196	40.704	4	4101.8943	4101.8943	R	L	473	513
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	83	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=20971	48.036	3	3606.7058	3606.7058	R	G	3369	3401
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	84	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=14616	35.926	3	3125.432	3125.4320	R	S	38	70
PSM	MKEIAEAYLGYPVTNAVITVPAYFNDSQR	85	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=24352	54.62	3	3259.6224	3259.6224	K	Q	127	156
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	86	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=30704	66.243	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VEQLGAEGNVEESQKVMDEVEK	87	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=14340	35.425	3	2446.1533	2446.1533	K	A	140	162
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	88	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	29-UNIMOD:4	ms_run[2]:scan=32088	70.629	3	3631.7902	3631.7902	K	E	3500	3533
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	89	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=25884	57.343391	3	3243.485862	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	90	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=32026	70.402008	3	3243.490866	3242.486863	K	H	3276	3304
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	91	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	29-UNIMOD:4	ms_run[1]:scan=28005	61.216277	3	3632.792868	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	92	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	29-UNIMOD:4	ms_run[1]:scan=29880	64.498922	3	3631.769001	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	93	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	29-UNIMOD:4	ms_run[1]:scan=31424	68.246458	3	3632.782256	3631.790221	K	E	3500	3533
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	94	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=21643	49.552	3	2890.3201	2890.3201	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	95	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=27184	59.842	4	3590.7109	3590.7109	R	G	3369	3401
PSM	KGLIAAICAGPTALLAHEIGFGSK	96	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	8-UNIMOD:4	ms_run[2]:scan=23188	52.412	3	2394.3093	2394.3093	R	V	99	123
PSM	KVDGSVNAYAINVSQK	97	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=9725	26.092	2	1691.8842	1691.8842	K	R	119	135
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	98	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=13483	33.772	4	3381.587	3381.5870	K	G	211	242
PSM	MLCTHTGTGQAITVTPEANMDQESFGGASCCLYCR	99	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	3-UNIMOD:4,30-UNIMOD:4,31-UNIMOD:4,34-UNIMOD:4	ms_run[2]:scan=17195	40.703	4	3922.6511	3922.6511	K	C	4297	4332
PSM	SIMAAAGVPVVEGYHGEDQSDQCLK	100	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	23-UNIMOD:4	ms_run[2]:scan=15305	37.146	3	2660.2211	2660.2211	K	E	168	193
PSM	TIGGGDDSFNTFFSETGAGK	101	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=20532	47.176	2	2006.8858	2006.8858	K	H	41	61
PSM	TILGSALLEDEFTPFDVVR	102	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=27952	61.131	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	103	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=30122	64.963	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	104	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=30414	65.591	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	105	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=32090	70.634	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	106	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=25985	57.532	4	3242.4869	3242.4869	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	107	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=29512	63.816	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	108	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=30194	65.11	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VQAERPDTMLGVVCGALHVADVSLR	109	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	14-UNIMOD:4	ms_run[2]:scan=24785	55.397	4	2692.3789	2692.3789	K	N	621	646
PSM	YGPQYGHPPPPPPPPEYGPHADSPVLMVYGLDQSK	110	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=18967	44.089	4	3783.8032	3783.8032	R	M	226	261
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	111	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=25755	57.121787	3	3243.485862	3242.486863	K	H	3276	3304
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	112	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	46.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=25388	56.469204	5	5748.4572	5748.4572	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	113	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	29-UNIMOD:4	ms_run[1]:scan=31214	67.616117	3	3632.796164	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	114	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	29-UNIMOD:4	ms_run[1]:scan=29918	64.572667	3	3632.788179	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	115	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	29-UNIMOD:4	ms_run[1]:scan=31635	68.962228	3	3633.794729	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	116	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	29-UNIMOD:4	ms_run[1]:scan=32016	70.367921	3	3633.793327	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	117	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=25934	57.438386	3	3647.786345	3647.785136	K	E	3500	3533
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	118	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	46.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=32114	70.736193	5	5736.4732	5735.4952	K	Q	3401	3452
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	119	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	46.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31799	69.561249	3	3245.494406	3242.486863	K	H	3276	3304
PSM	AYHEQLSVAEITNACFEPANQMVK	120	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	15-UNIMOD:4	ms_run[2]:scan=18807	43.774	3	2749.284	2749.2840	K	C	281	305
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	121	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	1-UNIMOD:4	ms_run[2]:scan=18458	43.137	5	3944.8639	3944.8639	R	L	201	238
PSM	GPAVGIDLGTTYSCVGVFQHGK	122	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	14-UNIMOD:4	ms_run[2]:scan=18461	43.142	3	2262.1103	2262.1103	K	V	4	26
PSM	HVICTSEDMLNPNYEDLLIR	123	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=20256	46.496	2	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	124	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=17227	40.757	3	2575.2411	2575.2411	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	125	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=21518	49.268	3	2890.3201	2890.3201	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	126	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=23794	53.522	3	3590.7109	3590.7109	R	G	3369	3401
PSM	KSNHNFLVQAGNVQLR	127	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=10632	27.865	2	1823.9755	1823.9755	R	V	3324	3340
PSM	LILPVGPAGGNQMLEQYDKLQDGSIK	128	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=21998	50.209	4	2783.4528	2783.4528	R	M	179	205
PSM	QTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNR	129	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=28525	62.059	4	3748.9325	3748.9325	R	F	3452	3486
PSM	SLVQANPEVAMDSIIHMTQHISPTQR	130	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=23920	53.771	4	2902.4429	2902.4429	R	A	2306	2332
PSM	TANKDHLVTAYNHLFETK	131	sp|Q00688|FKBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12049	30.65	3	2101.0593	2101.0593	K	R	53	71
PSM	TILGSALLEDEFTPFDVVR	132	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=27556	60.495	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	133	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=28365	61.789	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	134	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=29089	63.072	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	135	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=29445	63.698	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	136	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=31377	68.115	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	137	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=31572	68.744	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	138	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=31921	70.001	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	139	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=32421	71.89	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	140	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=31738	69.373	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	141	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	45.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26651	58.811623	5	5732.4606	5732.4623	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	142	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0	29-UNIMOD:4	ms_run[1]:scan=29528	63.845618	3	3633.783132	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	143	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0	29-UNIMOD:4	ms_run[1]:scan=28526	62.060317	3	3632.782479	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	144	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0	29-UNIMOD:4	ms_run[1]:scan=30805	66.494925	3	3631.765524	3631.790221	K	E	3500	3533
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	145	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0		ms_run[1]:scan=23430	52.844125	3	2798.340405	2797.336097	R	G	78	104
PSM	DLLSTQPSETLASSDSFASTQPTHSWK	146	sp|O75940|SPF30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=18018	42.261	3	2920.3727	2920.3727	K	V	48	75
PSM	GLIAAICAGPTALLAHEIGFGSK	147	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	7-UNIMOD:4	ms_run[2]:scan=25789	57.18	3	2266.2144	2266.2144	K	V	100	123
PSM	HVICTSEDMLNPNYEDLLIRK	148	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15483	37.456	3	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	149	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=19164	44.482	3	2575.2411	2575.2411	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	150	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=20103	46.228	3	2906.315	2906.3150	R	P	3369	3395
PSM	ISLGLPVGAVINCADNTGAK	151	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	13-UNIMOD:4	ms_run[2]:scan=21206	48.457	2	1969.0303	1969.0303	R	N	16	36
PSM	TILGSALLEDEFTPFDVVR	152	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=28736	62.432	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	153	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=29791	64.335	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	154	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=32247	71.264	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	155	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=32719	72.53	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	156	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=33073	73.161	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILSNQTVDIPENVDITLK	157	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=20648	47.412	2	2112.1314	2112.1314	K	G	3	22
PSM	TQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAEVK	158	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=17197	40.706	4	4081.9222	4081.9222	K	A	319	353
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	159	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=31016	67.072	3	3242.4869	3242.4869	K	H	3276	3304
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	160	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[2]:scan=25835	57.255	3	3647.7851	3647.7851	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	161	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	29-UNIMOD:4	ms_run[2]:scan=32351	71.636	3	3631.7902	3631.7902	K	E	3500	3533
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	162	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22921	51.95215	3	3592.707105	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	163	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	44.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=29447	63.701392	5	5749.4552	5748.4572	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	164	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	44.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32125	70.777591	5	5732.4576	5732.4623	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	165	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0	29-UNIMOD:4	ms_run[1]:scan=31808	69.593545	3	3631.762716	3631.790221	K	E	3500	3533
PSM	AMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTR	166	sp|P26368|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=26073	57.696976	3	3789.959616	3787.967474	K	Q	109	147
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	167	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0	29-UNIMOD:4	ms_run[1]:scan=29562	63.908939	3	3634.795892	3631.790221	K	E	3500	3533
PSM	GISLNPEQWSQLKEQISDIDDAVR	168	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=24815	55.451	3	2740.3668	2740.3668	K	K	102	126
PSM	HTHVQDGEAGGITQQIGATNVPLEAINEQTK	169	sp|O60841|IF2P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=15358	37.238	4	3255.612	3255.6120	R	M	653	684
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	170	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=20732	47.6	5	3606.7058	3606.7058	R	G	3369	3401
PSM	KSNHNFLVQAGNVQLR	171	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=10858	28.495	2	1823.9755	1823.9755	R	V	3324	3340
PSM	LALSQNQQSSGAAGPTGK	172	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=6941	19.497	2	1713.8646	1713.8646	R	N	107	125
PSM	LGGLTQAPGNPVLAVQINQDKNFAFLEFR	173	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=25371	56.44	4	3156.672	3156.6720	R	S	175	204
PSM	TEAEIAHIALETLEGHQR	174	sp|O75955|FLOT1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=20240	46.467	3	2017.0229	2017.0229	K	A	92	110
PSM	TILGSALLEDEFTPFDVVR	175	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=30697	66.224	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	176	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=30935	66.855	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	177	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=31168	67.484	2	2121.0994	2121.0994	R	Q	3543	3562
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	178	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	29-UNIMOD:4	ms_run[2]:scan=27501	60.406	4	3631.7902	3631.7902	K	E	3500	3533
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	179	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=28258	61.61788	3	3244.501242	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	180	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31739	69.374671	3	3244.488214	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	181	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=28793	62.531928	3	3243.489792	3242.486863	K	H	3276	3304
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	182	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23335	52.678714	3	3591.705826	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	183	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23870	53.673259	3	3591.708029	3590.710866	R	G	3369	3401
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	184	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	29-UNIMOD:4	ms_run[1]:scan=31580	68.768553	3	3632.778510	3631.790221	K	E	3500	3533
PSM	MGQLGLGNQTDAVPSPAQIMYNGQPITK	185	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0		ms_run[1]:scan=20981	48.053911	3	2929.451628	2928.447363	K	M	231	259
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	186	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=30491	65.749049	3	3245.500017	3242.486863	K	H	3276	3304
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	187	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	29-UNIMOD:4	ms_run[1]:scan=30545	65.86336	3	3634.790170	3631.790221	K	E	3500	3533
PSM	AIAIAAGVPVVPGTDAPITSLHEAHEFSNTYGFPIIFK	188	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=25410	56.505	4	3950.0618	3950.0618	R	A	157	195
PSM	AYHEQLSVAEITNACFEPANQMVK	189	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:4	ms_run[2]:scan=18775	43.711	3	2749.284	2749.2840	K	C	281	305
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	190	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	1-UNIMOD:4	ms_run[2]:scan=18402	43.041	4	3944.8639	3944.8639	R	L	201	238
PSM	DMAGLLKPTACTMLVSSLR	191	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4	ms_run[2]:scan=22262	50.692	3	2063.0577	2063.0577	K	D	742	761
PSM	HVICTSEDMLNPNYEDLLIRK	192	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15821	38.09	3	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	193	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=17921	42.064	3	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	194	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	4-UNIMOD:4	ms_run[2]:scan=18100	42.406	3	2559.2461	2559.2461	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	195	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=21414	48.944	4	2890.3201	2890.3201	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	196	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22963	52.035	3	3590.7109	3590.7109	R	G	3369	3401
PSM	QTQIFTTYSDNQPGVLIQVYEGER	197	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22605	51.281	3	2785.3559	2785.3559	K	A	424	448
PSM	SNHNFLVQAGNVQLR	198	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=5738	16.662	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	199	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=12992	32.546	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	200	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13201	33.177	2	1695.8805	1695.8805	K	V	3325	3340
PSM	TLDGIFSEQVAMGYSHSLVIAR	201	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=22658	51.371	3	2393.2049	2393.2049	K	D	480	502
PSM	VIHDNFGIVEGLMTTVHAITATQK	202	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=26966	59.435	4	2594.3527	2594.3527	K	T	163	187
PSM	HVICTSEDMLNPNYEDLLIR	203	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:4	ms_run[1]:scan=20919	47.943006	2	2432.158787	2431.151182	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	204	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=27235	59.940261	4	3590.712677	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	205	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=24215	54.380785	3	3592.711317	3590.710866	R	G	3369	3401
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	206	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	29-UNIMOD:4	ms_run[1]:scan=32659	72.424266	3	3631.762716	3631.790221	K	E	3500	3533
PSM	QMSCAAGTTQTACTDDNALAYYNTTK	207	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=13300	33.426512	3	2857.211192	2856.200059	R	G	4151	4177
PSM	GHYTEGAELVDSVLDVVRK	208	sp|Q13885|TBB2A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0		ms_run[1]:scan=22217	50.608195	3	2087.072144	2086.069484	K	E	104	123
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	209	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31975	70.207815	3	3245.491998	3242.486863	K	H	3276	3304
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	210	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	29-UNIMOD:4	ms_run[1]:scan=30988	66.986117	3	3634.792876	3631.790221	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	211	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	29-UNIMOD:4	ms_run[1]:scan=26144	57.827988	3	3632.757947	3631.790221	K	E	3500	3533
PSM	AEEGIAAGGVMDVNTALQEVLK	212	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	1-UNIMOD:1	ms_run[2]:scan=27963	61.146	3	2256.1308	2256.1308	M	T	2	24
PSM	ESTGAQVQVAGDMLPNSTER	213	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13276	33.374	2	2088.9746	2088.9746	R	A	125	145
PSM	FHDPDSAVVAQHLTNTVFVDR	214	sp|Q05519-2|SRS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=16789	39.89	4	2367.1608	2367.1608	K	A	83	104
PSM	GNFGGSFAGSFGGAGGHAPGVAR	215	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13877	34.587	3	2033.9456	2033.9456	R	K	589	612
PSM	HVICTSEDMLNPNYEDLLIR	216	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18129	42.46	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	217	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15871	38.181	4	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	218	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=19162	44.479	4	2575.2411	2575.2411	R	S	3304	3325
PSM	IGDQEFDHLPALLEFYK	219	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=24791	55.409	3	2034.0098	2034.0098	K	I	73	90
PSM	KPLVIIAEDVDGEALSTLVLNR	220	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=24912	55.621	3	2364.3264	2364.3264	R	L	269	291
PSM	LILPVGPAGGNQMLEQYDK	221	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=20744	47.623	2	2042.0507	2042.0507	R	L	179	198
PSM	NTHATTHNAYDLEVIDIFK	222	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19781	45.589	3	2201.0753	2201.0753	K	I	820	839
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	223	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4	ms_run[2]:scan=21933	50.101	3	2994.3925	2994.3926	K	F	396	424
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	224	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4	ms_run[2]:scan=22014	50.239	4	2994.3925	2994.3926	K	F	396	424
PSM	TLTAVHDAILEDLVFPSEIVGK	225	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=26117	57.775	3	2366.2733	2366.2733	R	R	121	143
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	226	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=29859	64.457	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	227	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=30942	66.873	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VETGVLKPGMVVTFAPVNVTTEVK	228	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	10-UNIMOD:35	ms_run[2]:scan=18401	43.04	3	2530.3717	2530.3717	R	S	267	291
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	229	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31192	67.553847	3	3244.492410	3242.486863	K	H	3276	3304
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	230	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=24819	55.456936	4	3590.712313	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	231	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	41.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32271	71.362557	5	5733.4602	5732.4622	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	232	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	29-UNIMOD:4	ms_run[1]:scan=29966	64.664732	3	3632.788179	3631.790221	K	E	3500	3533
PSM	TILGSALLEDEFTPFDVVR	233	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=27552	60.490513	2	2121.095314	2121.099387	R	Q	3543	3562
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	234	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23225	52.48049	3	2893.323505	2890.320055	R	P	3369	3395
PSM	ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK	235	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	6-UNIMOD:4	ms_run[1]:scan=22657	51.369504	3	3057.499512	3054.486920	K	G	598	629
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	236	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	29-UNIMOD:4	ms_run[1]:scan=31230	67.664533	3	3634.795334	3631.790221	K	E	3500	3533
PSM	CQEVISWLDANTLAEKDEFEHK	237	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	1-UNIMOD:4	ms_run[2]:scan=20080	46.174	4	2661.2381	2661.2381	K	R	574	596
PSM	DKLESEMEDAYHEHQANLLR	238	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=15565	37.594	4	2427.1125	2427.1125	K	Q	517	537
PSM	HVICTSEDMLNPNYEDLLIR	239	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18236	42.707	4	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	240	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=21767	49.782	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	241	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=21886	50.022	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	242	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=23143	52.338	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	243	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=16915	40.109	4	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	244	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=19387	44.872	3	2559.2461	2559.2461	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	245	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=20701	47.531	5	3606.7058	3606.7058	R	G	3369	3401
PSM	ITDIIGKEEGIGPENLR	246	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14478	35.674	3	1852.9894	1852.9894	K	G	1782	1799
PSM	KPLVIIAEDVDGEALSTLVLNR	247	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=24930	55.654	3	2364.3264	2364.3264	R	L	269	291
PSM	LDYFLLSHSLLPALCDSK	248	sp|P27695|APEX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=25315	56.343	3	2091.0711	2091.0711	R	I	282	300
PSM	LLDFGSLSNLQVTQPTVGMNFK	249	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=25232	56.199	3	2408.241	2408.2410	K	T	108	130
PSM	LPGGELNPGEDEVEGLKR	250	sp|O43809|CPSF5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=12685	31.807	3	1907.9589	1907.9589	K	L	106	124
PSM	LQVEHTVTEEITDVDLVHAQIHVAEGR	251	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=18559	43.313	4	3037.5469	3037.5469	R	S	329	356
PSM	SNHNFLVQAGNVQLR	252	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14146	35.074	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SVEMHHEALSEALPGDNVGFNVK	253	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=14355	35.452	4	2479.1802	2479.1802	K	N	291	314
PSM	SVVEFLQGYIGVPHGGFPEPFR	254	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=26224	57.971	3	2431.2325	2431.2325	R	S	943	965
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	255	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[2]:scan=25849	57.279	4	3647.7851	3647.7851	K	E	3500	3533
PSM	HVICTSEDMLNPNYEDLLIR	256	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:4	ms_run[1]:scan=22709	51.470449	3	2433.156046	2431.151182	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	257	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	4-UNIMOD:4	ms_run[1]:scan=25529	56.717494	3	2432.155471	2431.151182	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	258	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23373	52.747418	4	3590.712805	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	259	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	40.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,28-UNIMOD:35	ms_run[1]:scan=29957	64.645936	5	5748.4532	5748.4572	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	260	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	40.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=31757	69.433729	5	5735.4662	5735.4952	K	Q	3401	3452
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	261	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21889	50.026172	3	3598.692331	3596.685045	R	G	3369	3401
PSM	GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK	262	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	40.0	41-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=21097	48.25727	5	5113.4592	5112.4642	R	F	323	372
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	263	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	29-UNIMOD:4	ms_run[1]:scan=31832	69.671513	3	3634.802633	3631.790221	K	E	3500	3533
PSM	AFVHWYVGEGMEEGEFSEAR	264	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19465	45.023	3	2329.011	2329.0110	R	E	403	423
PSM	ECPSDECGAGVFMASHFDR	265	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=15481	37.454	3	2170.8507	2170.8507	R	H	120	139
PSM	HGEEVTPEDVLSAAMYPDVFAHFK	266	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=25512	56.689	4	2688.253	2688.2530	R	D	998	1022
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	267	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=21039	48.154	4	3010.5625	3010.5625	R	L	133	163
PSM	HLILVVNYSCPNHYEDYVHR	268	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:4	ms_run[2]:scan=14370	35.479	4	2527.2067	2527.2067	K	A	687	707
PSM	HVICTSEDMLNPNYEDLLIR	269	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18797	43.754	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	270	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=20228	46.45	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	271	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=20411	46.928	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	272	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=20268	46.515	4	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	273	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=20521	47.157	4	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	274	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=20292	46.564	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	275	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=20541	47.192	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	276	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=20992	48.073	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	277	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=21899	50.044	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	278	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=22261	50.691	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	279	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=25156	56.06	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	280	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15536	37.546	4	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	281	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=17678	41.553	4	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	282	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	4-UNIMOD:4	ms_run[2]:scan=18089	42.385	4	2559.2461	2559.2461	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	283	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=19780	45.588	3	2906.315	2906.3150	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	284	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=19904	45.811	4	2906.315	2906.3150	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	285	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=24386	54.68	4	3590.7109	3590.7109	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	286	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=25185	56.114	4	3590.7109	3590.7109	R	G	3369	3401
PSM	KGLIAAICAGPTALLAHEIGFGSK	287	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4	ms_run[2]:scan=23170	52.382	4	2394.3093	2394.3093	R	V	99	123
PSM	LEQMPSKEDAIEHFMK	288	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=13713	34.267	3	1931.9121	1931.9121	K	L	601	617
PSM	LGGLTQAPGNPVLAVQINQDKNFAFLEFR	289	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=25330	56.369	3	3156.672	3156.6720	R	S	175	204
PSM	LPAAGVGDMVMATVK	290	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=18769	43.702	2	1458.7575	1458.7575	R	K	52	67
PSM	MMCGAPSATQPATAETQHIADQVR	291	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=16743	39.808	3	2612.1781	2612.1781	-	S	1	25
PSM	SLVQANPEVAMDSIIHMTQHISPTQR	292	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=23925	53.781	4	2902.4429	2902.4429	R	A	2306	2332
PSM	SNHNFLVQAGNVQLR	293	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15216	36.987	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SVDETTQAMAFDGIIFQGQSLK	294	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=23817	53.564	3	2385.1522	2385.1522	R	I	204	226
PSM	YGDGGSTFQSTTGHCVHMR	295	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=7815	21.604	3	2096.8793	2096.8793	R	G	276	295
PSM	VSALNSVHCEHVEDEGESR	296	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	9-UNIMOD:4	ms_run[1]:scan=7122	19.845514	3	2153.943528	2152.944360	R	Y	1761	1780
PSM	HVICTSEDMLNPNYEDLLIRK	297	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=16858	40.009505	3	2577.246276	2575.241060	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIR	298	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:4	ms_run[1]:scan=23699	53.347945	3	2432.154614	2431.151182	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	299	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:4	ms_run[1]:scan=18872	43.893609	4	2562.277177	2559.246145	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIR	300	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:4	ms_run[1]:scan=21566	49.387293	3	2432.136091	2431.151182	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	301	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:4	ms_run[1]:scan=22251	50.668222	3	2431.153706	2431.151182	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	302	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	4-UNIMOD:4	ms_run[1]:scan=26880	59.284742	3	2432.135702	2431.151182	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	303	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22578	51.233609	3	2891.320699	2890.320055	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	304	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23390	52.775071	4	3591.702272	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	305	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	39.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,28-UNIMOD:35	ms_run[1]:scan=29274	63.400084	5	5748.4535	5748.4572	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	306	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	29-UNIMOD:4	ms_run[1]:scan=30848	66.612499	3	3633.780418	3631.790221	K	E	3500	3533
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	307	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=23581	53.12979	3	2798.340405	2797.336097	R	G	78	104
PSM	TVAGGAWTYNTTSAVTVK	308	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=14212	35.185656	2	1827.929661	1825.921028	K	S	63	81
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	309	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20739	47.612372	4	3609.709732	3606.705781	R	G	3369	3401
PSM	DFVDHLDKVDPVDGVVLVDPDYLK	310	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23306	52.628	4	2711.3694	2711.3694	R	D	27	51
PSM	ELVFKEDGQEYAQVIK	311	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15028	36.649	2	1894.9676	1894.9676	R	M	25	41
PSM	EQQIVIQSSGGLSKDDIENMVK	312	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16903	40.087	3	2417.2108	2417.2108	R	N	542	564
PSM	FSSELEQIELHNSIR	313	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15526	37.528	2	1800.9006	1800.9006	R	D	85	100
PSM	HVICTSEDMLNPNYEDLLIR	314	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=24725	55.288	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	315	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=24389	54.684	3	2431.1512	2431.1512	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	316	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=17316	40.908	4	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	317	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	4-UNIMOD:4	ms_run[2]:scan=17784	41.753	4	2559.2461	2559.2461	R	S	3304	3325
PSM	HYGPGWVSMANAGK	318	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11380	29.456	2	1473.6823	1473.6823	K	D	132	146
PSM	IINEPTAAAIAYGLDKK	319	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16329	39.062	3	1786.9829	1786.9829	R	V	172	189
PSM	KLPIDVTEGEVISLGLPFGK	320	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24826	55.471	3	2111.1878	2111.1878	R	V	65	85
PSM	LGEMWNNTAADDKQPYEK	321	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11308	29.321	3	2108.9473	2108.9473	K	K	129	147
PSM	LILPVGPAGGNQMLEQYDKLQDGSIK	322	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21906	50.055	3	2783.4528	2783.4528	R	M	179	205
PSM	LVEALCAEHQINLIK	323	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4	ms_run[2]:scan=15427	37.364	2	1749.9447	1749.9447	K	V	64	79
PSM	NGPGFHNDIDSNSTIQEILIPASK	324	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19521	45.125	3	2566.2663	2566.2663	R	V	150	174
PSM	SHLLNCCPHDVLSGTR	325	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9164	24.912	2	1864.8672	1864.8672	K	M	38	54
PSM	VTIAQGGVLPNIQAVLLPK	326	sp|Q7L7L0|H2A3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=24879	55.563	2	1930.1615	1930.1615	R	K	101	120
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	327	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31407	68.203902	3	3244.494620	3242.486863	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIR	328	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=21853	49.957402	3	2447.146694	2447.146097	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	329	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:4	ms_run[1]:scan=17856	41.889371	5	2559.246844	2559.246145	R	S	3304	3325
PSM	KSNHNFLVQAGNVQLR	330	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=11209	29.125698	2	1825.975909	1823.975464	R	V	3324	3340
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	331	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	38.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32657	72.421173	5	5733.4542	5732.4622	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	332	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	38.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=30719	66.281489	5	5732.4576	5732.4623	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	333	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	38.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=24545	54.962646	5	5749.4542	5748.4572	K	Q	3401	3452
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	334	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=27516	60.42998	3	3649.808127	3647.785136	K	E	3500	3533
PSM	QMSCAAGTTQTACTDDNALAYYNTTK	335	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=13324	33.470028	3	2857.201769	2856.200059	R	G	4151	4177
PSM	HVICTSEDMFNPNYEDLLIR	336	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:4	ms_run[1]:scan=20393	46.876671	2	2465.147801	2465.135531	R	K	3304	3324
PSM	GKVEIDQQQLTQQQLNGN	337	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=10922	28.612421	2	2042.032001	2040.023596	R	-	348	366
PSM	LGEMWNNTAADDKQPYEK	338	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:35	ms_run[1]:scan=9426	25.49832	3	2127.946653	2124.942235	K	K	129	147
PSM	SIYGEKFEDENFILK	339	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=17731	41.645239	2	1831.903439	1830.903981	K	H	77	92
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	340	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31144	67.4176	3	3245.496650	3242.486863	K	H	3276	3304
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	341	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	29-UNIMOD:4	ms_run[1]:scan=26269	58.046784	3	3632.757947	3631.790221	K	E	3500	3533
PSM	AAESVSKPDVSEEAPGPSK	342	sp|Q9BY42|RTF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6703	18.929	3	1883.9113	1883.9113	K	V	204	223
PSM	ATAGDTHLGGEDFDNR	343	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8070	22.325	2	1674.7234	1674.7234	K	L	221	237
PSM	FDTGNLCMVTGGANLGR	344	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=17627	41.461	2	1781.8189	1781.8189	K	I	175	192
PSM	GANAVGYTNYPDNVVFK	345	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16016	38.447	2	1827.8792	1827.8792	R	F	645	662
PSM	HVICTSEDMFNPNYEDLLIRK	346	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4	ms_run[2]:scan=17871	41.919	3	2593.2305	2593.2305	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIR	347	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18432	43.096	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	348	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=17592	41.398	3	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	349	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4	ms_run[2]:scan=17858	41.896	5	2559.2461	2559.2461	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	350	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4	ms_run[2]:scan=19567	45.21	4	2559.2461	2559.2461	R	S	3304	3325
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	351	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15230	37.013	4	3766.8724	3766.8724	R	I	356	395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	352	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[2]:scan=19852	45.719	2	2906.315	2906.3150	R	P	3369	3395
PSM	KGADSLEDFLYHEGYACTSIHGDR	353	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	17-UNIMOD:4	ms_run[2]:scan=18057	42.328	4	2740.2187	2740.2187	K	S	436	460
PSM	KPPLLNNADSVQAK	354	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=7381	20.392	2	1493.8202	1493.8202	K	V	748	762
PSM	LAETQEEISAEVAAK	355	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=11356	29.411	2	1587.7992	1587.7992	R	A	108	123
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	356	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14556	35.82	3	3125.432	3125.4320	R	S	38	70
PSM	MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR	357	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=22946	52.002	4	3503.7871	3503.7871	R	L	145	179
PSM	MISAAQLLDELMGR	358	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:1	ms_run[2]:scan=28620	62.228	2	1588.7953	1588.7953	-	D	1	15
PSM	MVMIQDGPLPTGADKPLR	359	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14463	35.646	3	1938.0067	1938.0067	K	I	196	214
PSM	NDKSEEEQSSSSVK	360	sp|P07910-4|HNRPC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2343	9.1993	2	1552.6853	1552.6853	K	K	174	188
PSM	SNHNFLVQAGNVQLR	361	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=6719	18.961	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	362	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=13504	33.814	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	363	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=16258	38.92	2	1695.8805	1695.8805	K	V	3325	3340
PSM	TDQAQKAEGAGDAK	364	sp|P05204|HMGN2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2338	9.1925	2	1388.6532	1388.6532	K	-	77	91
PSM	TILGSALLEDEFTPFDVVR	365	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27713	60.756	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	366	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=28127	61.408	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	367	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=28886	62.698	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	368	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=29936	64.606	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	369	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=31651	69.023	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TLSYLLPAIVHINHQPFLER	370	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=21960	50.144	4	2360.3005	2360.3005	K	G	145	165
PSM	TVAGGAWTYNTTSAVTVK	371	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14195	35.157	2	1825.921	1825.9210	K	S	63	81
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	372	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=31577	68.76	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VTVAGLAGKDPVQCSR	373	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	14-UNIMOD:4	ms_run[2]:scan=9987	26.604	2	1656.8617	1656.8617	K	D	33	49
PSM	WFNGQPIHAELSPVTDFR	374	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19323	44.757	3	2113.0381	2113.0381	R	E	134	152
PSM	YVQIPTTCANDPVGFTLK	375	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:4	ms_run[2]:scan=19330	44.768	3	2023.0085	2023.0085	K	N	4349	4367
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	376	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=32930	72.908946	3	3243.490133	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	377	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=32193	71.05163	3	3243.481290	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	378	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=32305	71.467111	3	3243.485927	3242.486863	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIR	379	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4	ms_run[1]:scan=21670	49.607506	3	2432.136091	2431.151182	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	380	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4	ms_run[1]:scan=18896	43.941157	4	2559.245888	2559.246145	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	381	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4	ms_run[1]:scan=18475	43.16515	4	2559.245774	2559.246145	R	S	3304	3325
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	382	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	29-UNIMOD:4	ms_run[1]:scan=32360	71.664543	3	3631.779255	3631.790221	K	E	3500	3533
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	383	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	37.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=31772	69.480608	5	5735.4662	5735.4952	K	Q	3401	3452
PSM	DSSTCPGDYVLSVSENSR	384	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	5-UNIMOD:4	ms_run[1]:scan=16137	38.673444	2	1973.853846	1971.848000	R	V	40	58
PSM	HTGPGILSMANAGPNTNGSQFFICTAK	385	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	24-UNIMOD:4	ms_run[1]:scan=19369	44.836973	3	2791.320195	2790.321769	K	T	92	119
PSM	VTGEADVEFATHEDAVAAMSK	386	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=14717	36.101533	3	2176.991983	2176.994664	R	D	327	348
PSM	IGGVQQDTILAEGLHFR	387	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=19053	44.245336	3	1853.981184	1852.979546	R	I	55	72
PSM	AAELFGLTAEEVYLVHDELDKPLGR	388	sp|Q86Y79|PTH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=25781	57.164388	4	2785.437838	2784.433411	R	L	105	130
PSM	NDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK	389	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	33-UNIMOD:4,40-UNIMOD:4	ms_run[1]:scan=22025	50.258431	5	4387.118540	4384.119118	K	F	331	372
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	390	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31266	67.756439	3	3245.490201	3242.486863	K	H	3276	3304
PSM	IQPGQTFSVLACYNGTPSGVYQCAMR	391	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=21883	50.014524	3	2907.329515	2904.335705	R	P	3369	3395
PSM	IQPGQTFSVLACYNGTPSGVYQCAMR	392	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=19837	45.691375	3	2923.339228	2920.330620	R	P	3369	3395
PSM	DLEAEHVEVEDTTLNR	393	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=12026	30.611	2	1868.8752	1868.8752	R	C	15	31
PSM	GFGFITFEDEQSVDQAVNMHFHDIMGK	394	sp|Q96EP5-2|DAZP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=25816	57.224	4	3098.3902	3098.3902	R	K	155	182
PSM	GPGTSFEFALAIVEALNGK	395	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=28071	61.319	3	1919.9993	1919.9993	R	E	157	176
PSM	HVICTSEDMFNPNYEDLLIRK	396	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=17842	41.855	3	2593.2305	2593.2305	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	397	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=19413	44.918	4	2575.2411	2575.2411	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	398	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=18394	43.031	4	2559.2461	2559.2461	R	S	3304	3325
PSM	IINEPTAAAIAYGLDKR	399	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16965	40.2	3	1814.989	1814.9890	R	E	198	215
PSM	IITITGTQDQIQNAQYLLQNSVK	400	sp|P61978-3|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=23486	52.945	3	2588.381	2588.3810	R	Q	410	433
PSM	LDNASAFQGAVISPHYDSLLVK	401	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19352	44.809	3	2344.2063	2344.2063	R	V	407	429
PSM	LGEMWNNTAADDKQPYEK	402	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:35	ms_run[2]:scan=9412	25.472	3	2124.9422	2124.9422	K	K	129	147
PSM	LGEMWNNTAADDKQPYEK	403	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11330	29.365	3	2108.9473	2108.9473	K	K	129	147
PSM	NQGGYGGSSSSSSYGSGR	404	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=5042	15.187	2	1693.6928	1693.6928	R	R	248	266
PSM	PGLVDSNPAPPESQEK	405	sp|Q14061|COX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=8513	23.315	2	1663.8053	1663.8053	M	K	2	18
PSM	QEQVTAAVAHAVEQQMQK	406	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17736	41.656	3	1994.9844	1994.9844	R	L	128	146
PSM	SETAPAAPAAAPPAEKAPVK	407	sp|P16403|H12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:1	ms_run[2]:scan=8655	23.641	2	1915.0051	1915.0051	M	K	2	22
PSM	SNHNFLVQAGNVQLR	408	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=13796	34.442	2	1695.8805	1695.8805	K	V	3325	3340
PSM	TILGSALLEDEFTPFDVVR	409	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=27334	60.124	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	410	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=27356	60.165	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	411	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=28521	62.05	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	412	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=29230	63.325	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	413	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=29594	63.968	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	414	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=30549	65.872	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	415	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=31038	67.135	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	416	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=31472	68.397	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	417	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=31827	69.652	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILSNQTVDIPENVDITLK	418	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20653	47.428	3	2112.1314	2112.1314	K	G	3	22
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	419	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=25960	57.485	4	3242.4869	3242.4869	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	420	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=31478	68.413	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VRPCVVYGGADIGQQIR	421	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	4-UNIMOD:4	ms_run[2]:scan=12168	30.851	3	1886.9785	1886.9785	R	D	279	296
PSM	WPEVDDDSIEDLGEVKK	422	sp|O43583|DENR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17792	41.767	3	1972.9266	1972.9266	K	-	182	199
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	423	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=31815	69.620286	3	3243.488026	3242.486863	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIRK	424	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:4	ms_run[1]:scan=18840	43.831366	3	2561.267776	2559.246145	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIR	425	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:4	ms_run[1]:scan=24319	54.561667	3	2431.151759	2431.151182	R	K	3304	3324
PSM	TILGSALLEDEFTPFDVVR	426	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=30266	65.244577	3	2122.102152	2121.099387	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVR	427	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=31268	67.761997	3	2122.101856	2121.099387	R	Q	3543	3562
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	428	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	36.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=27563	60.507184	3	3634.7942	3633.7692	K	E	3500	3533
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	429	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	36.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35,28-UNIMOD:35	ms_run[1]:scan=29621	64.01443	5	5751.4782	5751.4902	K	Q	3401	3452
PSM	HVICTSEDMFNPNYEDLLIRK	430	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	4-UNIMOD:4	ms_run[1]:scan=19186	44.519961	3	2594.239157	2593.230495	R	S	3304	3325
PSM	KGDEVDGVDEVAK	431	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=6415	18.269225	2	1360.660832	1359.651789	R	K	209	222
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	432	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=19193	44.532082	4	3102.396396	3101.400273	K	I	20	47
PSM	TDASSASSFLDSDELER	433	sp|Q14498|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=16550	39.466442	2	1830.813450	1828.796281	R	T	330	347
PSM	NMGGPYGGGNYGPGGSGGSGGYGGR	434	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=10504	27.632742	3	2189.896872	2188.898078	R	S	326	351
PSM	LNRLPAAGVGDMVMATVK	435	sp|P62829|RL23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=18200	42.614314	3	1842.991918	1841.985560	R	K	49	67
PSM	YVIHTVGPIAYGEPSASQAAELR	436	sp|Q9BQ69|MACD1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=16120	38.640521	3	2429.243064	2428.238674	K	S	222	245
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	437	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	29-UNIMOD:4	ms_run[1]:scan=26208	57.940518	3	3632.757947	3631.790221	K	E	3500	3533
PSM	EEFLIPIYHQVAVQFADLHDTPGR	438	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=25056	55.885	4	2794.4079	2794.4079	R	M	2172	2196
PSM	EKPYFPIPEEYTFIQNVPLEDR	439	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=23771	53.476	3	2723.3483	2723.3483	K	V	444	466
PSM	FTTTLNDFNLVAMK	440	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=30409	65.573	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FVINYDYPNSSEDYVHR	441	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15582	37.623	3	2116.949	2116.9490	K	I	489	506
PSM	HVICTSEDMLNPNYEDLLIR	442	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=19752	45.538	2	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	443	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4	ms_run[2]:scan=18411	43.058	3	2559.2461	2559.2461	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	444	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4	ms_run[2]:scan=19218	44.577	4	2559.2461	2559.2461	R	S	3304	3325
PSM	IHNANPELTDGQIQAMLR	445	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16262	38.926	3	2020.016	2020.0160	K	R	2232	2250
PSM	IINEPTAAAIAYGLDR	446	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19353	44.81	3	1686.8941	1686.8941	R	T	172	188
PSM	IINEVSKPLAHHIPVEK	447	sp|P55145|MANF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8543	23.369	3	1923.0942	1923.0942	K	I	88	105
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	448	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=24711	55.262	3	3590.7109	3590.7109	R	G	3369	3401
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK	449	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=19647	45.348	4	3438.6218	3438.6218	R	I	122	155
PSM	LDYFLLSHSLLPALCDSK	450	sp|P27695|APEX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	15-UNIMOD:4	ms_run[2]:scan=25260	56.248	3	2091.0711	2091.0711	R	I	282	300
PSM	LVEALCAEHQINLIK	451	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=15396	37.307	3	1749.9447	1749.9447	K	V	64	79
PSM	NHTLALTETGSVFAFGENK	452	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18016	42.258	3	2035.0011	2035.0011	R	M	212	231
PSM	NQVAMNPTNTVFDAK	453	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13078	32.815	2	1648.7879	1648.7879	K	R	57	72
PSM	SHLLNCCPHDVLSGTR	454	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9125	24.823	3	1864.8672	1864.8672	K	M	38	54
PSM	SINPDEAVAYGAAVQAAILSGDK	455	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=26274	58.054	3	2259.1383	2259.1383	K	S	362	385
PSM	SNHNFLVQAGNVQLR	456	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14858	36.357	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	457	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15934	38.293	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	458	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16969	40.206	2	1695.8805	1695.8805	K	V	3325	3340
PSM	TCTTVAFTQVNSEDKGALAK	459	sp|P62424|RL7A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=11006	28.765	3	2140.047	2140.0470	K	L	198	218
PSM	TILGSALLEDEFTPFDVVR	460	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=33061	73.141	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	461	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=29277	63.405	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VINEPTAAALAYGLDKSEDK	462	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16780	39.874	3	2104.0688	2104.0688	R	V	219	239
PSM	VVVPIYCTSFLAVEEDKQQK	463	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=19809	45.638	3	2352.2035	2352.2035	K	I	240	260
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	464	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=26222	57.967506	3	3259.511814	3258.481778	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	465	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=29224	63.313658	3	3242.515371	3242.486863	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIR	466	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:4	ms_run[1]:scan=25314	56.341344	3	2431.150898	2431.151182	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	467	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=17980	42.190019	4	2575.249852	2575.241060	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	468	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20172	46.353948	3	2906.326676	2906.314970	R	P	3369	3395
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	469	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	35.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=30758	66.381069	5	5748.4530	5748.4572	K	Q	3401	3452
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	470	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	35.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=30307	65.323491	5	5707.4252	5705.4512	K	Q	3401	3452
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	471	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=30453	65.672983	3	3629.772570	3628.757541	K	E	3500	3533
PSM	ALAPTWEQLALGLEHSETVK	472	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=24018	53.993644	3	2193.148426	2192.147734	K	I	222	242
PSM	ADDIDIEAMLEAPYKK	473	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=24829	55.475	2	1862.8972	1862.8972	M	D	2	18
PSM	AEAQQVEALPGPSLDQWHR	474	sp|Q66PJ3-2|AR6P4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15470	37.434	3	2131.0447	2131.0447	K	S	305	324
PSM	AELVQGQSAPVGMK	475	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=15593	37.642	2	1455.7392	1455.7392	M	A	2	16
PSM	ALDVGSGSGILTACFAR	476	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=19682	45.413	2	1693.8458	1693.8458	K	M	82	99
PSM	AQQNNVEHKVETFSGVYK	477	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10547	27.72	4	2077.0229	2077.0229	K	K	161	179
PSM	AVCMLSNTTAIAEAWAR	478	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4	ms_run[2]:scan=22553	51.189	3	1863.8971	1863.8971	R	L	374	391
PSM	FAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPR	479	sp|O95881|TXD12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24740	55.316	4	4470.9962	4470.9962	K	I	76	115
PSM	FGGNPGGFGNQGGFGNSR	480	sp|Q13148|TADBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12320	31.112	2	1725.7608	1725.7608	R	G	276	294
PSM	FGQAATMEGIGAIGGTPPAFNR	481	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19574	45.223	3	2162.0579	2162.0579	R	A	346	368
PSM	FTLDCTHPVEDGIMDAANFEQFLQER	482	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=27145	59.771	3	3082.3801	3082.3801	K	I	21	47
PSM	FTTTLNDFNLVAMK	483	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:35	ms_run[2]:scan=22206	50.586	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	484	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24772	55.376	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	485	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26199	57.927	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	486	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26543	58.556	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FVINYDYPNSSEDYIHR	487	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16572	39.507	3	2130.9647	2130.9647	K	I	412	429
PSM	FVINYDYPNSSEDYVHR	488	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15629	37.705	3	2116.949	2116.9490	K	I	489	506
PSM	GHYTEGAELVDSVLDVVR	489	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24061	54.095	3	1957.9745	1957.9745	K	K	104	122
PSM	GLSEDTTEETLKESFDGSVR	490	sp|P19338|NUCL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=16364	39.127	3	2199.0179	2199.0179	K	A	578	598
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	491	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=22129	50.436	6	3590.7109	3590.7109	R	G	3369	3401
PSM	ISLGLPVGAVINCADNTGAK	492	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	13-UNIMOD:4	ms_run[2]:scan=21156	48.365	3	1969.0303	1969.0303	R	N	16	36
PSM	KALAAAGYDVEK	493	sp|P10412|H14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=6848	19.233	2	1234.6558	1234.6558	K	N	64	76
PSM	KPLPDHVSIVEPK	494	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8778	23.944	3	1457.8242	1457.8242	K	D	202	215
PSM	LEQMPSKEDAIEHFMK	495	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13701	34.24	3	1931.9121	1931.9121	K	L	601	617
PSM	LILPVGPAGGNQMLEQYDKLQDGSIK	496	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=21892	50.031	3	2783.4528	2783.4528	R	M	179	205
PSM	LYVGSLHFNITEDMLR	497	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22376	50.886	3	1906.9611	1906.9611	R	G	230	246
PSM	MKEIAEAYLGYPVTNAVITVPAYFNDSQR	498	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24186	54.333	3	3259.6224	3259.6224	K	Q	127	156
PSM	MSVQPTVSLGGFEITPPVVLR	499	sp|P06748|NPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25639	56.918	3	2226.2082	2226.2082	K	L	81	102
PSM	NQVAMNPTNTVFDAK	500	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:35	ms_run[2]:scan=10600	27.808	2	1664.7828	1664.7828	K	R	57	72
PSM	RPLDDGVGNQLGALVHQR	501	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13947	34.72	3	1944.029	1944.0290	K	T	58	76
PSM	SAAQAAAQTNSNAAGK	502	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=3302	11.195	2	1459.7015	1459.7015	K	Q	53	69
PSM	SHLLNCCPHDVLSGTR	503	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9114	24.803	3	1864.8672	1864.8672	K	M	38	54
PSM	SLVQANPEVAMDSIIHMTQHISPTQR	504	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23854	53.641	4	2902.4429	2902.4429	R	A	2306	2332
PSM	SVTNEDVTQEELGGAK	505	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9324	25.307	2	1675.7901	1675.7901	K	T	233	249
PSM	TDQVIQSLIALVNDPQPEHPLR	506	sp|P68036-2|UB2L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=26254	58.021	3	2482.318	2482.3180	K	A	69	91
PSM	TDYNASVSVPDSSGPER	507	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9846	26.366	2	1779.7911	1779.7911	R	I	70	87
PSM	TILGSALLEDEFTPFDVVR	508	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=30809	66.503	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TLTAVHDAILEDLVFPSEIVGKR	509	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24381	54.672	4	2522.3744	2522.3744	R	I	121	144
PSM	TVTNAVVTVPAYFNDSQR	510	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17754	41.691	2	1980.9905	1980.9905	K	Q	138	156
PSM	VETGVLKPGMVVTFAPVNVTTEVK	511	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20206	46.411	3	2514.3767	2514.3767	R	S	267	291
PSM	WFNGQPIHAELSPVTDFR	512	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19760	45.552	3	2113.0381	2113.0381	R	E	134	152
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	513	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=26224	57.970522	4	3242.486636	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	514	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=25847	57.27649	3	3259.497060	3258.481778	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIRK	515	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=16419	39.224182	4	2575.240849	2575.241060	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	516	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22929	51.966854	4	3590.712805	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	517	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	34.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=31566	68.723982	5	5734.4612	5732.4622	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	518	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	34.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32844	72.754002	5	5733.4542	5732.4622	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	519	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	34.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=27057	59.599982	4	5732.4579	5732.4623	K	Q	3401	3452
PSM	SVEMHHEALSEALPGDNVGFNVK	520	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=14381	35.498456	3	2480.186046	2479.180173	K	N	291	314
PSM	SVDETTQAMAFDGIIFQGQSLK	521	sp|P26368|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=23822	53.574089	3	2385.153138	2385.152227	R	I	204	226
PSM	TAFQEALDAAGDKLVVVDFSATWCGPCK	522	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	24-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=26452	58.38038	3	3057.443075	3055.441944	K	M	9	37
PSM	SAIQNLHSFDPFADASKGDDLLPAGTEDYIHIR	523	sp|P41567|EIF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	34.0	1-UNIMOD:1	ms_run[1]:scan=24815	55.450863	4	3654.7561	3654.7585	M	I	2	35
PSM	NEDEEEEEEEKDEAEDLLGR	524	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=15574	37.607664	3	2406.991229	2405.983032	K	G	434	454
PSM	IQPGQTFSVLACYNGTPSGVYQCAMRPNFTIK	525	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22457	51.019253	4	3607.731039	3604.726516	R	G	3369	3401
PSM	AMGIMNSFVNDIFER	526	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:35	ms_run[2]:scan=25593	56.838	2	1758.8069	1758.8069	K	I	59	74
PSM	ASEELQKDLEEVK	527	sp|Q9HB71|CYBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=18358	42.966	2	1558.7726	1558.7726	M	V	2	15
PSM	CPVAQLEQDDQVSPSSTFCK	528	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=14040	34.886	2	2295.0147	2295.0147	K	V	252	272
PSM	DYQDNKADVILK	529	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9202	24.998	2	1420.7198	1420.7198	R	Y	83	95
PSM	FTTTLNDFNLVAMK	530	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21913	50.068	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	531	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=23436	52.856	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	532	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=25856	57.293	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	533	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=28344	61.755	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	534	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=30111	64.942	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	535	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=32083	70.612	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	536	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14948	36.509	3	2494.0323	2494.0323	R	G	239	267
PSM	GQVLPAHTLLNTVDVELIYEGVK	537	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=24546	54.964	3	2507.3635	2507.3635	R	Y	658	681
PSM	IEDLSQQAQLAAAEK	538	sp|Q13765|NACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11981	30.533	2	1613.8261	1613.8261	K	F	128	143
PSM	IESIQLMMDSETGR	539	sp|Q14498-3|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18308	42.862	2	1608.7487	1608.7487	R	S	254	268
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	540	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14521	35.748	4	3766.8724	3766.8724	R	I	356	395
PSM	IQIASESSGIPERPCVLTGTPESIEQAK	541	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=16022	38.459	3	2996.5125	2996.5125	K	R	111	139
PSM	ISVMGGEQAANVLATITK	542	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22693	51.439	2	1801.9608	1801.9608	R	D	470	488
PSM	ITSENPDEGFKPSSGTVQELNFR	543	sp|O00763-3|ACACB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14797	36.25	3	2551.2191	2551.2191	R	S	451	474
PSM	KFYPLEIDYGQDEEAVK	544	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17073	40.4	3	2042.9837	2042.9837	K	K	637	654
PSM	KHPDSSVNFAEFSK	545	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9605	25.869	3	1591.7631	1591.7631	K	K	30	44
PSM	KSEIEYYAMLAK	546	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14945	36.502	2	1444.7272	1444.7272	R	T	57	69
PSM	KSNHNFLVQAGNVQLR	547	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=10615	27.836	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KYEDICPSTHNMDVPNIK	548	sp|P63241|IF5A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=11119	28.958	3	2159.998	2159.9980	K	R	68	86
PSM	LYVGNIPFGITEEAMMDFFNAQMR	549	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=28166	61.468	3	2793.2965	2793.2965	R	L	151	175
PSM	MTGTLETQFTCPFCNHEK	550	sp|P60002|ELOF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=15464	37.425	3	2199.9387	2199.9387	K	S	16	34
PSM	NDQDTWDYTNPNLSGQGDPGSNPNKR	551	sp|P14866-2|HNRPL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11941	30.461	3	2889.255	2889.2550	K	Q	145	171
PSM	SALSGHLETVILGLLK	552	sp|A6NMY6|AXA2L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=26984	59.465	3	1649.9716	1649.9716	K	T	89	105
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	553	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4	ms_run[2]:scan=22087	50.363	4	2994.3925	2994.3926	K	F	396	424
PSM	SHLLDCCPHDILAGTR	554	sp|Q9NQ29-2|LUC7L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=11973	30.519	3	1863.872	1863.8720	K	M	38	54
PSM	SNHNFLVQAGNVQLR	555	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=23702	53.353	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SPYQEFTDHLVK	556	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14920	36.458	2	1462.7092	1462.7092	K	T	264	276
PSM	VDCTAHSDVCSAQGVR	557	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5508	16.086	3	1760.757	1760.7570	K	G	119	135
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	558	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=26351	58.186	4	3242.4869	3242.4869	K	H	3276	3304
PSM	VIGHSMQNCVLK	559	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=7480	20.562	2	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLK	560	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=7683	21.19	2	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLK	561	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=7725	21.334	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	562	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5833	16.875	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VIKDFMIQGGDFTR	563	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15757	37.968	2	1625.8236	1625.8236	R	G	96	110
PSM	VSALNSVHCEHVEDEGESR	564	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4	ms_run[2]:scan=7097	19.789	4	2152.9444	2152.9444	R	Y	1761	1780
PSM	VYVGNLGNNGNKTELER	565	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9126	24.824	3	1875.9439	1875.9439	K	A	12	29
PSM	HVICTSEDMLNPNYEDLLIRK	566	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:4	ms_run[1]:scan=19356	44.81488	3	2559.246726	2559.246145	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	567	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22631	51.324925	4	3590.709505	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	568	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	33.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=26213	57.948118	5	5749.4532	5748.4572	K	Q	3401	3452
PSM	TILGSALLEDEFTPFDVVR	569	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=33177	73.353012	2	2121.099445	2121.099387	R	Q	3543	3562
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	570	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	29-UNIMOD:4	ms_run[1]:scan=28168	61.470554	3	3618.777722	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	571	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=28767	62.484061	3	3635.798361	3633.769486	K	E	3500	3533
PSM	EKPYFPIPEEYTFIQNVPLEDR	572	sp|Q00839|HNRPU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=23824	53.57966	3	2724.352487	2723.348284	K	V	463	485
PSM	VNPTVFFDIAVDGEPLGR	573	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	33.0		ms_run[1]:scan=26494	58.456913	2	1944.9938	1944.9940	M	V	2	20
PSM	DATNVGDEGGFAPNILENK	574	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=17777	41.739857	2	1960.918430	1959.917400	K	E	203	222
PSM	NPPGFAFVEFEDPRDAADAVR	575	sp|P84103|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=21438	49.016313	3	2321.117209	2319.092010	R	E	44	65
PSM	HVICTSEDMLNPNYEDLLIRK	576	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:4	ms_run[1]:scan=15543	37.555874	4	2560.225078	2559.246145	R	S	3304	3325
PSM	AEAEAQAEELSFPR	577	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13538	33.875	2	1546.7264	1546.7264	R	S	929	943
PSM	AVFVDLEPTVIDEVR	578	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22334	50.813	2	1700.8985	1700.8985	R	T	65	80
PSM	DAHSIHGTNPQYLVEK	579	sp|Q8NAV1|PR38A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8358	23.03	3	1807.8853	1807.8853	K	I	8	24
PSM	DLEAEHVEVEDTTLNR	580	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12008	30.579	3	1868.8752	1868.8752	R	C	15	31
PSM	ECPSDECGAGVFMASHFDR	581	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=12255	31	3	2186.8456	2186.8456	R	H	120	139
PSM	EIVHLQAGQCGNQIGAK	582	sp|P68371|TBB4B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	10-UNIMOD:4	ms_run[2]:scan=8888	24.168	3	1821.9156	1821.9156	R	F	3	20
PSM	ELAQQVQQVADDYGK	583	sp|Q92841|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16129	38.659	2	1690.8162	1690.8162	R	C	255	270
PSM	FTTTLNDFNLVAMK	584	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:35	ms_run[2]:scan=19012	44.172	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	585	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21287	48.597	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	586	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22270	50.707	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	587	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=25130	56.017	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	588	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=25486	56.644	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	589	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=26829	59.193	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	590	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=27176	59.828	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	591	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=29064	63.029	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	592	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=29774	64.304	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	593	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=30689	66.205	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	594	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=30927	66.832	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	595	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=31370	68.093	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	596	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=31916	69.983	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	GEHPGLSIGDVAK	597	sp|P09429|HMGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9413	25.474	2	1278.6568	1278.6568	K	K	115	128
PSM	GPDGLTAFEATDNQAIK	598	sp|P58546|MTPN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15359	37.24	2	1746.8424	1746.8424	K	A	98	115
PSM	GQAAVQQLQAEGLSPR	599	sp|P16152|CBR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12203	30.908	2	1651.8642	1651.8642	R	F	43	59
PSM	GTYIHALDNGLFTLGAPHKEVDEGPSPPEQFTAVK	600	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19329	44.766	5	3734.858	3734.8580	K	L	67	102
PSM	GWEEGVAQMSVGQR	601	sp|P62942|FKB1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=14894	36.416	2	1532.7042	1532.7042	R	A	59	73
PSM	HFYWYLTNEGIQYLR	602	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22097	50.381	3	2001.9737	2001.9737	R	D	66	81
PSM	HPDASVNFSEFSK	603	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11971	30.516	2	1463.6681	1463.6681	K	K	31	44
PSM	HPDSSVNFAEFSK	604	sp|P26583|HMGB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11697	30.026	2	1463.6681	1463.6681	K	K	31	44
PSM	HPELADKNVPNLHVMK	605	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9162	24.909	4	1840.9618	1840.9618	K	A	32	48
PSM	IHFPLATYAPVISAEK	606	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19430	44.953	3	1755.956	1755.9560	R	A	265	281
PSM	IHYLDTTTLIEPAPR	607	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15137	36.845	2	1738.9254	1738.9254	K	Y	90	105
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	608	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=26381	58.24	4	3590.7109	3590.7109	R	G	3369	3401
PSM	ISVMGGEQAANVLATITK	609	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22718	51.491	3	1801.9608	1801.9608	R	D	470	488
PSM	KEDLVFIFWAPESAPLK	610	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=25028	55.834	3	1989.0612	1989.0612	K	S	96	113
PSM	KLLMMAGIDDCYTSAR	611	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	11-UNIMOD:4	ms_run[2]:scan=15807	38.061	3	1843.8631	1843.8631	K	G	212	228
PSM	LAETQEEISAEVAAK	612	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11716	30.059	2	1587.7992	1587.7992	R	A	108	123
PSM	LAETQEEISAEVAAK	613	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12078	30.702	2	1587.7992	1587.7992	R	A	108	123
PSM	LFVGGIKEDTEEHHLR	614	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8767	23.924	4	1878.9588	1878.9588	K	D	114	130
PSM	LQGQLEQGDDTAAER	615	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6991	19.591	2	1629.7594	1629.7594	R	L	359	374
PSM	LVNACLAEELPHIHAFEQK	616	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4	ms_run[2]:scan=17819	41.815	4	2218.1205	2218.1205	R	T	55	74
PSM	MEEFKDQLPADECNK	617	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=9901	26.45	3	1852.7971	1852.7972	K	L	596	611
PSM	QGGGGGGGSVPGIER	618	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7050	19.694	2	1283.6218	1283.6218	K	M	350	365
PSM	QITEEDLEGKTEEEIEMMK	619	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19192	44.531	3	2281.0341	2281.0341	R	L	87	106
PSM	RFDDAVVQSDMK	620	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9156	24.895	2	1409.6609	1409.6609	R	H	77	89
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	621	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19074	44.285	5	3558.7566	3558.7566	R	L	228	261
PSM	SHLLNCCPHDVLSGTR	622	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9120	24.814	4	1864.8672	1864.8672	K	M	38	54
PSM	SIEIPRPVDGVEVPGCGK	623	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:4	ms_run[2]:scan=14820	36.292	3	1907.9775	1907.9775	K	I	410	428
PSM	TILGSALLEDEFTPFDVVR	624	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=32695	72.488	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TTGFGMIYDSLDYAK	625	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22406	50.934	2	1680.7705	1680.7705	K	K	69	84
PSM	TYDPSGDSTLPTCSK	626	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=8684	23.71	2	1627.7036	1627.7036	K	K	427	442
PSM	VADGMVFGALLPCEECSGQLVFK	627	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=25697	57.022	3	2526.1957	2526.1957	R	S	283	306
PSM	VCTLAIIDPGDSDIIR	628	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4	ms_run[2]:scan=20497	47.114	2	1756.9029	1756.9029	R	S	91	107
PSM	VDGSVNAYAINVSQK	629	sp|Q8WVK2|SNR27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11576	29.805	2	1563.7893	1563.7893	K	R	120	135
PSM	VDNDENEHQLSLR	630	sp|P06748|NPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7290	20.223	2	1567.7227	1567.7227	K	T	33	46
PSM	VEAVNMAEGIIHDTETK	631	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18597	43.387	3	1855.8986	1855.8986	R	M	579	596
PSM	VEQLGAEGNVEESQK	632	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7360	20.357	2	1615.7689	1615.7689	K	V	140	155
PSM	VIGHSMQNCVLK	633	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5585	16.227	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VSSAEGAAKEEPK	634	sp|P05114|HMGN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=3194	11.002	2	1301.6463	1301.6463	K	R	6	19
PSM	VTIAQGGVLPNIQAVLLPK	635	sp|Q7L7L0|H2A3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=24864	55.535	3	1930.1615	1930.1615	R	K	101	120
PSM	VYVGNLGNNGNKTELER	636	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9118	24.811	3	1875.9439	1875.9439	K	A	12	29
PSM	KSNHNFLVQAGNVQLR	637	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=14779	36.215082	4	1824.978559	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	638	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=21629	49.525694	2	1696.888035	1695.880501	K	V	3325	3340
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	639	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	32.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=26430	58.330574	5	5749.4532	5748.4572	K	Q	3401	3452
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	640	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	32.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=30450	65.66841	5	5748.4500	5748.4572	K	Q	3401	3452
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	641	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21952	50.132623	4	3598.675295	3596.685045	R	G	3369	3401
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	642	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23405	52.803177	4	3582.694747	3580.690130	R	G	3369	3401
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	643	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=14874	36.383533	4	3767.877726	3766.872371	R	I	356	395
PSM	LMCSLCHCPGATIGCDVK	644	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:35,3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=9832	26.340954	3	2095.882834	2093.882494	K	T	80	98
PSM	SETAPAAPAAPAPAEK	645	sp|P10412|H14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:1	ms_run[1]:scan=8877	24.137584	2	1521.7542	1519.7512	M	T	2	18
PSM	HGYEKPTPIQTQAIPAIMSGR	646	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13643	34.075318	3	2295.190336	2294.184136	K	D	390	411
PSM	NGDLDEVKDYVAK	647	sp|P58546|MTPN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=11865	30.32068	2	1465.709446	1464.709639	K	G	12	25
PSM	VLNSYWVGEDSTYK	648	sp|P61313|RL15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=15572	37.604639	2	1660.784397	1659.778053	R	F	115	129
PSM	TPENYPNAGLTMNYCR	649	sp|P00747|PLMN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	15-UNIMOD:4	ms_run[1]:scan=13439	33.694981	2	1899.823966	1899.824368	K	N	412	428
PSM	VYNVTQHAVGIVVNK	650	sp|P46778|RL21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=11652	29.946311	2	1640.907587	1639.904590	R	Q	64	79
PSM	AAIDWFDGKEFSGNPIK	651	sp|P35637|FUS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=20269	46.51602	3	1894.929887	1893.926114	K	V	349	366
PSM	EAHQLFLEPEVLDPESVELK	652	sp|P39748|FEN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=21676	49.618708	3	2323.193244	2321.179094	K	W	278	298
PSM	TPAFAESVTEGDVR	653	sp|P36957|ODO2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=12487	31.406393	2	1479.715428	1477.704888	K	W	75	89
PSM	HVICISEDMLNPNYEDLLIR	654	cov|corona03602|ORF1a_USA/FL-BPHL-0381/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4	ms_run[1]:scan=21529	49.292792	3	2446.210200	2443.187567	R	K	3304	3324
PSM	IQPGQTFSVLACYNGTPSGVYQCAMRPNFTIK	655	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20737	47.609785	4	3622.724683	3620.721431	R	G	3369	3401
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	656	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=32865	72.791018	3	3245.489645	3242.486863	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIR	657	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=19779	45.586078	2	2450.151397	2447.146097	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	658	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=17873	41.925204	4	2578.260380	2575.241060	R	S	3304	3325
PSM	AAELIANSLATAGDGLIELR	659	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=24635	55.126	3	1997.0793	1997.0793	K	K	220	240
PSM	AAGVEAAAEVAATEIK	660	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=25675	56.983	2	1541.7937	1541.7937	M	M	2	18
PSM	ADRDESSPYAAMLAAQDVAQR	661	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16842	39.982	3	2264.0492	2264.0492	K	C	64	85
PSM	AEAEAQAEELSFPR	662	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13532	33.866	2	1546.7264	1546.7264	R	S	929	943
PSM	AEAGAGSATEFQFR	663	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12600	31.649	2	1440.6634	1440.6634	K	G	140	154
PSM	AITIAGVPQSVTECVK	664	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4	ms_run[2]:scan=16481	39.33	2	1671.8866	1671.8866	R	Q	145	161
PSM	AMGIMNSFVNDIFER	665	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27143	59.765	2	1742.812	1742.8120	K	I	59	74
PSM	AMGIMNSFVNDIFER	666	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27196	59.863	3	1742.812	1742.8120	K	I	59	74
PSM	AQQNNVEHKVETFSGVYK	667	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10549	27.723	3	2077.0229	2077.0229	K	K	161	179
PSM	AYVWDNNKDLAEWLEK	668	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21977	50.173	3	1992.9581	1992.9581	K	Q	2261	2277
PSM	DNYVPEVSALDQEIIEVDPDTK	669	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=24610	55.079	3	2488.1857	2488.1857	R	E	82	104
PSM	ELVFKEDGQEYAQVIK	670	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14951	36.513	3	1894.9676	1894.9676	R	M	25	41
PSM	ERHPGSFDVVHVK	671	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6649	18.804	3	1505.7739	1505.7739	R	D	199	212
PSM	FDSNNVVLIEDNGNPVGTR	672	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16293	38.993	2	2058.997	2058.9970	R	I	100	119
PSM	FGFPEGSVELYAEK	673	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19469	45.029	2	1571.7508	1571.7508	R	V	77	91
PSM	FTTTLNDFNLVAMK	674	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	13-UNIMOD:35	ms_run[2]:scan=20037	46.068	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	675	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=22645	51.349	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	676	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=23059	52.201	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	677	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21305	48.626	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	678	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27938	61.109	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	679	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=29427	63.666	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	GGAAVDPDSGLEHSAHVLEK	680	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10062	26.744	4	1987.9599	1987.9599	K	G	529	549
PSM	GGSDDSSKDPIDVNYEK	681	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8646	23.616	3	1824.8014	1824.8014	R	L	780	797
PSM	HLESFYEKPPPGLIK	682	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12330	31.129	3	1753.9403	1753.9403	K	E	47	62
PSM	HLQDLMEGLTAK	683	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15259	37.065	2	1354.6915	1354.6915	K	V	576	588
PSM	HQGVMVGMGQK	684	sp|P63261|ACTG_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5823	16.855	2	1170.5638	1170.5638	R	D	40	51
PSM	HVICTSEDMLNPNYEDLLIR	685	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=19747	45.53	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	686	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4	ms_run[2]:scan=18888	43.927	4	2559.2461	2559.2461	R	S	3304	3325
PSM	IAPPEAPVTGYMFGK	687	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18216	42.655	2	1576.796	1576.7960	R	G	879	894
PSM	IINEPTAAAIAYGLDR	688	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19324	44.759	2	1686.8941	1686.8941	R	T	172	188
PSM	ILAGLGFDPEMQNRPTQK	689	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15599	37.651	3	2014.0306	2014.0306	R	F	396	414
PSM	INETFVDKDFVPYQDIR	690	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18117	42.437	3	2098.0371	2098.0371	K	I	139	156
PSM	ISSLLEEQFQQGK	691	sp|P62241|RS8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15099	36.776	2	1505.7726	1505.7726	K	L	158	171
PSM	IVETEAYLGPEDEAAHSR	692	sp|P29372-4|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10850	28.477	3	1985.933	1985.9330	R	G	116	134
PSM	KGTGIAAQTAGIAAAAR	693	sp|P82912-3|RT11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9315	25.291	3	1526.8529	1526.8529	K	A	89	106
PSM	KSNHNFLVQAGNVQLR	694	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10846	28.469	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	695	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11194	29.096	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	696	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12789	31.989	4	1823.9755	1823.9755	R	V	3324	3340
PSM	LAAVDATVNQVLASR	697	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18674	43.524	2	1526.8417	1526.8417	K	Y	214	229
PSM	LFVGGIKEDTEEHHLR	698	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8794	23.979	3	1878.9588	1878.9588	K	D	114	130
PSM	LNEQASEEILKVEQK	699	sp|Q01105-2|SET_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12133	30.794	3	1756.9207	1756.9207	R	Y	45	60
PSM	LPAAGVGDMVMATVK	700	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18815	43.786	3	1458.7575	1458.7575	R	K	52	67
PSM	NFILDQTNVSAAAQR	701	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14922	36.464	2	1646.8376	1646.8376	R	R	557	572
PSM	NQVALNPQNTVFDAK	702	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13705	34.25	2	1657.8424	1657.8424	K	R	57	72
PSM	QLFHPEQLITGKEDAANNYAR	703	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14372	35.482	3	2414.1979	2414.1979	R	G	85	106
PSM	SETAPAAPAAAPPAEK	704	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=8616	23.535	2	1519.7518	1519.7518	M	A	2	18
PSM	SGDHLHNDSQIEADFR	705	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=11116	28.953	3	1881.8242	1881.8242	M	L	2	18
PSM	SINQQSGAHVELQR	706	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=6513	18.45	2	1565.791	1565.7910	K	N	379	393
PSM	SKSEEAHAEDSVMDHHFR	707	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7048	19.691	4	2110.9127	2110.9127	K	K	307	325
PSM	SNHNFLVQAGNVQLR	708	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12929	32.315	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SVDETTQAMAFDGIIFQGQSLK	709	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=23758	53.451	3	2385.1522	2385.1522	R	I	204	226
PSM	TDITYPAGFMDVISIDK	710	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=24779	55.388	2	1884.9179	1884.9179	R	T	78	95
PSM	VCIESEHSMDTLLATLKK	711	sp|O00244|ATOX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=18049	42.314	4	2074.0439	2074.0439	K	T	40	58
PSM	VGNLGLATSFFNER	712	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21324	48.655	2	1523.7732	1523.7732	R	N	519	533
PSM	VIGHSMQNCVLK	713	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:4	ms_run[2]:scan=7917	21.829	2	1384.6955	1384.6955	R	L	3340	3352
PSM	VNPTVFFDIAVDGEPLGR	714	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=26471	58.414	2	1944.9945	1944.9945	M	V	2	20
PSM	VVQVSAGDSHTAALTDDGR	715	sp|P18754|RCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8299	22.916	3	1897.913	1897.9130	K	V	121	140
PSM	VWLDPNETNEIANANSR	716	sp|P84098|RL19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15663	37.768	2	1941.9181	1941.9181	K	Q	22	39
PSM	VYNVTQHAVGIVVNK	717	sp|P46778|RL21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11637	29.918	3	1639.9046	1639.9046	R	Q	64	79
PSM	YVQIPTTCANDPVGFTLK	718	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=19306	44.729	2	2023.0085	2023.0085	K	N	4349	4367
PSM	YYLCGFCPAELFTNTR	719	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=25434	56.545	3	2010.8968	2010.8968	K	S	37	53
PSM	HVICTSEDMLNPNYEDLLIRK	720	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4	ms_run[1]:scan=19040	44.220692	3	2560.230142	2559.246145	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIR	721	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=19012	44.171934	3	2447.145227	2447.146097	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	722	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=20493	47.108386	3	2447.145656	2447.146097	R	K	3304	3324
PSM	KSNHNFLVQAGNVQLR	723	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15008	36.61161	3	1824.979171	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	724	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11529	29.722409	3	1824.962857	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	725	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15381	37.280408	2	1695.881053	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	726	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=16398	39.188369	2	1695.880862	1695.880501	K	V	3325	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	727	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=25175	56.09675	3	3592.722678	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	728	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21258	48.544822	3	2906.318372	2906.314970	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	729	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22775	51.605371	3	2892.317282	2890.320055	R	P	3369	3395
PSM	FTTTLNDFNLVAMK	730	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=33063	73.143553	2	1614.813404	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	731	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=31732	69.352863	2	1614.813593	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	732	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=32240	71.237191	2	1614.813638	1613.812330	R	Y	3486	3500
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	733	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	29-UNIMOD:4	ms_run[1]:scan=32301	71.460973	3	3619.784689	3617.774571	K	E	3500	3533
PSM	LILPVGPAGGNQMLEQYDK	734	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=20819	47.769636	3	2043.052843	2042.050662	R	L	179	198
PSM	LGEMWNNTAADDKQPYEK	735	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11389	29.472161	2	2110.955418	2108.947320	K	K	129	147
PSM	AANAAENDFSVSQAEMSSR	736	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=12505	31.438088	2	1984.863284	1983.859233	K	Q	276	295
PSM	LLMMAGIDDCYTSAR	737	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	10-UNIMOD:4	ms_run[1]:scan=18780	43.720933	2	1716.772923	1715.768099	K	G	213	228
PSM	TLTAVHDAILEDLVFPSEIVGK	738	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=26153	57.844259	2	2367.274274	2366.273329	R	R	121	143
PSM	QITEEDLEGKTEEEIEMMK	739	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	17-UNIMOD:35	ms_run[1]:scan=18697	43.564976	3	2298.030770	2297.029060	R	L	87	106
PSM	GLDVDSLVIEHIQVNK	740	sp|P18621|RL17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=20054	46.112429	3	1778.962671	1777.957414	K	A	106	122
PSM	CGYPGHLTFECR	741	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=10810	28.393747	2	1496.635227	1495.633654	K	N	18	30
PSM	VRTDITYPAGFMDVISIDK	742	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=22492	51.079856	3	2143.076437	2140.087442	K	T	76	95
PSM	SNHNFLVQAGNVQLR	743	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15605	37.661982	2	1696.867879	1695.880501	K	V	3325	3340
PSM	AAAAAWEEPSSGNGTAR	744	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8518	23.325	2	1644.7492	1644.7492	K	A	6	23
PSM	AAFTAFEEAQLPR	745	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18101	42.408	2	1449.7252	1449.7252	R	L	171	184
PSM	AFVAIGDYNGHVGLGVK	746	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16275	38.955	3	1715.8995	1715.8995	K	C	126	143
PSM	AMGIMNSFVNDIFER	747	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=27147	59.774	2	1742.812	1742.8120	K	I	59	74
PSM	AYSEALAAFGNGALFVEK	748	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=23251	52.524	3	1856.9309	1856.9309	R	F	220	238
PSM	DKLNNLVLFDK	749	sp|P62851|RS25_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15839	38.121	2	1317.7293	1317.7293	R	A	42	53
PSM	EENKSDMNTVLNYIFSHAQVTK	750	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24341	54.601	4	2567.2326	2567.2326	R	K	1015	1037
PSM	ETGVDLTKDNMALQR	751	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11095	28.918	3	1689.8356	1689.8356	R	V	293	308
PSM	FSSELEQIELHNSIR	752	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15468	37.431	3	1800.9006	1800.9006	R	D	85	100
PSM	FTTTLNDFNLVAMK	753	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:35	ms_run[2]:scan=19697	45.441	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	754	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:35	ms_run[2]:scan=21853	49.957	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	755	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:35	ms_run[2]:scan=23098	52.266	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	756	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24073	54.12	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	757	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24424	54.748	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	758	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=32703	72.503	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	GAEEMETVIPVDVMR	759	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20044	46.085	2	1674.7957	1674.7957	K	R	13	28
PSM	GFGYGQGAGALVHAQ	760	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13344	33.507	2	1431.6895	1431.6895	K	-	179	194
PSM	GKVEIDQQQLTQQQLNGN	761	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10927	28.622	3	2040.0236	2040.0236	R	-	347	365
PSM	GVVDSEDLPLNISR	762	sp|P08238|HS90B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16936	40.147	2	1512.7784	1512.7784	R	E	379	393
PSM	HELQANCYEEVKDR	763	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=6490	18.413	3	1789.8053	1789.8053	K	C	133	147
PSM	HKELAPYDENWFYTR	764	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15220	36.996	3	1967.9166	1967.9166	K	A	42	57
PSM	HVICTSEDMLNPNYEDLLIR	765	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=20223	46.436	2	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIR	766	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=23443	52.867	3	2447.1461	2447.1461	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	767	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=18611	43.411	3	2559.2461	2559.2461	R	S	3304	3325
PSM	IGSFGPQEDLLFLR	768	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=23990	53.932	2	1590.8406	1590.8406	R	A	1688	1702
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	769	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=23455	52.89	3	3590.7109	3590.7109	R	G	3369	3401
PSM	IVGDLAQFMVQNGLSR	770	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=23118	52.298	3	1746.9087	1746.9087	K	A	913	929
PSM	IYAEDPSNNFMPVAGPLVHLSTPR	771	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21294	48.607	3	2624.3057	2624.3057	R	A	386	410
PSM	KSNHNFLVQAGNVQLR	772	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13168	33.099	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	773	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13461	33.735	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	774	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14646	35.978	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	775	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17141	40.589	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	776	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17667	41.534	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KVDGSVNAYAINVSQK	777	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9751	26.164	3	1691.8842	1691.8842	K	R	119	135
PSM	LGLEFFDQPAVPLAR	778	sp|P29372-4|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24068	54.11	2	1671.8984	1671.8984	R	A	81	96
PSM	LLASANLEEVTMK	779	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15613	37.676	2	1417.7487	1417.7487	K	Q	332	345
PSM	LMCSLCHCPGATIGCDVK	780	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=11191	29.089	3	2077.8876	2077.8876	K	T	80	98
PSM	LVQDVANNTNEEAGDGTTTATVLAR	781	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12334	31.135	3	2559.2413	2559.2413	K	S	97	122
PSM	LVQSPNSYFMDVK	782	sp|P42677|RS27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16447	39.273	2	1526.7439	1526.7439	R	C	24	37
PSM	MMNGGHYTYSENR	783	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6525	18.469	2	1558.6293	1558.6293	K	V	133	146
PSM	NQLTSNPENTVFDAK	784	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12710	31.851	2	1676.8006	1676.8006	K	R	82	97
PSM	NTHATTHNAYDLEVIDIFK	785	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19730	45.498	4	2201.0753	2201.0753	K	I	820	839
PSM	NVVHQLSVTLEDLYNGATR	786	sp|P31689-2|DNJA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=25819	57.228	3	2128.0913	2128.0913	K	K	106	125
PSM	PASESPHHHTAPAK	787	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1909	8.4535	4	1465.7062	1465.7062	R	S	59	73
PSM	QAVTNPNNTFYATK	788	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9132	24.84	2	1567.7631	1567.7631	R	R	108	122
PSM	QPYAVSELAGHQTSAESWGTGR	789	sp|P36578|RL4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13799	34.446	3	2331.088	2331.0880	R	A	50	72
PSM	SHLLDCCPHDILAGTR	790	sp|Q9NQ29-2|LUC7L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=12007	30.578	4	1863.872	1863.8720	K	M	38	54
PSM	SLESTTLTEKEGEIYCK	791	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	16-UNIMOD:4	ms_run[2]:scan=11646	29.935	3	1986.9456	1986.9456	K	G	152	169
PSM	SNHNFLVQAGNVQLR	792	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12745	31.913	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	793	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=29813	64.375	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	794	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24475	54.836	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	795	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19450	44.995	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	796	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21161	48.373	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SQIFSTASDNQPTVTIK	797	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13545	33.888	2	1835.9265	1835.9265	K	V	448	465
PSM	SQVFSTAADGQTQVEIK	798	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12392	31.234	2	1807.8952	1807.8952	K	V	469	486
PSM	TGTAEMSSILEER	799	sp|P25705|ATPA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14592	35.885	2	1422.6661	1422.6661	K	I	46	59
PSM	TKEEALELINGYIQK	800	sp|Q13526|PIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18407	43.049	3	1747.9356	1747.9356	R	I	81	96
PSM	TVTAMDVVYALKR	801	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18847	43.844	2	1465.7963	1465.7963	K	Q	81	94
PSM	TVTNAVVTVPAYFNDSQR	802	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17772	41.73	3	1980.9905	1980.9905	K	Q	138	156
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	803	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=24684	55.214	3	3258.4818	3258.4818	K	H	3276	3304
PSM	VIGHSMQNCVLK	804	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5250	15.595	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	805	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=7538	20.67	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VLGVPIIVQASQAEK	806	sp|Q14498-3|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18744	43.655	3	1550.9032	1550.9032	R	N	196	211
PSM	VLLESEQFLTELTR	807	sp|P37108|SRP14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=24233	54.413	2	1676.8985	1676.8985	M	L	2	16
PSM	VVHSYEELEENYTR	808	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11651	29.945	2	1766.8111	1766.8111	R	A	206	220
PSM	YFQINQDEEEEEDED	809	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14321	35.39	2	1930.7228	1930.7228	R	-	114	129
PSM	YYLCGFCPAELFTNTR	810	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=25495	56.66	2	2010.8968	2010.8968	K	S	37	53
PSM	GLAPVQAYLHIPDIIK	811	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=22865	51.839916	3	1748.007777	1747.003242	R	V	89	105
PSM	GLAPVQAYLHIPDIIK	812	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=23118	52.297567	3	1747.004577	1747.003242	R	V	89	105
PSM	AEAEAQAEELSFPR	813	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13573	33.937067	2	1546.728875	1546.726351	R	S	929	943
PSM	HVICTSEDMLNPNYEDLLIRK	814	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4	ms_run[1]:scan=17911	42.037853	5	2559.246844	2559.246145	R	S	3304	3325
PSM	KSNHNFLVQAGNVQLR	815	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=23734	53.409288	3	1824.978825	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	816	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13032	32.683734	3	1825.982700	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	817	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14601	35.901061	3	1823.976147	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	818	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=18886	43.924171	2	1696.880900	1695.880501	K	V	3325	3340
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	819	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	29-UNIMOD:4	ms_run[1]:scan=29365	63.554054	4	3632.783650	3631.790221	K	E	3500	3533
PSM	HVICTSEDMFNPNYEDLLIRK	820	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=15575	37.609178	3	2610.233827	2609.225410	R	S	3304	3325
PSM	IINEPTAAAIAYGLDR	821	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=19488	45.064624	2	1686.894573	1686.894085	R	T	172	188
PSM	QTQIFTTYSDNQPGVLIQVYEGER	822	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=22665	51.384238	3	2785.358575	2785.355889	K	A	424	448
PSM	VNDTIQIDLETGKITDFIK	823	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=22421	50.959203	3	2163.148476	2162.147065	K	F	156	175
PSM	VTVAGLAGKDPVQCSR	824	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	14-UNIMOD:4	ms_run[1]:scan=9937	26.514723	3	1656.863099	1656.861740	K	D	33	49
PSM	CGFCHVGEEENEAR	825	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=11020	28.790567	2	1675.6349	1675.6350	K	G	212	226
PSM	IGDQEFDHLPALLEFYK	826	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=24935	55.667093	3	2034.011613	2034.009844	K	I	73	90
PSM	TVTAMDVVYALKR	827	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=18830	43.813841	2	1465.796679	1465.796286	K	Q	81	94
PSM	GSYGDLGGPIITTQVTIPK	828	sp|P61978|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=19494	45.073694	2	1917.027805	1916.025494	R	D	378	397
PSM	LQVEHPVTECITGLDLVQEMIR	829	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	10-UNIMOD:4	ms_run[1]:scan=24865	55.536381	3	2580.314136	2579.308745	R	V	354	376
PSM	NDEELNKLLGK	830	sp|P20671|H2A1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=12938	32.350405	2	1272.676121	1271.672131	R	V	90	101
PSM	VLDCGAAPGAWSQVAVQK	831	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	4-UNIMOD:4	ms_run[1]:scan=14984	36.570934	2	1856.927625	1855.925068	R	V	76	94
PSM	TYDPSGDSTLPTCSK	832	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	13-UNIMOD:4	ms_run[1]:scan=8671	23.679812	2	1628.706173	1627.703567	K	K	427	442
PSM	SNHNFLVQAGNVQLR	833	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=17286	40.855685	2	1696.870540	1695.880501	K	V	3325	3340
PSM	GHYTEGAELVDSVLDVVR	834	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=24150	54.268188	2	1958.958415	1957.974521	K	K	104	122
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	835	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=32284	71.409246	3	3631.749899	3628.757541	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	836	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=27961	61.14289	3	3649.765814	3647.785136	K	E	3500	3533
PSM	AEEGIAAGGVMDVNTALQEVLK	837	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=27943	61.115	3	2256.1308	2256.1308	M	T	2	24
PSM	AEQLGAEGNVDESQK	838	sp|Q9NQ29-2|LUC7L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6409	18.258	2	1573.722	1573.7220	K	I	140	155
PSM	AGQSVIGLQMGTNK	839	sp|Q15417-3|CNN3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12114	30.763	2	1402.7238	1402.7238	K	C	113	127
PSM	AGTGVDNVDLEAATR	840	sp|O43175|SERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11192	29.09	2	1487.7216	1487.7216	R	K	76	91
PSM	AQIHDLVLVGGSTR	841	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11971	30.516	2	1464.8049	1464.8049	K	I	329	343
PSM	ATENDIYNFFSPLNPVR	842	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=25537	56.735	2	1995.969	1995.9690	K	V	300	317
PSM	DSSTCPGDYVLSVSENSR	843	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=16099	38.604	2	1971.848	1971.8480	R	V	40	58
PSM	DVQIGDIVTVGECRPLSK	844	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:4	ms_run[2]:scan=17597	41.405	3	1985.0252	1985.0252	R	T	119	137
PSM	DYLHLPPEIVPATLR	845	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21547	49.342	3	1732.9512	1732.9512	R	R	81	96
PSM	DYLHLPPEIVPATLR	846	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21620	49.507	3	1732.9512	1732.9512	R	R	81	96
PSM	ERHPGSFDVVHVK	847	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6660	18.83	3	1505.7739	1505.7739	R	D	199	212
PSM	FSVCVLGDQQHCDEAK	848	sp|P62906|RL10A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	4-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=11786	30.183	3	1891.8193	1891.8193	K	A	63	79
PSM	FTTTLNDFNLVAMK	849	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:35	ms_run[2]:scan=23880	53.693	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	850	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:35	ms_run[2]:scan=24209	54.372	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	851	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	13-UNIMOD:35	ms_run[2]:scan=25591	56.835	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	852	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21579	49.416	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	853	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=27534	60.462	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	GGAAVDPDSGLEHSAHVLEK	854	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10051	26.723	3	1987.9599	1987.9599	K	G	529	549
PSM	GISLNPEQWSQLK	855	sp|P53999|TCP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20162	46.339	2	1498.778	1498.7780	K	E	102	115
PSM	GLAPDLPEDLYHLIK	856	sp|P62277|RS13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23777	53.487	3	1692.9087	1692.9087	K	K	79	94
PSM	GSMVGPFQEAAFALPVSGMDKPVFTDPPVK	857	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=24957	55.703	3	3118.5508	3118.5508	R	T	88	118
PSM	GYGFITFSDSECAK	858	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=18002	42.231	2	1580.6817	1580.6817	K	K	270	284
PSM	GYGYGQGAGTLNMDR	859	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11364	29.425	2	1558.6834	1558.6834	K	G	70	85
PSM	HTGPNSPDTANDGFVR	860	sp|P31943|HNRH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6961	19.538	3	1683.7601	1683.7601	K	L	99	115
PSM	IEEIKDFLLTAR	861	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18809	43.777	3	1446.8082	1446.8082	K	R	5	17
PSM	IINEPTAAAIAYGLDK	862	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18748	43.661	2	1658.8879	1658.8879	R	R	198	214
PSM	IITITGTQDQIQNAQYLLQNSVK	863	sp|P61978-3|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23461	52.899	3	2588.381	2588.3810	R	Q	410	433
PSM	KASGPPVSELITK	864	sp|P10412|H14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9610	25.878	2	1325.7555	1325.7555	R	A	34	47
PSM	KFLDGIYVSEK	865	sp|P32969|RL9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12855	32.092	2	1297.6918	1297.6918	R	G	174	185
PSM	KHPDSSVNFAEFSK	866	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9623	25.902	2	1591.7631	1591.7631	K	K	30	44
PSM	KSNHNFLVQAGNVQLR	867	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19606	45.279	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	868	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20219	46.43	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	869	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11878	30.35	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	870	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12961	32.433	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	871	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23204	52.439	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KTAEAGGVTGK	872	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2228	8.9991	2	1017.5455	1017.5455	K	G	87	98
PSM	LGEMWNNLNDSEKQPYITK	873	sp|O15347|HMGB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15492	37.47	3	2279.0892	2279.0892	K	A	127	146
PSM	LGGSAVISLEGKPL	874	sp|P23528|COF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17448	41.14	2	1339.7711	1339.7711	K	-	153	167
PSM	LHISPSNMTNQNTNEYLEK	875	sp|Q13547|HDAC1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12029	30.615	3	2232.0481	2232.0481	K	I	343	362
PSM	LHISPSNMTNQNTPEYMEK	876	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11578	29.81	3	2233.0144	2233.0144	K	I	314	333
PSM	LLHYLGHVMVNGPTTPIPVK	877	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15170	36.906	3	2185.2082	2185.2082	K	A	500	520
PSM	MAIMVQSPMFDGK	878	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18527	43.259	2	1453.6768	1453.6768	R	V	35	48
PSM	MGPAMGPALGAGIER	879	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14409	35.55	2	1426.7061	1426.7061	R	M	553	568
PSM	RPLDDGVGNQLGALVHQR	880	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13939	34.706	4	1944.029	1944.0290	K	T	58	76
PSM	SDAYYCTGDVTAWTK	881	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=15646	37.738	2	1736.7352	1736.7352	K	C	306	321
PSM	SFYPEEVSSMVLTK	882	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20390	46.872	3	1615.7804	1615.7804	K	M	113	127
PSM	SNHNFLVQAGNVQLR	883	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5095	15.31	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	884	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13037	32.697	4	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	885	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21485	49.181	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	886	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=24775	55.382	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SPWSNKYDPPLEDGAMPSAR	887	sp|P47756-2|CAPZB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14469	35.655	3	2217.0161	2217.0161	R	L	73	93
PSM	SPYQEFTDHLVK	888	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14836	36.318	3	1462.7092	1462.7092	K	T	264	276
PSM	SQVFSTAADGQTQVEIK	889	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12344	31.152	2	1807.8952	1807.8952	K	V	469	486
PSM	SSGPYGGGGQYFAKPR	890	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8928	24.271	3	1627.7743	1627.7743	R	N	232	248
PSM	SSQSSSQQFSGIGR	891	sp|Q92841|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7858	21.695	2	1454.675	1454.6750	R	S	671	685
PSM	SYGRPPPDVEGMTSLK	892	sp|Q01130|SRSF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=14859	36.358	2	1774.856	1774.8560	M	V	2	18
PSM	TANKDHLVTAYNHLFETK	893	sp|Q00688|FKBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11995	30.558	4	2101.0593	2101.0593	K	R	53	71
PSM	TGTAYTFFTPNNIK	894	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17831	41.836	2	1573.7777	1573.7777	K	Q	438	452
PSM	THINIVVIGHVDSGK	895	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10973	28.707	3	1587.8733	1587.8733	K	S	6	21
PSM	TKPADMVIEAYGHGQR	896	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10860	28.498	3	1771.8676	1771.8676	K	T	48	64
PSM	TTPSYVAFTDTER	897	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13001	32.579	2	1486.694	1486.6940	R	L	37	50
PSM	TYHEVVDEIYFK	898	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14689	36.054	2	1541.7402	1541.7402	K	V	81	93
PSM	VAHEDPMYDIIR	899	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13744	34.342	2	1457.6973	1457.6973	R	D	135	147
PSM	VCEEIAIIPSKK	900	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=10468	27.546	2	1385.7588	1385.7588	R	L	34	46
PSM	VCTLAIIDPGDSDIIR	901	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=20537	47.183	3	1756.9029	1756.9029	R	S	91	107
PSM	VHVGDEDFVHLR	902	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11141	28.998	3	1421.7052	1421.7052	K	V	57	69
PSM	VIGHSMQNCVLK	903	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=10465	27.538	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VNQIGSVTESLQACK	904	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=12754	31.929	2	1632.8141	1632.8141	K	L	344	359
PSM	YLGINSDGLVVGR	905	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17519	41.263	2	1361.7303	1361.7303	K	S	116	129
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	906	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	29-UNIMOD:4	ms_run[2]:scan=30553	65.878	3	3617.7746	3617.7746	K	E	3500	3533
PSM	MADHYVPVPGGPNNNNYANVELILDIAK	907	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=24175	54.310788	3	3038.516562	3037.496756	K	R	171	199
PSM	MMYGVSPWGDSPIDFEDSAHVPCPR	908	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	23-UNIMOD:4	ms_run[1]:scan=22033	50.273049	3	2851.235190	2849.224757	R	G	478	503
PSM	KSNHNFLVQAGNVQLR	909	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=12599	31.647264	3	1824.967816	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	910	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=16224	38.836586	3	1823.976576	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	911	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=7534	20.665768	2	1696.881199	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	912	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=5470	16.020576	2	1696.882395	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	913	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	29.0		ms_run[1]:scan=30242	65.199894	2	1697.9052	1695.8802	K	V	3325	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	914	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=25015	55.809631	4	3590.712313	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	915	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21793	49.841215	3	3607.717611	3606.705781	R	G	3369	3401
PSM	FTTTLNDFNLVAMK	916	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=21405	48.916617	2	1613.812956	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	917	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=22958	52.025081	2	1613.812295	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	918	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:35	ms_run[1]:scan=24858	55.52586	2	1629.807542	1629.807245	R	Y	3486	3500
PSM	SDGTGTIYTELEPPCR	919	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	15-UNIMOD:4	ms_run[1]:scan=15372	37.264329	2	1794.812849	1794.809429	K	F	4199	4215
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	920	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	29-UNIMOD:4	ms_run[1]:scan=30174	65.069091	3	3619.763371	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	921	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	29-UNIMOD:4	ms_run[1]:scan=29295	63.435098	3	3619.786159	3617.774571	K	E	3500	3533
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	922	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	29.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=27286	60.038227	5	5707.4272	5705.4512	K	Q	3401	3452
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	923	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21844	49.938996	3	3598.673288	3596.685045	R	G	3369	3401
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	924	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21876	49.999608	4	3581.674792	3580.653745	R	G	3369	3401
PSM	THINIVVIGHVDSGK	925	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=10710	28.068687	3	1588.876654	1587.873290	K	S	6	21
PSM	VIKDFMIQGGDFTR	926	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=15986	38.389041	2	1625.823781	1625.823563	R	G	96	110
PSM	SGDHLHNDSQIEADFR	927	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:1	ms_run[1]:scan=11281	29.268949	3	1881.8246	1881.8236	M	L	2	18
PSM	KIWCFGPDGTGPNILTDITK	928	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4	ms_run[1]:scan=22563	51.206203	3	2232.138682	2232.124890	R	G	648	668
PSM	MMCGAPSATQPATAETQHIADQVR	929	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=16739	39.802084	3	2612.179544	2612.178142	-	S	1	25
PSM	FTLDCTHPVEDGIMDAANFEQFLQER	930	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4	ms_run[1]:scan=27222	59.912794	4	3083.380081	3082.380072	K	I	21	47
PSM	VAVEYLDPSPEVQK	931	sp|O43684|BUB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=13279	33.37856	2	1574.805452	1572.803539	R	K	203	217
PSM	LVNLQHLDLLNNK	932	sp|Q96AG4|LRC59_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=17221	40.745042	3	1532.869615	1532.867477	R	L	84	97
PSM	SGQVYSFGCNDEGALGR	933	sp|P18754|RCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	9-UNIMOD:4	ms_run[1]:scan=13563	33.91955	2	1816.786595	1815.784612	K	D	85	102
PSM	HVICTSEDMLNPNYEDLLIRK	934	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	4-UNIMOD:4	ms_run[1]:scan=19082	44.29929	3	2560.230142	2559.246145	R	S	3304	3325
PSM	AEYLASIFGTEK	935	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=28029	61.253	2	1369.6765	1369.6765	M	D	2	14
PSM	ALTVPELTQQVFDAK	936	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22283	50.729	2	1658.8879	1658.8879	R	N	283	298
PSM	AMGIMNSFVNDIFER	937	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:35	ms_run[2]:scan=25705	57.037	3	1758.8069	1758.8069	K	I	59	74
PSM	ATENDIYNFFSPLNPVR	938	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25511	56.687	3	1995.969	1995.9690	K	V	300	317
PSM	AVFVDLEPTVIDEVR	939	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22391	50.91	3	1700.8985	1700.8985	R	T	65	80
PSM	CCLTYCFNKPEDK	940	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10347	27.255	3	1733.7211	1733.7211	K	-	144	157
PSM	DFLAGGVAAAISK	941	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=18805	43.771	2	1218.6608	1218.6608	K	T	11	24
PSM	DISEASVFDAYVLPK	942	sp|P62854|RS26_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23402	52.799	2	1652.8298	1652.8298	R	L	52	67
PSM	EGDVLTLLESER	943	sp|P62857|RS28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21338	48.688	2	1359.6882	1359.6882	R	E	52	64
PSM	EKQSEDTNTESK	944	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1917	8.4651	2	1394.6161	1394.6161	R	E	397	409
PSM	FNEVAAQYSEDKAR	945	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7872	21.724	3	1626.7638	1626.7638	R	Q	64	78
PSM	FTTTLNDFNLVAMK	946	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=19699	45.443	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	947	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=19351	44.808	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	948	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=20891	47.897	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	949	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=21348	48.728	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	950	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	13-UNIMOD:35	ms_run[2]:scan=27014	59.521	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	951	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23780	53.494	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	952	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22183	50.542	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	953	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=24197	54.352	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FVDGLMIHSGDPVNYYVDTAVR	954	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20850	47.827	3	2467.1842	2467.1842	K	H	152	174
PSM	FVLALLSDLQDLK	955	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=27683	60.707	2	1473.8443	1473.8443	R	W	4180	4193
PSM	GFAFVTFDDHDSVDKIVIQK	956	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19700	45.445	4	2280.1426	2280.1426	R	Y	147	167
PSM	GSDEVQILEMPSK	957	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14981	36.564	2	1431.6915	1431.6915	R	T	136	149
PSM	HHEEEIVHHKK	958	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=1869	8.3793	3	1421.7164	1421.7164	K	E	73	84
PSM	HSGNITFDEIVNIAR	959	sp|P30050|RL12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19718	45.475	3	1684.8533	1684.8533	K	Q	100	115
PSM	HVICTSEDMFNPNYEDLLIR	960	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=20408	46.92	2	2481.1304	2481.1304	R	K	3304	3324
PSM	HVICTSEDMLNPNYEDLLIRK	961	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=15162	36.892	4	2575.2411	2575.2411	R	S	3304	3325
PSM	IHFPLATYAPVISAEK	962	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19091	44.32	3	1755.956	1755.9560	R	A	265	281
PSM	IHYLDTTTLIEPAPR	963	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15017	36.627	3	1738.9254	1738.9254	K	Y	90	105
PSM	IHYLDTTTLIEPAPR	964	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15121	36.816	2	1738.9254	1738.9254	K	Y	90	105
PSM	IKGEHPGLSIGDVAK	965	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8369	23.053	2	1519.8358	1519.8358	K	K	113	128
PSM	ILIANTGMDTDKIK	966	sp|P78371-2|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11887	30.365	3	1531.828	1531.8280	K	I	190	204
PSM	IQIASESSGIPERPCVLTGTPESIEQAK	967	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	15-UNIMOD:4	ms_run[2]:scan=15869	38.176	3	2996.5125	2996.5125	K	R	111	139
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	968	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=25259	56.246	3	2890.3201	2890.3201	R	P	3369	3395
PSM	ITLEAVLNTTCK	969	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=18426	43.081	2	1361.7225	1361.7225	K	K	99	111
PSM	KGISLNPEQWSQLK	970	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17099	40.47	3	1626.873	1626.8730	R	E	101	115
PSM	KLLMMAGIDDCYTSAR	971	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=15793	38.034	3	1843.8631	1843.8631	K	G	212	228
PSM	KNPEVPVNFAEFSK	972	sp|O15347|HMGB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15269	37.082	3	1604.8199	1604.8199	K	K	30	44
PSM	KSNHNFLVQAGNVQLR	973	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10653	27.915	5	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	974	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10732	28.141	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	975	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11013	28.778	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	976	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17310	40.896	4	1823.9755	1823.9755	R	V	3324	3340
PSM	LAETQEEISAEVAAK	977	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11407	29.503	3	1587.7992	1587.7992	R	A	108	123
PSM	LGEMWNNLNDSEK	978	sp|O15347|HMGB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14564	35.834	2	1548.6879	1548.6879	K	Q	127	140
PSM	LGSTVVDLSVPGK	979	sp|Q86U90|YRDC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13991	34.801	2	1270.7133	1270.7133	R	F	236	249
PSM	LHFFMPGFAPLTSR	980	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22320	50.789	3	1619.8283	1619.8283	R	G	263	277
PSM	LIDLHSPSEIVK	981	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12727	31.881	2	1349.7555	1349.7555	R	Q	88	100
PSM	LMEEIMSEKENK	982	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9485	25.603	2	1479.6949	1479.6949	R	T	332	344
PSM	LTEVPVEPVLTVHPESK	983	sp|Q9H307|PININ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14393	35.521	3	1873.0197	1873.0197	K	S	537	554
PSM	LVNHFVEEFKR	984	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10407	27.371	3	1416.7514	1416.7514	R	K	237	248
PSM	LVNLQHLDLLNNK	985	sp|Q96AG4|LRC59_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17236	40.771	3	1532.8675	1532.8675	R	L	84	97
PSM	MSDLTPVHFTPLDSSVDR	986	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17274	40.834	3	2015.9622	2015.9622	R	V	194	212
PSM	MSSYAFFVQTCR	987	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=16356	39.113	2	1511.6537	1511.6537	K	E	13	25
PSM	NCLTNFHGMDLTR	988	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=14025	34.861	3	1577.7079	1577.7079	K	D	95	108
PSM	NLDIERPTYTNLNR	989	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11816	30.235	3	1717.8747	1717.8747	R	L	216	230
PSM	QVMGLITHTDSPYIR	990	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14475	35.667	3	1729.8821	1729.8821	K	A	144	159
PSM	QVTITGSAASISLAQYLINAR	991	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25515	56.693	3	2176.1852	2176.1852	R	L	326	347
PSM	SFYPEEVSSMVLTK	992	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20358	46.789	2	1615.7804	1615.7804	K	M	113	127
PSM	SGGASHSELIHNLR	993	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6438	18.316	2	1476.7433	1476.7433	K	K	5	19
PSM	SHTILLVQPTK	994	sp|P84090|ERH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=13107	32.915	2	1277.7343	1277.7343	M	R	2	13
PSM	SNHNFLVQAGNVQLR	995	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12835	32.064	4	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	996	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15845	38.133	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	997	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19673	45.396	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	998	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21788	49.831	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	999	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22149	50.473	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1000	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23175	52.392	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1001	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=24427	54.755	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1002	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=27971	61.161	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1003	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=29465	63.734	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1004	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=30141	65.006	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLRVIGHSMQNCVLK	1005	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	24-UNIMOD:4	ms_run[2]:scan=18044	42.304	5	3062.5655	3062.5655	K	L	3325	3352
PSM	SYGRPPPDVEGMTSLK	1006	sp|Q01130|SRSF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=14869	36.373	2	1774.856	1774.8560	M	V	2	18
PSM	TEVNYTQLVDLHAR	1007	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15299	37.137	3	1657.8424	1657.8424	K	Y	49	63
PSM	THINIVVIGHVDSGK	1008	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10909	28.588	3	1587.8733	1587.8733	K	S	6	21
PSM	TIAECLADELINAAK	1009	sp|P46782|RS5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=26363	58.207	3	1630.8236	1630.8236	K	G	168	183
PSM	TPVEPEVAIHR	1010	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8145	22.532	3	1246.667	1246.6670	K	I	9	20
PSM	TVAIYSEQDTGQMHR	1011	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8541	23.364	3	1734.7995	1734.7995	R	Q	63	78
PSM	TYHYHCGVQDK	1012	sp|Q8IWS0-3|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:4	ms_run[2]:scan=3679	11.87	3	1406.6037	1406.6037	K	A	299	310
PSM	VCEVCSAYLGLHDNDR	1013	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=11978	30.529	3	1906.8302	1906.8302	R	R	189	205
PSM	VIGHSMQNCVLK	1014	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=7463	20.53	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLK	1015	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	9-UNIMOD:4	ms_run[2]:scan=7677	21.164	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VKEGMNIVEAMER	1016	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13620	34.025	2	1504.7378	1504.7378	K	F	132	145
PSM	VLEQLTGQTPVFSK	1017	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15538	37.549	2	1545.8403	1545.8403	K	A	39	53
PSM	VNPTVFFDIAVDGEPLGR	1018	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=26407	58.29	3	1944.9945	1944.9945	M	V	2	20
PSM	YFQINQDEEEEEDED	1019	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14286	35.319	2	1930.7228	1930.7228	R	-	114	129
PSM	YHTINGHNAEVR	1020	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=3892	12.519	3	1409.68	1409.6800	K	K	174	186
PSM	YLYTLVITDKEK	1021	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14711	36.093	2	1484.8126	1484.8126	R	A	41	53
PSM	YSQVLANGLDNK	1022	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10149	26.899	2	1320.6674	1320.6674	K	L	95	107
PSM	DVDDGLQAAEEVGYPVMIK	1023	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=21997	50.207738	2	2047.962742	2047.977223	K	A	293	312
PSM	LPGGNEIGMVAWK	1024	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=18057	42.328303	2	1371.702025	1370.701657	R	M	1651	1664
PSM	VVEIAPAAHLDPQLR	1025	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=13769	34.391051	2	1628.911328	1627.904590	K	T	274	289
PSM	KSNHNFLVQAGNVQLR	1026	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=21198	48.442185	4	1824.978691	1823.975464	R	V	3324	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1027	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20657	47.436686	4	3606.703660	3606.705781	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	1028	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26345	58.176696	5	5734.4662	5732.4622	K	Q	3401	3452
PSM	FTTTLNDFNLVAMK	1029	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=21351	48.73965	2	1613.812956	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1030	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	13-UNIMOD:35	ms_run[1]:scan=26624	58.748521	2	1630.809759	1629.807245	R	Y	3486	3500
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	1031	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=15388	37.290985	3	3768.882007	3766.872371	R	I	356	395
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	1032	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=19277	44.680339	4	3102.396396	3101.400273	K	I	20	47
PSM	MAVTFIGNSTAIQELFK	1033	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=26245	58.007835	3	1869.972944	1868.970621	K	R	363	380
PSM	LAETQEEISAEVAAK	1034	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=14193	35.154227	2	1589.805648	1587.799182	R	A	108	123
PSM	ALMLQGVDLLADAVAVTMGPK	1035	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=28143	61.432565	3	2113.141343	2112.132284	R	G	38	59
PSM	HLILVVNYSCPNHYEDYVHR	1036	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	10-UNIMOD:4	ms_run[1]:scan=14454	35.63033	4	2527.207246	2527.206663	K	A	687	707
PSM	LPAAGVGDMVMATVK	1037	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=19056	44.249525	2	1458.757235	1458.757457	R	K	52	67
PSM	VCTLAIIDPGDSDIIR	1038	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	2-UNIMOD:4	ms_run[1]:scan=20577	47.251379	2	1756.902468	1756.902936	R	S	91	107
PSM	QYTSPEEIDAQLQAEK	1039	sp|Q13442|HAP28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=14462	35.644932	2	1849.871311	1848.874138	R	Q	16	32
PSM	MQTDKPFDQTTISLQMGTNK	1040	sp|Q15417|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=14982	36.565346	3	2284.091228	2283.087518	K	G	193	213
PSM	SDKTEEIAEEEETVFPK	1041	sp|Q9NR30|DDX21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=14636	35.960309	3	1979.920712	1979.921148	K	A	38	55
PSM	VDQETLTEMVKPSIDYVR	1042	sp|Q9NS86|LANC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=18433	43.097185	3	2123.066583	2122.061621	K	H	280	298
PSM	HVICTSEDMLNPNYEDLLIR	1043	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=19697	45.441059	3	2447.146108	2447.146097	R	K	3304	3324
PSM	ADGQVAELLLR	1044	sp|Q9Y285-2|SYFA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=24733	55.303	2	1225.6667	1225.6667	M	R	2	13
PSM	AITGASLADIMAK	1045	sp|P83731|RL24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18185	42.579	2	1260.6748	1260.6748	R	R	81	94
PSM	AITHLNNNFMFGQK	1046	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13731	34.314	3	1633.8035	1633.8035	R	L	302	316
PSM	ALTVPELTQQVFDAK	1047	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22280	50.724	3	1658.8879	1658.8879	R	N	283	298
PSM	AYKDYLASGGQPITNCVK	1048	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	16-UNIMOD:4	ms_run[2]:scan=11720	30.065	3	1983.9724	1983.9724	K	M	4279	4297
PSM	CGHTNNLRPK	1049	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=2192	8.9471	2	1195.588	1195.5880	K	K	115	125
PSM	DTGKTPVEPEVAIHR	1050	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7820	21.613	3	1647.858	1647.8580	K	I	5	20
PSM	DTNGSQFFITTVK	1051	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17140	40.588	2	1456.7198	1456.7198	K	T	146	159
PSM	DVVICPDASLEDAKK	1052	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=11349	29.401	2	1658.8185	1658.8185	R	E	49	64
PSM	EGKPTIVEEDDPELFK	1053	sp|O75937|DNJC8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13936	34.697	3	1844.9044	1844.9044	K	Q	144	160
PSM	EGRPSGEAFVELESEDEVK	1054	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14190	35.15	3	2105.9753	2105.9753	R	L	50	69
PSM	ELAILLGMLDPAEKDEK	1055	sp|P30041|PRDX6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24422	54.742	3	1883.9914	1883.9914	R	G	109	126
PSM	ERVEAVNMAEGIIHDTETK	1056	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17477	41.188	3	2141.0423	2141.0423	K	M	577	596
PSM	ESTGAQVQVAGDMLPNSTER	1057	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13251	33.324	3	2088.9746	2088.9746	R	A	125	145
PSM	FDTGNLCMVTGGANLGR	1058	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=17638	41.483	3	1781.8189	1781.8189	K	I	175	192
PSM	FNEVAAQYSEDK	1059	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8929	24.273	2	1399.6256	1399.6256	R	A	64	76
PSM	FTTTLNDFNLVAMK	1060	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=21540	49.325	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1061	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=21591	49.444	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1062	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=23543	53.059	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1063	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=25233	56.201	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1064	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=29942	64.617	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1065	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=30296	65.299	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1066	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=31042	67.141	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1067	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21513	49.259	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1068	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23206	52.444	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1069	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=27338	60.132	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1070	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=28717	62.398	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1071	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=31565	68.722	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1072	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=32416	71.868	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FVLALLSDLQDLK	1073	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=27698	60.731	2	1473.8443	1473.8443	R	W	4180	4193
PSM	GADINAPDKHHITPLLSAVYEGHVSCVK	1074	sp|P58546|MTPN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	26-UNIMOD:4	ms_run[2]:scan=14175	35.124	5	3027.5236	3027.5236	K	L	58	86
PSM	GFGDGYNGYGGGPGGGNFGGSPGYGGGR	1075	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14963	36.532	3	2494.0323	2494.0323	R	G	239	267
PSM	GGFCNFMHLKPISR	1076	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=14899	36.423	4	1662.8123	1662.8123	R	E	166	180
PSM	GHAVGDIPGVR	1077	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7517	20.621	2	1076.5727	1076.5727	K	F	109	120
PSM	GKDSLYAQGK	1078	sp|P83881|RL36A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3728	12.002	2	1065.5455	1065.5455	K	R	29	39
PSM	GLAPVQAYLHIPDIIK	1079	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22974	52.054	3	1747.0032	1747.0032	R	V	89	105
PSM	GLCAIAQAESLR	1080	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=14525	35.757	2	1287.6605	1287.6605	R	Y	95	107
PSM	GMGGAFVLVLYDELKK	1081	sp|P12236|ADT3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25433	56.543	3	1738.9328	1738.9328	R	V	281	297
PSM	GMGGAFVLVLYDELKK	1082	sp|P12236|ADT3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25601	56.85	3	1738.9328	1738.9328	R	V	281	297
PSM	GTGIAAQTAGIAAAAR	1083	sp|P82912-3|RT11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11579	29.812	2	1398.7579	1398.7579	K	A	90	106
PSM	GVEGLIDIENPNR	1084	sp|Q13442|HAP28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16597	39.552	2	1424.726	1424.7260	K	V	76	89
PSM	HDAQQLQQLK	1085	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5493	16.06	2	1207.6309	1207.6309	R	H	37	47
PSM	HGRPGIGATHSSR	1086	sp|P62841|RS15_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2171	8.9178	3	1331.6807	1331.6807	K	F	128	141
PSM	HIEIQVLGDK	1087	sp|P05165-3|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10920	28.607	2	1150.6346	1150.6346	R	H	269	279
PSM	HSGPNSADSANDGFVR	1088	sp|P52597|HNRPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6035	17.48	3	1629.7132	1629.7132	K	L	99	115
PSM	HVICTSEDMLNPNYEDLLIRK	1089	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=19707	45.455	3	2559.2461	2559.2461	R	S	3304	3325
PSM	IDFYFDENPYFENK	1090	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22767	51.591	2	1839.7992	1839.7992	R	V	124	138
PSM	IDFYFDENPYFENK	1091	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22772	51.598	2	1839.7992	1839.7992	R	V	124	138
PSM	IEEIKDFLLTAR	1092	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18857	43.862	2	1446.8082	1446.8082	K	R	5	17
PSM	IIDVVYNASNNELVR	1093	sp|P62241|RS8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16705	39.736	3	1717.8999	1717.8999	R	T	78	93
PSM	IKGEHPGLSIGDVAK	1094	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8330	22.979	3	1519.8358	1519.8358	K	K	113	128
PSM	KFGYVDFESAEDLEK	1095	sp|P19338|NUCL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17031	40.315	3	1775.8254	1775.8254	R	A	348	363
PSM	KGISLNPEQWSQLK	1096	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17109	40.497	3	1626.873	1626.8730	R	E	101	115
PSM	KHPDASVNFSEFSK	1097	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9927	26.498	3	1591.7631	1591.7631	K	K	30	44
PSM	KSNHNFLVQAGNVQLR	1098	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13658	34.12	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1099	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13962	34.749	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1100	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16142	38.684	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1101	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16282	38.972	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KTVTAMDVVYALK	1102	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17948	42.127	3	1437.7901	1437.7901	R	R	80	93
PSM	KVTQLDLDGPK	1103	sp|Q13442|HAP28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7929	21.848	2	1212.6714	1212.6714	K	E	95	106
PSM	LDHKFDLMYAK	1104	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11108	28.939	3	1379.6908	1379.6908	R	R	391	402
PSM	LGEENKGHQMLVK	1105	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5165	15.438	3	1481.766	1481.7660	R	M	839	852
PSM	LPAAGVGDMVMATVK	1106	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35	ms_run[2]:scan=14191	35.151	2	1474.7524	1474.7524	R	K	52	67
PSM	LQAVEVVITHLAPGTK	1107	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18953	44.061	3	1674.9669	1674.9669	K	H	121	137
PSM	MAPVPLDDSNRPASLTK	1108	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10588	27.791	3	1810.9247	1810.9247	K	D	549	566
PSM	MDGIVPDIAVGTK	1109	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=23189	52.413	2	1356.6959	1356.6959	-	R	1	14
PSM	QAEVANQETKEDLPAENGETK	1110	sp|P05114|HMGN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7028	19.654	3	2300.0768	2300.0768	K	T	62	83
PSM	QVHPDTGISSK	1111	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=3725	11.994	2	1167.5884	1167.5884	K	A	48	59
PSM	QVQSLTCEVDALKGTNESLER	1112	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=15966	38.349	3	2376.1591	2376.1591	R	Q	322	343
PSM	SDALETLGFLNHYQMK	1113	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20924	47.953	3	1865.8982	1865.8982	K	N	420	436
PSM	SEHPGLSIGDTAK	1114	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7198	20.04	2	1310.6466	1310.6466	K	K	115	128
PSM	SHQLIHAASLK	1115	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5481	16.039	3	1203.6724	1203.6724	R	L	210	221
PSM	SNHNFLVQAGNVQLR	1116	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6008	17.401	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1117	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6981	19.574	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1118	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13151	33.054	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1119	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13728	34.309	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1120	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14435	35.597	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1121	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14786	36.228	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1122	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15147	36.862	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1123	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15513	37.507	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1124	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16188	38.771	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1125	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16521	39.411	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1126	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16885	40.057	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1127	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17693	41.579	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1128	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17992	42.217	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1129	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18302	42.848	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1130	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18653	43.486	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1131	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18984	44.122	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1132	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19321	44.755	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1133	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20018	46.025	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1134	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20589	47.275	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1135	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20901	47.914	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1136	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21260	48.551	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1137	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21492	49.194	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1138	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22507	51.108	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1139	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22824	51.742	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1140	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23528	53.025	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1141	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24074	54.121	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1142	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25131	56.018	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1143	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25858	57.296	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1144	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=26200	57.929	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1145	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=26550	58.569	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1146	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=26832	59.199	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1147	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=28386	61.822	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1148	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=28750	62.456	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1149	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=29101	63.092	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1150	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=30432	65.636	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1151	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=30711	66.264	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1152	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14501	35.714	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SQIHDIVLVGGSTR	1153	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10946	28.654	2	1480.7998	1480.7998	K	I	329	343
PSM	STTSTIESFAAQEK	1154	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13505	33.815	2	1498.7151	1498.7151	R	Q	174	188
PSM	STVAESVSQQILR	1155	sp|Q86WX3|AROS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15753	37.959	2	1416.7573	1416.7573	R	Q	84	97
PSM	SVYAHFPINVVIQENGSLVEIR	1156	sp|P32969|RL9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22832	51.765	3	2483.3173	2483.3173	R	N	94	116
PSM	TALALEVGDIVK	1157	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18948	44.054	2	1227.7075	1227.7075	K	V	254	266
PSM	TDQAQKAEGAGDAK	1158	sp|P05204|HMGN2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=2349	9.2102	3	1388.6532	1388.6532	K	-	77	91
PSM	TGEAIVDAALSALR	1159	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24849	55.509	2	1385.7514	1385.7514	R	Q	116	130
PSM	TPAFAESVTEGDVR	1160	sp|P36957|ODO2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12475	31.382	2	1477.7049	1477.7049	K	W	75	89
PSM	TSDLIVLGLPWK	1161	sp|Q13148|TADBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24726	55.29	2	1340.7704	1340.7704	K	T	103	115
PSM	VFSATLGLVDIVK	1162	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22497	51.087	2	1360.7966	1360.7966	K	G	552	565
PSM	VIGGDDLSTLTGK	1163	sp|P00492|HPRT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13985	34.788	2	1274.6718	1274.6718	K	N	116	129
PSM	VLEGNEQFINAAK	1164	sp|P35030-5|TRY3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11848	30.292	2	1431.7358	1431.7358	K	I	73	86
PSM	VLEQLTGQTPVFSK	1165	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15612	37.675	3	1545.8403	1545.8403	K	A	39	53
PSM	VTVAGLAGKDPVQCSR	1166	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=9960	26.558	3	1656.8617	1656.8617	K	D	33	49
PSM	VVDALGNAIDGK	1167	sp|P25705|ATPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11690	30.012	2	1170.6245	1170.6245	R	G	150	162
PSM	YNYEPLTQDHVDILGPLSAQTGIAVLDMCASLK	1168	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	29-UNIMOD:4	ms_run[2]:scan=30468	65.704	4	3631.7902	3631.7902	K	E	3500	3533
PSM	VVEIAPAAHLDPQLR	1169	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=13781	34.414528	2	1629.912693	1627.904590	K	T	274	289
PSM	HVICTSEDMLNPNYEDLLIR	1170	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=23543	53.059074	3	2447.144498	2447.146097	R	K	3304	3324
PSM	KSNHNFLVQAGNVQLR	1171	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=20946	47.988957	3	1824.979298	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1172	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=13309	33.442393	3	1823.975438	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1173	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=16990	40.243543	4	1824.978899	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	1174	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7531	20.662191	3	1696.884299	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1175	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=32683	72.467462	3	1696.882866	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1176	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=27817	60.917629	3	1695.881027	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1177	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=27561	60.504765	3	1696.879646	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1178	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=20316	46.642629	3	1697.883392	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1179	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=18672	43.521264	2	1695.879664	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1180	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=13059	32.754725	3	1695.878432	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1181	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=28222	61.55987	3	1695.881027	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1182	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=30022	64.767597	2	1695.889498	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1183	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7009	19.621509	3	1695.880037	1695.880501	K	V	3325	3340
PSM	VIGHSMQNCVLK	1184	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	9-UNIMOD:4	ms_run[1]:scan=8825	24.038163	3	1385.696154	1384.695526	R	L	3340	3352
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1185	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26470	58.412796	3	3592.741756	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1186	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=25621	56.885267	3	3592.722018	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	1187	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=27164	59.804799	3	2890.341576	2890.320055	R	P	3369	3395
PSM	FTTTLNDFNLVAMK	1188	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:35	ms_run[1]:scan=26304	58.105974	2	1630.818366	1629.807245	R	Y	3486	3500
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1189	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	27.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=30545	65.86336	3	3634.7902	3633.7692	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1190	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	29-UNIMOD:4	ms_run[1]:scan=31967	70.17292	3	3619.770951	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1191	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	29-UNIMOD:4	ms_run[1]:scan=30477	65.720005	3	3618.768820	3617.774571	K	E	3500	3533
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	1192	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=32360	71.664543	3	3629.734640	3628.757541	K	E	3500	3533
PSM	IQSGQTFSVLACYNGSPSGVYQCAMR	1193	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22720	51.494089	3	2882.307564	2880.299319	R	P	3369	3395
PSM	HVICTSEDMFNPNYEDLLIR	1194	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	27.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=21608	49.482211	3	2482.1632	2481.1302	R	K	3304	3324
PSM	HVICISEDMLNPNYEDLLIR	1195	cov|corona03602|ORF1a_USA/FL-BPHL-0381/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4	ms_run[1]:scan=18129	42.460332	3	2445.199145	2443.187567	R	K	3304	3324
PSM	HVICISEDMLNPNYEDLLIR	1196	cov|corona03602|ORF1a_USA/FL-BPHL-0381/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	4-UNIMOD:4	ms_run[1]:scan=18093	42.390751	3	2445.199145	2443.187567	R	K	3304	3324
PSM	LAETQEEISAEVAAK	1197	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=14758	36.176609	2	1588.798313	1587.799182	R	A	108	123
PSM	RFGFPEGSVELYAEK	1198	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=16737	39.796511	3	1727.865533	1727.851886	K	V	76	91
PSM	HFYWYLTNEGIQYLR	1199	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=22042	50.286677	3	2001.974619	2001.973733	R	D	66	81
PSM	FDETEQALANER	1200	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=10057	26.734038	2	1422.645652	1421.642287	K	K	780	792
PSM	KSEIEYYAMLAK	1201	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=15141	36.850746	2	1444.727487	1444.727203	R	T	57	69
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	1202	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=20976	48.043765	4	3010.565296	3010.562468	R	L	133	163
PSM	LGGSAVISLEGKPL	1203	sp|P23528|COF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=17389	41.035952	2	1339.772592	1339.771117	K	-	153	167
PSM	TGEAIVDAALSALR	1204	sp|Q15084|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=24757	55.347118	2	1385.752472	1385.751444	R	Q	119	133
PSM	MQTDKPFDQTTISLQMGTNK	1205	sp|Q15417|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=15006	36.605404	3	2285.094487	2283.087518	K	G	193	213
PSM	FDSNNVVLIEDNGNPVGTR	1206	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=16243	38.876999	2	2059.995945	2058.997047	R	I	100	119
PSM	LIAPVAEEEATVPNNK	1207	sp|P07195|LDHB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12178	30.868874	2	1694.891849	1693.888666	K	I	8	24
PSM	LQAVEVVITHLAPGTK	1208	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=18965	44.086172	3	1674.968516	1674.966856	K	H	121	137
PSM	LLDYTEKPLYENLR	1209	sp|Q99986|VRK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=15642	37.729063	3	1766.929397	1765.925051	K	D	308	322
PSM	CGYPGHLTFECR	1210	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=10867	28.51137	2	1497.642429	1495.633654	K	N	18	30
PSM	FTTTLNDFNLVAMK	1211	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	13-UNIMOD:35	ms_run[1]:scan=30519	65.80644	2	1631.807800	1629.807245	R	Y	3486	3500
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	1212	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23290	52.59576	3	2893.323505	2890.320055	R	P	3369	3395
PSM	NHTLALTETGSVFAFGENK	1213	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=17988	42.208513	3	2035.001813	2035.001070	R	M	212	231
PSM	ADGYEPPVQESV	1214	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12677	31.792	2	1289.5776	1289.5776	R	-	253	265
PSM	AILVDLEPGTMDSVR	1215	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19205	44.553	2	1614.8287	1614.8287	R	S	63	78
PSM	AQDQGEKENPMR	1216	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=6010	17.404	2	1443.6412	1443.6412	M	E	2	14
PSM	ASGPPVSELITK	1217	sp|P10412|H14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12631	31.71	2	1197.6605	1197.6605	K	A	35	47
PSM	ASGVAVSDGVIK	1218	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=13261	33.344	2	1143.6136	1143.6136	M	V	2	14
PSM	CGETGHVAINCSK	1219	sp|P62633-7|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=4426	13.687	2	1431.6235	1431.6235	R	T	123	136
PSM	CTLCSQPGATIGCEIK	1220	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=11976	30.523	2	1793.811	1793.8110	K	A	279	295
PSM	DAGVIAGLNVLR	1221	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19641	45.339	2	1196.6877	1196.6877	K	I	160	172
PSM	DGIDDESYGQIFKPIISK	1222	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20186	46.378	3	2024.0102	2024.0102	R	V	201	219
PSM	DNIQGITKPAIR	1223	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8874	24.131	2	1324.7463	1324.7463	R	R	25	37
PSM	DTNGSQFFITTVK	1224	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17125	40.546	2	1456.7198	1456.7198	K	T	146	159
PSM	EGMNIVEAMER	1225	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17313	40.903	2	1277.5744	1277.5744	K	F	134	145
PSM	EHALLAYTLGVK	1226	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14706	36.082	2	1313.7343	1313.7343	R	Q	135	147
PSM	ELILSSNIGQHDLDTK	1227	sp|Q9H2K0|IF3M_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13332	33.484	3	1781.9159	1781.9159	K	T	160	176
PSM	ENNVDAVHPGYGFLSER	1228	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14026	34.863	3	1902.886	1902.8860	K	A	108	125
PSM	FDQLFDDESDPFEVLK	1229	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=25053	55.88	2	1942.8836	1942.8836	R	A	17	33
PSM	FTTTLNDFNLVAMK	1230	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=19007	44.162	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1231	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=21247	48.528	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1232	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=29214	63.296	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1233	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=30782	66.438	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1234	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23892	53.716	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1235	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24914	55.627	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1236	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=28639	62.26	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1237	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=29357	63.542	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1238	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=31159	67.459	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1239	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=25636	56.911	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1240	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=26673	58.867	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	GAEEMETVIPVDVMR	1241	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20066	46.143	3	1674.7957	1674.7957	K	R	13	28
PSM	GAEEMETVIPVDVMR	1242	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:35	ms_run[2]:scan=16772	39.86	2	1690.7906	1690.7906	K	R	13	28
PSM	GALQNIIPASTGAAK	1243	sp|P04406|G3P_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13777	34.406	2	1410.7831	1410.7831	R	A	201	216
PSM	GGGHVAQIYAIR	1244	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8870	24.121	2	1240.6677	1240.6677	K	Q	74	86
PSM	GQAAVQQLQAEGLSPR	1245	sp|P16152|CBR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12238	30.97	3	1651.8642	1651.8642	R	F	43	59
PSM	HVICTSEDMLNPNYEDLLIRK	1246	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=18163	42.532	2	2559.2461	2559.2461	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	1247	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=19745	45.524	3	2559.2461	2559.2461	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	1248	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	4-UNIMOD:4	ms_run[2]:scan=18667	43.509	3	2559.2461	2559.2461	R	S	3304	3325
PSM	IINEVSKPLAHHIPVEK	1249	sp|P55145|MANF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8527	23.34	4	1923.0942	1923.0942	K	I	88	105
PSM	IIQQAGQVWFPDSAFK	1250	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20967	48.028	3	1833.9414	1833.9414	K	T	2010	2026
PSM	IITLAGPTNAIFK	1251	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19808	45.637	2	1357.7969	1357.7969	R	A	58	71
PSM	IKSEHPGLSIGDTAK	1252	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6502	18.432	3	1551.8257	1551.8257	K	K	113	128
PSM	IKSEHPGLSIGDTAK	1253	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6518	18.457	2	1551.8257	1551.8257	K	K	113	128
PSM	ILQDGGLQVVEK	1254	sp|O43175|SERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11986	30.543	2	1297.7242	1297.7242	K	Q	22	34
PSM	IMNTFSVVPSPK	1255	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15180	36.924	2	1318.6955	1318.6955	R	V	163	175
PSM	IMNTFSVVPSPK	1256	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15221	36.997	2	1318.6955	1318.6955	R	V	163	175
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	1257	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=25249	56.228	3	2890.3201	2890.3201	R	P	3369	3395
PSM	KALEQLNGFELAGR	1258	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14135	35.054	3	1544.8311	1544.8311	K	P	284	298
PSM	KDDPTLLSSGR	1259	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6672	18.863	2	1187.6146	1187.6146	R	V	125	136
PSM	KDGFLHETLLDR	1260	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12210	30.924	3	1442.7518	1442.7518	R	R	236	248
PSM	KESYSIYVYK	1261	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10287	27.145	2	1278.6496	1278.6496	R	V	35	45
PSM	KSNHNFLVQAGNVQLR	1262	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18665	43.506	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1263	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19931	45.86	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1264	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20841	47.81	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KYWDVPPPGFEHITPMQYK	1265	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17486	41.204	3	2332.1351	2332.1351	R	A	90	109
PSM	LALEQQQLICK	1266	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=12664	31.767	2	1342.7279	1342.7279	K	Q	60	71
PSM	LEQMPSKEDAIEHFMK	1267	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13667	34.139	4	1931.9121	1931.9121	K	L	601	617
PSM	LFIGGLSFETTDESLR	1268	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22967	52.041	2	1783.8992	1783.8992	K	S	16	32
PSM	LGENDKTDLDVIR	1269	sp|Q70Z53-2|F10C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10574	27.768	3	1486.7627	1486.7627	R	E	98	111
PSM	LGGIPVGVVAVETR	1270	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17138	40.582	2	1365.798	1365.7980	R	T	1978	1992
PSM	LSSEMNTSTVNSAR	1271	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7187	20.015	2	1495.6937	1495.6937	R	E	277	291
PSM	LVNHFVEEFK	1272	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12416	31.277	2	1260.6503	1260.6503	R	R	237	247
PSM	LYTLVTYVPVTTFK	1273	sp|P62899|RL31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22581	51.238	3	1643.9174	1643.9174	K	N	102	116
PSM	MSSYAFFVQTCR	1274	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=17954	42.138	2	1495.6588	1495.6588	K	E	13	25
PSM	NNPHYDPSSKEDNPK	1275	sp|Q9P016|THYN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3521	11.585	3	1740.7703	1740.7703	K	W	143	158
PSM	NPPGFAFVEFEDPRDAADAVR	1276	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21415	48.945	3	2319.092	2319.0920	R	E	44	65
PSM	NSSYFVEWIPNNVK	1277	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21329	48.665	2	1695.8257	1695.8257	K	T	337	351
PSM	PQYQTWEEFSR	1278	sp|P49458-2|SRP09_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15502	37.487	2	1469.6575	1469.6575	M	A	2	13
PSM	QEPGSNEEIKEFAAGYNVK	1279	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14117	35.022	3	2109.0015	2109.0015	K	F	81	100
PSM	QGPLHGMLINTPYVTK	1280	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15153	36.876	3	1767.9342	1767.9342	K	D	1565	1581
PSM	QIGNVAALPGIVHR	1281	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13806	34.461	3	1443.831	1443.8310	K	S	68	82
PSM	QITVNDLPVGR	1282	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13096	32.871	2	1210.667	1210.6670	R	S	141	152
PSM	QPYAVSELAGHQTSAESWGTGR	1283	sp|P36578|RL4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13856	34.548	3	2331.088	2331.0880	R	A	50	72
PSM	QQVAFYGQTLGQAQAHSQEQ	1284	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13466	33.742	3	2218.0403	2218.0403	R	-	553	573
PSM	SEQEFQEQLESAR	1285	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12414	31.274	2	1579.7114	1579.7114	R	R	220	233
PSM	SGVSDHWALDDHHALHLTR	1286	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11161	29.034	5	2166.0355	2166.0355	K	K	270	289
PSM	SINQQSGAHVELQR	1287	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6524	18.468	3	1565.791	1565.7910	K	N	379	393
PSM	SNHNFLVQAGNVQLR	1288	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7149	19.923	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1289	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13432	33.682	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1290	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13253	33.33	4	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1291	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17190	40.695	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SYLNMDAIMEAIKK	1292	sp|P05165-3|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22592	51.258	3	1625.8157	1625.8157	K	T	120	134
PSM	TDKVFEVMLATDR	1293	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16507	39.385	3	1523.7654	1523.7654	K	S	25	38
PSM	TDKVFEVMLATDR	1294	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16519	39.406	3	1523.7654	1523.7654	K	S	25	38
PSM	TFGENYVQELLEK	1295	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23252	52.526	2	1568.7722	1568.7722	R	A	64	77
PSM	THINIVVIGHVDSGK	1296	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12059	30.667	3	1587.8733	1587.8733	K	S	6	21
PSM	TICSHVQNMIK	1297	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6200	17.808	2	1345.6482	1345.6482	R	G	72	83
PSM	TLYDFPGNDAEDLPFKK	1298	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18087	42.379	3	1968.9469	1968.9469	R	G	130	147
PSM	TPVEPEVAIHR	1299	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8163	22.573	2	1246.667	1246.6670	K	I	9	20
PSM	TSEVPYAGINIGPVHK	1300	sp|O60841|IF2P_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14007	34.83	3	1680.8835	1680.8835	K	K	1000	1016
PSM	TSEVPYAGINIGPVHK	1301	sp|O60841|IF2P_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14029	34.867	3	1680.8835	1680.8835	K	K	1000	1016
PSM	TTSSANNPNLMYQDECDRR	1302	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4	ms_run[2]:scan=8285	22.886	3	2270.9644	2270.9644	R	L	569	588
PSM	TVDNFVALATGEK	1303	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18169	42.543	3	1363.6983	1363.6983	K	G	72	85
PSM	VAGQDGSVVQFK	1304	sp|P61956-2|SUMO2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9592	25.833	2	1233.6354	1233.6354	K	I	22	34
PSM	VCEEIAIIPSK	1305	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4	ms_run[2]:scan=13203	33.18	2	1257.6639	1257.6639	R	K	34	45
PSM	VEVERDNLAEDIMR	1306	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14207	35.178	3	1687.8199	1687.8199	R	L	171	185
PSM	VGINYQPPTVVPGGDLAK	1307	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16573	39.509	2	1823.9781	1823.9781	K	V	353	371
PSM	VGNNFHNLQEIR	1308	sp|Q9UM13|APC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9669	25.978	3	1439.727	1439.7270	R	Q	98	110
PSM	VHELNEEIGK	1309	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6199	17.806	2	1166.5932	1166.5932	R	L	126	136
PSM	VHIGQVIMSIR	1310	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14977	36.558	2	1251.7122	1251.7122	R	T	129	140
PSM	VHPEIINENGNPSYK	1311	sp|O95881|TXD12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8322	22.965	3	1709.8373	1709.8373	K	Y	124	139
PSM	VHPEIINENGNPSYK	1312	sp|O95881|TXD12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8360	23.033	2	1709.8373	1709.8373	K	Y	124	139
PSM	VIGHSMQNCVLK	1313	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=12457	31.347	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLK	1314	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6899	19.398	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VMLGETNPADSKPGTIR	1315	sp|P15531-2|NDKA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9330	25.322	3	1784.9091	1784.9091	R	G	114	131
PSM	VNDTIQIDLETGK	1316	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14716	36.1	2	1444.7409	1444.7409	K	I	156	169
PSM	VNLEVIKPWITK	1317	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18447	43.118	3	1438.8548	1438.8548	K	R	43	55
PSM	VNNADDFPNLFR	1318	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19386	44.87	2	1420.6735	1420.6735	K	Q	324	336
PSM	VVDRDSEEAEIIR	1319	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8455	23.21	3	1529.7686	1529.7686	K	K	803	816
PSM	VYENYPTYDLTER	1320	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13901	34.629	2	1661.7573	1661.7573	K	K	350	363
PSM	VYTITPLLSDNR	1321	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17231	40.763	2	1390.7456	1390.7456	K	E	272	284
PSM	VYVGNLGNNGNK	1322	sp|P84103-2|SRSF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7595	20.857	2	1247.6258	1247.6258	K	T	12	24
PSM	YISPDQLADLYK	1323	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19527	45.136	2	1424.7187	1424.7187	R	S	270	282
PSM	QLTEEDGVHSVIEENIK	1324	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=13673	34.154771	3	1940.967550	1938.953451	K	C	2277	2294
PSM	KSNHNFLVQAGNVQLR	1325	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=25216	56.169545	3	1824.979123	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1326	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=18450	43.12246	3	1824.979365	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1327	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=24348	54.614467	3	1824.978897	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	1328	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14078	34.953222	3	1696.876565	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1329	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=25266	56.256766	2	1696.876438	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1330	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19391	44.877727	2	1695.881016	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1331	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12958	32.424436	3	1695.878432	1695.880501	K	V	3325	3340
PSM	VIGHSMQNCVLK	1332	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=7527	20.654275	3	1400.688894	1400.690441	R	L	3340	3352
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1333	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21959	50.142594	4	3607.731039	3606.705781	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	1334	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23967	53.869972	3	2891.317526	2890.320055	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	1335	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21432	48.991796	3	2908.3592	2906.3142	R	P	3369	3395
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	1336	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=30838	66.580405	3	3630.777243	3628.757541	K	E	3500	3533
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1337	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23539	53.048678	4	3582.698857	3580.690130	R	G	3369	3401
PSM	HVICISEDMLNPNYEDLLIRK	1338	cov|corona03602|ORF1a_USA/FL-BPHL-0381/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=17023	40.299947	4	2588.292565	2587.277445	R	S	3304	3325
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRLNFTIK	1339	cov|corona06418|ORF1a_Russia/Krasnodar-80902/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=19799	45.621105	3	3622.703239	3622.737081	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRLNFTIK	1340	cov|corona06418|ORF1a_Russia/Krasnodar-80902/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20737	47.609785	4	3625.736113	3622.737081	R	G	3369	3401
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1341	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23359	52.723095	3	3565.678915	3564.658830	R	G	3369	3401
PSM	VADGMVFGALLPCEECSGQLVFK	1342	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=25673	56.980067	3	2526.201106	2526.195689	R	S	283	306
PSM	THINIVVIGHVDSGK	1343	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11407	29.503219	3	1587.873524	1587.873290	K	S	6	21
PSM	GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK	1344	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	41-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=21049	48.171852	6	5112.4656	5112.4639	R	F	323	372
PSM	NAVITVPAYFNDSQR	1345	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17821	41.817565	2	1693.842611	1693.842384	K	Q	188	203
PSM	LIEGLSHEVIVSAACGR	1346	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	15-UNIMOD:4	ms_run[1]:scan=15139	36.847761	3	1810.944766	1809.940718	R	N	195	212
PSM	FDETEQALANER	1347	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=10045	26.707443	2	1422.645652	1421.642287	K	K	780	792
PSM	QVMGLITHTDSPYIR	1348	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14448	35.61809	2	1730.880955	1729.882140	K	A	144	159
PSM	MGQMAMGGAMGINNR	1349	sp|Q15233|NONO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12591	31.624304	2	1539.659641	1537.662193	R	G	384	399
PSM	ESTGAQVQVAGDMLPNSTER	1350	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=13429	33.675106	3	2088.972890	2088.974597	R	A	125	145
PSM	LQVEHPVTECITGLDLVQEMIR	1351	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4	ms_run[1]:scan=24808	55.437213	3	2580.314136	2579.308745	R	V	354	376
PSM	DTGKTPVEPEVAIHR	1352	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7904	21.805492	2	1648.859226	1647.858034	K	I	5	20
PSM	AAFTAFEEAQLPR	1353	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=18027	42.276385	2	1449.726061	1449.725229	R	L	171	184
PSM	GFAFVTFESPADAK	1354	sp|P38159|RBMX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=20526	47.164082	2	1486.719337	1485.713996	R	D	50	64
PSM	IVQAEGEAEAAK	1355	sp|Q99623|PHB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=5393	15.872083	2	1215.617857	1214.614282	K	M	225	237
PSM	FHQLDIDDLQSIR	1356	sp|P16152|CBR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17445	41.132472	3	1598.806872	1598.805270	R	A	59	72
PSM	AATASAGAGGIDGKPR	1357	sp|Q02978|M2OM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:1	ms_run[1]:scan=7183	20.005661	2	1441.7302	1440.7312	M	T	2	18
PSM	QTQTFTTYSDNQPGVLIQVYEGER	1358	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=21073	48.215164	3	2776.317685	2773.319504	K	A	424	448
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	1359	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=31695	69.194508	3	3630.734444	3628.757541	K	E	3500	3533
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1360	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=22457	51.019253	4	3609.722974	3606.705781	R	G	3369	3401
PSM	VESCMVQVTCGTTTLNGLWLDDVVYCPR	1361	cov|corona02321|ORF1a_Canada/NB-233/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=24983	55.751017	3	3275.508193	3272.497427	K	H	3276	3304
PSM	IQPGQTFSVLACYNGTPSGVYQCAMRPNFTIK	1362	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22141	50.458698	3	3605.710884	3604.726516	R	G	3369	3401
PSM	HVICTSEDMLNPNYEDLLIRK	1363	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=15784	38.020305	4	2561.230919	2559.246145	R	S	3304	3325
PSM	ADFAQACQDAGVR	1364	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=9286	25.228	2	1407.6201	1407.6201	R	F	125	138
PSM	AGGAAVVITEPEHTK	1365	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7325	20.294	3	1478.7729	1478.7729	K	E	78	93
PSM	AGKPVICATQMLESMIK	1366	sp|P14618-3|KPYM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=22629	51.322	3	1875.962	1875.9620	R	K	305	322
PSM	AGNLGGGVVTIER	1367	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10888	28.552	2	1241.6728	1241.6728	K	S	53	66
PSM	ALAAAGYDVEKNNSR	1368	sp|P10412|H14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7227	20.097	3	1577.7798	1577.7798	K	I	65	80
PSM	APILIATDVASR	1369	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13614	34.014	2	1225.703	1225.7030	K	G	392	404
PSM	ASPSPTDPVVPAVPIGPPPAGFR	1370	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20031	46.052	3	2225.1845	2225.1845	K	D	520	543
PSM	AVPGCNKDSVR	1371	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=6084	17.59	2	1243.5979	1243.5979	M	A	2	13
PSM	DAGTIAGLNVLR	1372	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17648	41.5	2	1198.667	1198.6670	K	I	160	172
PSM	DAHQSLLATR	1373	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7061	19.714	2	1110.5782	1110.5782	R	V	572	582
PSM	DHAVVVGVYRPPPK	1374	sp|P22087|FBRL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7800	21.578	3	1532.8463	1532.8463	R	V	305	319
PSM	DHLVTAYNHLFETK	1375	sp|Q00688|FKBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13846	34.53	3	1686.8366	1686.8366	K	R	57	71
PSM	DKFNECGHVLYADIK	1376	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=11591	29.834	3	1807.8563	1807.8563	K	M	632	647
PSM	DLAQDEAVWLER	1377	sp|P29372-4|3MG_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21086	48.238	2	1443.6994	1443.6994	R	G	230	242
PSM	DLTTAGAVTQCYR	1378	sp|Q02543|RL18A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=11232	29.17	2	1454.6824	1454.6824	R	D	99	112
PSM	DTGKTPVEPEVAIHR	1379	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7806	21.589	4	1647.858	1647.8580	K	I	5	20
PSM	DVVICPDASLEDAKK	1380	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=11309	29.323	3	1658.8185	1658.8185	R	E	49	64
PSM	DYLASGGQPITNCVK	1381	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=11801	30.207	2	1621.777	1621.7770	K	M	4282	4297
PSM	DYQDNKADVILK	1382	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9172	24.935	3	1420.7198	1420.7198	R	Y	83	95
PSM	EIKDILIQYDR	1383	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15521	37.521	2	1404.7613	1404.7613	K	T	107	118
PSM	EILGTAQSVGCNVDGR	1384	sp|P30050|RL12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=11246	29.199	2	1674.7995	1674.7995	K	H	131	147
PSM	ELAEDGYSGVEVR	1385	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10793	28.346	2	1422.6627	1422.6627	R	V	28	41
PSM	ERVEAVNMAEGIIHDTETK	1386	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17495	41.22	4	2141.0423	2141.0423	K	M	577	596
PSM	EVDEGPSPPEQFTAVK	1387	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12224	30.947	2	1728.8206	1728.8206	K	L	86	102
PSM	FAAATGATPIAGR	1388	sp|P08865|RSSA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8837	24.06	2	1202.6408	1202.6408	K	F	90	103
PSM	FNADEFEDMVAEKR	1389	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17771	41.729	3	1699.7512	1699.7512	K	L	176	190
PSM	FTTTLNDFNLVAMK	1390	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=20411	46.928	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1391	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=20885	47.886	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1392	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=22569	51.218	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1393	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=31247	67.709	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1394	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=31460	68.357	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1395	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:35	ms_run[2]:scan=29605	63.987	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1396	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=24563	54.996	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1397	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25268	56.263	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1398	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=27002	59.501	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1399	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=26373	58.226	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	GLYAAFDCTATMK	1400	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=16034	38.487	2	1447.6476	1447.6476	R	S	843	856
PSM	GMGGAFVLVLYDELKK	1401	sp|P12236|ADT3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=26255	58.023	3	1738.9328	1738.9328	R	V	281	297
PSM	HGRPGIGATHSSR	1402	sp|P62841|RS15_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2163	8.9048	4	1331.6807	1331.6807	K	F	128	141
PSM	HGYEKPTPIQTQAIPAIMSGR	1403	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13580	33.95	4	2294.1841	2294.1841	K	D	390	411
PSM	HPDVEVDGFSELR	1404	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13499	33.804	3	1498.7052	1498.7052	R	W	66	79
PSM	HSEVETDSK	1405	sp|Q9NX58|LYAR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2101	8.7814	2	1030.4567	1030.4567	R	K	275	284
PSM	HVFLTGPPGVGK	1406	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10103	26.819	2	1207.6713	1207.6713	R	T	4	16
PSM	HWPFMVVNDAGRPK	1407	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14094	34.982	3	1652.8246	1652.8246	K	V	89	103
PSM	IFVGGLSPDTPEEK	1408	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13719	34.28	2	1487.7508	1487.7508	K	I	184	198
PSM	INEELESQYQQSMDSK	1409	sp|O00193|SMAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11707	30.044	2	1927.8469	1927.8469	K	L	76	92
PSM	KAEAGAGSATEFQFR	1410	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9899	26.448	3	1568.7583	1568.7583	K	G	139	154
PSM	KCGYPGHLTFECR	1411	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8726	23.814	3	1623.7286	1623.7286	K	N	17	30
PSM	KDDEENYLDLFSHK	1412	sp|Q07666-3|KHDR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16566	39.496	3	1751.8002	1751.8002	K	N	139	153
PSM	KESYSVYVYK	1413	sp|Q99880|H2B1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9008	24.462	2	1264.634	1264.6340	R	V	35	45
PSM	KLGEMWNNLNDSEK	1414	sp|O15347|HMGB3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12383	31.218	2	1676.7828	1676.7828	K	Q	126	140
PSM	KLYDIDVAK	1415	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9283	25.219	2	1063.5914	1063.5914	K	V	115	124
PSM	KSFNDDAMLIEK	1416	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11005	28.764	2	1409.6861	1409.6861	K	F	237	249
PSM	KSNHNFLVQAGNVQLR	1417	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13954	34.732	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1418	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18001	42.23	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KYWDVPPPGFEHITPMQYK	1419	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17498	41.224	4	2332.1351	2332.1351	R	A	90	109
PSM	LGNDFHTNKR	1420	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3379	11.324	2	1200.6	1200.6000	R	V	24	34
PSM	LISQIVSSITASLR	1421	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=26846	59.223	2	1486.8719	1486.8719	R	F	230	244
PSM	LKHYGPGWVSMANAGK	1422	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10084	26.786	3	1714.8613	1714.8613	K	D	130	146
PSM	LMEEIMSEKENK	1423	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9419	25.486	3	1479.6949	1479.6949	R	T	332	344
PSM	NALESYAFNMK	1424	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16677	39.691	2	1286.5965	1286.5965	K	S	540	551
PSM	NSVSNFLHSLER	1425	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19200	44.543	3	1401.7001	1401.7001	R	G	646	658
PSM	QLFHPEQLITGK	1426	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15110	36.795	2	1409.7667	1409.7667	R	E	85	97
PSM	QLTEEDGVHSVIEENIK	1427	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13693	34.216	3	1938.9535	1938.9535	K	C	2277	2294
PSM	QSSSSRDDNMFQIGK	1428	sp|P53999|TCP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10109	26.828	2	1698.7631	1698.7631	K	M	54	69
PSM	QVLIASHLPSYELR	1429	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15453	37.406	3	1624.8937	1624.8937	R	H	1083	1097
PSM	SAHLQWMVVR	1430	sp|P46779|RL28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=18388	43.018	2	1267.6496	1267.6496	M	N	2	12
PSM	SDGTGTIYTELEPPCR	1431	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	15-UNIMOD:4	ms_run[2]:scan=15183	36.928	2	1794.8094	1794.8094	K	F	4199	4215
PSM	SGGASHSELIHNLR	1432	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6416	18.27	4	1476.7433	1476.7433	K	K	5	19
PSM	SGNTGIATTFINK	1433	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12325	31.119	2	1322.683	1322.6830	R	A	526	539
PSM	SIFASPESVTGK	1434	sp|O75940|SPF30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12651	31.744	2	1221.6241	1221.6241	R	V	197	209
PSM	SNHNFLVQAGNVQLR	1435	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5773	16.741	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1436	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25494	56.658	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1437	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=27178	59.83	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1438	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25420	56.52	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1439	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18596	43.385	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1440	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=32387	71.766	3	1695.8805	1695.8805	K	V	3325	3340
PSM	STSSHGTDEMESSSYR	1441	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5228	15.548	3	1759.6955	1759.6955	R	D	180	196
PSM	TGGTQTDLFTCGK	1442	sp|Q15560-2|TCEA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=10320	27.206	2	1384.6293	1384.6293	R	C	224	237
PSM	TILGSALLEDEFTPFDVVR	1443	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=27586	60.542	4	2121.0994	2121.0994	R	Q	3543	3562
PSM	TLSYLLPAIVHINHQPFLER	1444	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=22020	50.248	3	2360.3005	2360.3005	K	G	145	165
PSM	TWNDPSVQQDIK	1445	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11083	28.898	2	1429.6838	1429.6838	R	F	102	114
PSM	VCEEIAIIPSKK	1446	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=10467	27.545	3	1385.7588	1385.7588	R	L	34	46
PSM	VDNDENEHQLSLR	1447	sp|P06748|NPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7278	20.2	3	1567.7227	1567.7227	K	T	33	46
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	1448	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=25647	56.93	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VEGRPGASLPPLDLQALEK	1449	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18387	43.017	3	1989.0895	1989.0895	R	E	974	993
PSM	VFIGNLNTLVVK	1450	sp|P07910-4|HNRPC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19624	45.312	2	1315.7864	1315.7864	R	K	18	30
PSM	VIGHSMQNCVLK	1451	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5825	16.861	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1452	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6040	17.494	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1453	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6340	18.125	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1454	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6666	18.847	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1455	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=7145	19.914	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1456	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=7478	20.556	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGSGCNLDSAR	1457	sp|P07195|LDHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:4	ms_run[2]:scan=7364	20.362	2	1247.5928	1247.5928	R	F	159	171
PSM	VLEEANQAINPK	1458	sp|Q92841|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8281	22.878	2	1324.6987	1324.6987	K	L	536	548
PSM	VSFELFADKVPK	1459	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17811	41.801	3	1378.7497	1378.7497	R	T	20	32
PSM	VSISEGDDKIEYR	1460	sp|P22087|FBRL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9583	25.813	3	1509.7311	1509.7311	R	A	123	136
PSM	VVEIAPAAHLDPQLR	1461	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13675	34.158	3	1627.9046	1627.9046	K	T	274	289
PSM	VVHSYEELEENYTR	1462	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11694	30.021	3	1766.8111	1766.8111	R	A	206	220
PSM	YNILGTNTIMDK	1463	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16740	39.803	2	1381.6912	1381.6912	K	M	506	518
PSM	KSNHNFLVQAGNVQLR	1464	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13621	34.026339	3	1823.975438	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1465	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=27029	59.547299	3	1825.978869	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	1466	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12722	31.873902	2	1695.877829	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1467	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=23777	53.486543	3	1695.881733	1695.880501	K	V	3325	3340
PSM	VIGHSMQNCVLK	1468	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:4	ms_run[1]:scan=13955	34.733834	3	1385.697537	1384.695526	R	L	3340	3352
PSM	VIGHSMQNCVLK	1469	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	9-UNIMOD:4	ms_run[1]:scan=9298	25.258553	3	1384.697925	1384.695526	R	L	3340	3352
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1470	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=24871	55.54801	4	3592.709567	3590.710866	R	G	3369	3401
PSM	FTTTLNDFNLVAMK	1471	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:35	ms_run[1]:scan=31964	70.163995	2	1630.810887	1629.807245	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1472	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	13-UNIMOD:35	ms_run[1]:scan=22253	50.67378	3	1630.812704	1629.807245	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1473	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=22846	51.79918	3	1614.817231	1613.812330	R	Y	3486	3500
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1474	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=29562	63.908939	3	3634.7952	3633.7692	K	E	3500	3533
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	1475	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26949	59.405414	5	5707.4272	5705.4512	K	Q	3401	3452
PSM	HVICTSEDMFNPNYEDLLIR	1476	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=24336	54.593171	3	2481.111958	2481.130446	R	K	3304	3324
PSM	HWPFQVINDGDKPK	1477	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12806	32.015978	3	1679.852008	1679.841990	K	V	89	103
PSM	GDGPICLVLAPTR	1478	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4	ms_run[1]:scan=18502	43.213657	2	1367.722415	1367.723121	R	E	242	255
PSM	VEAVNMAEGIIHDTETK	1479	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=18745	43.656061	3	1855.899219	1855.898578	R	M	579	596
PSM	NHTLALTETGSVFAFGENK	1480	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=18084	42.374801	3	2035.001813	2035.001070	R	M	212	231
PSM	ALAAAGYDVEKNNSR	1481	sp|Q02539|H11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=7294	20.232909	3	1577.780028	1577.779784	K	I	68	83
PSM	DLAQDEAVWLER	1482	sp|P29372|3MG_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=21124	48.30462	2	1443.698152	1443.699408	R	G	235	247
PSM	ELVFKEDGQEYAQVIK	1483	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15353	37.230923	3	1894.968858	1894.967644	R	M	25	41
PSM	SQVVAGTNYFIK	1484	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13709	34.258844	2	1325.700724	1325.697952	K	V	45	57
PSM	TDQAQKAEGAGDAK	1485	sp|P05204|HMGN2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2327	9.1755432	3	1388.652593	1388.653186	K	-	77	91
PSM	CGYPGHLTFECR	1486	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=10713	28.076537	3	1496.634112	1495.633654	K	N	18	30
PSM	CGYPGHLTFECR	1487	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=15583	37.624126	2	1478.6068	1478.6066	K	N	18	30
PSM	GHQQLYWSHPR	1488	sp|P62273|RS29_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0		ms_run[1]:scan=6799	19.087725	2	1408.6892	1407.6792	M	K	2	13
PSM	HGRPGIGATHSSR	1489	sp|P62841|RS15_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2164	8.9060075	3	1331.680983	1331.680679	K	F	128	141
PSM	QLDDLKVELSQLR	1490	sp|P42766|RL35_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=17969	42.169504	3	1555.858424	1555.856972	K	V	20	33
PSM	LQAVEVVITHLAPGTK	1491	sp|Q9Y2V2|CHSP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=19032	44.206344	3	1674.968516	1674.966856	K	H	121	137
PSM	ALSAVHSPTFCQLACGQDGQLK	1492	sp|Q8IY67|RAVR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=14625	35.942015	3	2389.134769	2387.136200	R	G	241	263
PSM	MTGTLETQFTCPFCNHEK	1493	sp|P60002|ELOF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=15523	37.523346	3	2199.936989	2199.938746	K	S	16	34
PSM	EQAPLEMSMHPAASAPLSVFTK	1494	sp|Q6P1X5|TAF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=19684	45.41565	3	2342.147196	2341.144639	K	E	1115	1137
PSM	ISNTAISISDHTALAQFCK	1495	sp|P22102|PUR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	18-UNIMOD:4	ms_run[1]:scan=16180	38.757006	3	2077.036380	2076.030990	K	E	45	64
PSM	IFDTSSGHLIQELR	1496	sp|Q5MNZ6|WIPI3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15917	38.261424	3	1615.843160	1614.836570	R	R	212	226
PSM	TGTAEMSSILEER	1497	sp|P25705|ATPA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=14673	36.024706	2	1424.666060	1422.666059	K	I	46	59
PSM	KSNHNFLVQAGNVQLR	1498	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12266	31.01815	3	1824.962724	1823.975464	R	V	3324	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1499	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21903	50.050018	3	3609.699103	3606.705781	R	G	3369	3401
PSM	IQPGQTFSVLACYNGTPSGVYQCAMR	1500	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=19823	45.664772	3	2923.339228	2920.330620	R	P	3369	3395
PSM	AAYFGIYDTAK	1501	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15218	36.993	2	1218.5921	1218.5921	R	G	189	200
PSM	ADQGEKENPMR	1502	sp|P62913-2|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=6254	17.919	2	1315.5827	1315.5827	M	E	2	13
PSM	AEEPSDLIGPEAPK	1503	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12039	30.633	2	1451.7144	1451.7144	K	T	284	298
PSM	AGGAAVVITEPEHTKER	1504	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6378	18.195	4	1763.9166	1763.9166	K	V	78	95
PSM	ALEQLNGFELAGR	1505	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17785	41.754	2	1416.7361	1416.7361	K	P	285	298
PSM	AMGIMNSFVNDIFER	1506	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=27370	60.186	2	1742.812	1742.8120	K	I	59	74
PSM	AMLDQLMGTSR	1507	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16823	39.95	2	1221.5846	1221.5846	R	D	9	20
PSM	AQFEGIVTDLIR	1508	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22375	50.884	2	1360.7351	1360.7351	R	R	349	361
PSM	ARFEELCSDLFR	1509	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=17651	41.505	3	1541.7297	1541.7297	R	S	300	312
PSM	ATGANATPLDFPSK	1510	sp|Q15637-4|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=16418	39.223	2	1430.7042	1430.7042	M	K	2	16
PSM	AYGELPEHAK	1511	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5815	16.841	2	1113.5455	1113.5455	K	I	105	115
PSM	AYIAYELNSVQHR	1512	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12285	31.051	3	1562.7841	1562.7841	R	Q	1157	1170
PSM	CTLCSQPGATIGCEIK	1513	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=12055	30.661	3	1793.811	1793.8110	K	A	279	295
PSM	DFNHINVELSLLGK	1514	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21303	48.624	3	1597.8464	1597.8464	R	K	37	51
PSM	DSFDDRGPSLNPVLDYDHGSR	1515	sp|P43243|MATR3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15071	36.721	4	2361.0622	2361.0622	R	S	187	208
PSM	EFHLNESGDPSSK	1516	sp|Q01105-2|SET_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7579	20.805	3	1445.6423	1445.6423	K	S	142	155
PSM	EGKPTIVEEDDPELFK	1517	sp|O75937|DNJC8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13870	34.574	3	1844.9044	1844.9044	K	Q	144	160
PSM	ELAPYDENWFYTR	1518	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20906	47.921	2	1702.7627	1702.7627	K	A	44	57
PSM	FTTTLNDFNLVAMK	1519	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:35	ms_run[2]:scan=19348	44.801	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1520	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21822	49.896	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1521	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22542	51.17	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1522	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=28208	61.537	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	GFGFVTYATVEEVDAAMNARPHK	1523	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23238	52.502	4	2509.206	2509.2060	R	V	56	79
PSM	GGSGSGPTIEEVD	1524	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10005	26.638	2	1203.5255	1203.5255	K	-	629	642
PSM	GLPWSCSADEVQR	1525	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=13757	34.369	2	1503.6776	1503.6776	R	F	17	30
PSM	GMVLGSLAATVR	1526	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17007	40.274	2	1173.654	1173.6540	R	L	4240	4252
PSM	GPVKPTGGPGGGGTQTQQQMNQLK	1527	sp|P26196|DDX6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7416	20.451	3	2365.1808	2365.1808	R	N	23	47
PSM	GVQVETISPGDGR	1528	sp|P62942|FKB1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8897	24.191	2	1313.6575	1313.6575	M	T	2	15
PSM	HGEEVTPEDVLSAAMYPDVFAHFK	1529	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25540	56.74	3	2688.253	2688.2530	R	D	998	1022
PSM	HYGPGWVSMANAGK	1530	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:35	ms_run[2]:scan=8514	23.317	2	1489.6772	1489.6772	K	D	132	146
PSM	HYGPGWVSMANAGK	1531	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11371	29.44	3	1473.6823	1473.6823	K	D	132	146
PSM	IDTIEIITDR	1532	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16633	39.615	2	1187.6398	1187.6398	K	Q	138	148
PSM	IESIQLMMDSETGR	1533	sp|Q14498-3|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18357	42.965	3	1608.7487	1608.7487	R	S	254	268
PSM	IEVEKPFAIAK	1534	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11302	29.31	2	1243.7176	1243.7176	K	E	205	216
PSM	IIETLTQQLQAK	1535	sp|Q9UHV9|PFD2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13952	34.73	2	1384.7926	1384.7926	K	G	100	112
PSM	IILDLISESPIK	1536	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22495	51.084	2	1339.7963	1339.7963	K	G	184	196
PSM	IQFKPDDGISPER	1537	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10139	26.882	3	1500.7573	1500.7573	R	A	287	300
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	1538	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=24818	55.455	3	2890.3201	2890.3201	R	P	3369	3395
PSM	ISGLIYEETRGVLK	1539	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15923	38.273	3	1576.8825	1576.8825	R	V	47	61
PSM	ISVYYNEATGGK	1540	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9907	26.462	2	1300.6299	1300.6299	R	Y	47	59
PSM	ITLEAVLNTTCKK	1541	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=15448	37.398	3	1489.8174	1489.8174	K	C	99	112
PSM	ITPSYVAFTPEGER	1542	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15079	36.739	2	1565.7726	1565.7726	R	L	61	75
PSM	IVQAEGEAEAAK	1543	sp|Q99623|PHB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5415	15.922	2	1214.6143	1214.6143	K	M	225	237
PSM	IWHHTFYNELR	1544	sp|P63261|ACTG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10322	27.208	3	1514.7419	1514.7419	K	V	85	96
PSM	KIAPYVAHNFSK	1545	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6930	19.474	3	1373.7456	1373.7456	K	L	589	601
PSM	KLCLNICVGESGDR	1546	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=12827	32.049	2	1619.776	1619.7760	R	L	19	33
PSM	KLTVNPGTK	1547	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3745	12.035	2	956.56548	956.5655	K	S	654	663
PSM	KQGGLGPMNIPLVSDPK	1548	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16147	38.691	3	1749.9447	1749.9447	K	R	93	110
PSM	KSNHNFLVQAGNVQLR	1549	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11358	29.416	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1550	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19219	44.579	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1551	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20535	47.18	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1552	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22015	50.241	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1553	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24836	55.486	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1554	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=26322	58.133	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1555	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19571	45.219	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KVVGCSCVVVK	1556	sp|P25398|RS12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5535	16.132	2	1233.6573	1233.6573	R	D	102	113
PSM	KYDAFLASESLIK	1557	sp|P62906|RL10A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16665	39.667	3	1483.7922	1483.7922	K	Q	106	119
PSM	LALNQISQISMK	1558	sp|Q96E11-8|RRFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17148	40.609	2	1344.7435	1344.7435	K	S	76	88
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	1559	sp|P05387|RLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12732	31.891	3	2773.4246	2773.4246	K	K	62	95
PSM	LDKSQIHDIVLVGGSTR	1560	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12343	31.151	3	1837.0058	1837.0058	K	I	326	343
PSM	LETHMTPEMFR	1561	sp|Q08211|DHX9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12333	31.133	3	1390.6373	1390.6373	R	T	785	796
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	1562	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13435	33.686	5	3381.587	3381.5870	K	G	211	242
PSM	LLEPVLLLGK	1563	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21747	49.745	2	1093.7111	1093.7111	K	E	51	61
PSM	LMELHGEGSSSGK	1564	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5955	17.187	3	1330.6187	1330.6187	K	A	228	241
PSM	LMGFASFDSTK	1565	sp|Q8WVK2|SNR27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17413	41.076	2	1202.5642	1202.5642	K	G	106	117
PSM	LNHVAAGLVSPSLK	1566	sp|Q05519-2|SRS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10562	27.748	3	1404.8089	1404.8089	K	S	198	212
PSM	LQGEVVAFDYQSK	1567	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14068	34.936	2	1482.7355	1482.7355	R	M	25	38
PSM	LTMQVSSLQR	1568	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11258	29.223	2	1161.6176	1161.6176	R	E	66	76
PSM	LTSDDVKEQIYK	1569	sp|P62277|RS13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9288	25.231	3	1437.7351	1437.7351	K	L	28	40
PSM	LVEALAAATEK	1570	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10914	28.598	2	1114.6234	1114.6234	K	Q	188	199
PSM	MEETPTEYLQR	1571	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12064	30.677	2	1395.634	1395.6340	R	G	665	676
PSM	NDKSEEEQSSSSVK	1572	sp|P07910-4|HNRPC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2341	9.1966	3	1552.6853	1552.6853	K	K	174	188
PSM	NEEPSEEEIDAPKPK	1573	sp|Q9NR30|DDX21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7043	19.681	3	1710.7948	1710.7948	K	K	117	132
PSM	NKLDHYAIIK	1574	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7592	20.85	3	1213.6819	1213.6819	R	F	69	79
PSM	NLGQNLWGPHR	1575	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11565	29.786	2	1290.6582	1290.6582	R	Y	131	142
PSM	NMSVIAHVDHGK	1576	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6102	17.624	3	1306.6452	1306.6452	R	S	21	33
PSM	NPPNQSSNERPPSLLVIETK	1577	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13351	33.52	3	2219.1546	2219.1546	K	K	169	189
PSM	NQVAMNPTNTVFDAKR	1578	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11120	28.959	3	1804.889	1804.8890	K	L	57	73
PSM	NSLESYAFNMK	1579	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16261	38.924	2	1302.5914	1302.5914	K	A	540	551
PSM	PGASLPPLDLQALEK	1580	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20765	47.677	2	1547.8559	1547.8559	R	E	978	993
PSM	PGFSIADKK	1581	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6701	18.926	2	961.52328	961.5233	R	R	137	146
PSM	QGNVLPLWGNEK	1582	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17173	40.664	2	1353.7041	1353.7041	K	T	43	55
PSM	QVTSNSLSGTQEDGLDDPRLEK	1583	sp|P30533|AMRP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10919	28.605	3	2388.1405	2388.1405	R	L	132	154
PSM	SGDHLHNDSQIEADFR	1584	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=11157	29.028	2	1881.8242	1881.8242	M	L	2	18
PSM	SGVSLAALKK	1585	sp|P10412|H14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7976	21.963	2	972.59678	972.5968	R	A	55	65
PSM	SIYGEKFEDENFILK	1586	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17656	41.515	3	1830.904	1830.9040	K	H	77	92
PSM	SKPGAAMVEMADGYAVDR	1587	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14105	35.001	3	1866.8604	1866.8604	K	A	284	302
PSM	SNHNFLVQAGNVQLR	1588	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12690	31.814	3	1695.8805	1695.8805	K	V	3325	3340
PSM	TAGQTGMCGGVR	1589	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=4860	14.675	2	1193.5281	1193.5281	K	G	106	118
PSM	THTTMSGVAHR	1590	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2654	9.8913	3	1196.572	1196.5720	K	A	249	260
PSM	TLNDELEIIEGMK	1591	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22566	51.211	2	1503.7491	1503.7491	K	F	206	219
PSM	TNIIPVLEDAR	1592	sp|A6NHQ2|FBLL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16555	39.474	2	1239.6823	1239.6823	R	H	220	231
PSM	TPCNAGTFSQPEK	1593	sp|O43684-2|BUB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=6722	18.965	2	1435.6402	1435.6402	R	V	127	140
PSM	TVTAMDVVYALKR	1594	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18768	43.7	3	1465.7963	1465.7963	K	Q	81	94
PSM	VAPEEHPVLLTEAPLNPK	1595	sp|P63261|ACTG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13813	34.474	3	1953.0571	1953.0571	R	A	96	114
PSM	VAYMNPIAMAR	1596	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15693	37.836	2	1235.6155	1235.6155	R	S	8	19
PSM	VEILANDQGNR	1597	sp|P17066|HSP76_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7322	20.287	2	1227.6208	1227.6208	R	T	28	39
PSM	VGDQILLAIK	1598	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17388	41.034	2	1068.6543	1068.6543	K	G	69	79
PSM	VIGHSMQNCVLK	1599	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=14761	36.181	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLK	1600	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5254	15.603	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VQQTVQDLFGR	1601	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14935	36.485	2	1289.6728	1289.6728	K	A	395	406
PSM	VVASDKETYELR	1602	sp|Q6P5R6|RL22L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7339	20.319	3	1408.7198	1408.7198	R	Y	96	108
PSM	VYALPEDLVEVKPK	1603	sp|P13797|PLST_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16408	39.206	3	1598.892	1598.8920	R	M	600	614
PSM	WDYPEGTPNGGSTTLPSAPPPASAGLK	1604	sp|A0A0U1RRE5|NBDY_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16896	40.073	3	2667.2817	2667.2817	R	S	34	61
PSM	YFPTQALNFAFK	1605	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22873	51.859	2	1445.7343	1445.7343	R	D	81	93
PSM	YLQSLLAEVER	1606	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20383	46.857	2	1319.7085	1319.7085	R	R	88	99
PSM	YSLQYYMGLAEELVR	1607	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=27796	60.882	3	1833.8971	1833.8971	K	A	718	733
PSM	TIQVENSHLILTGAGALNK	1608	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=15180	36.92355	3	1979.089038	1978.084740	R	V	1838	1857
PSM	DFTATFGPLDSLNTR	1609	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=22267	50.699767	2	1654.800733	1653.799851	K	L	1022	1037
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	1610	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=24648	55.148707	3	3244.497821	3242.486863	K	H	3276	3304
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	1611	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=25551	56.759243	3	3259.497060	3258.481778	K	H	3276	3304
PSM	KSNHNFLVQAGNVQLR	1612	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=15136	36.843569	4	1824.978559	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1613	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=29814	64.376108	3	1824.974258	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1614	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=28637	62.257211	3	1824.976556	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	1615	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17068	40.388121	3	1695.882109	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1616	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6121	17.661346	3	1695.883144	1695.880501	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1617	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=14091	34.975003	4	1695.874730	1695.880501	K	V	3325	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1618	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=25609	56.864799	3	3592.722018	3590.710866	R	G	3369	3401
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1619	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=31832	69.671513	3	3634.8022	3633.7692	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1620	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	29-UNIMOD:4	ms_run[1]:scan=32395	71.790556	3	3618.764573	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1621	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	29-UNIMOD:4	ms_run[1]:scan=31550	68.662853	3	3619.778830	3617.774571	K	E	3500	3533
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	1622	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=28833	62.604084	5	5707.4382	5705.4512	K	Q	3401	3452
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	1623	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26900	59.320157	5	5707.4272	5705.4512	K	Q	3401	3452
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	1624	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=31841	69.696686	4	3628.730120	3628.757541	K	E	3500	3533
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	1625	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=30993	67.001769	4	3629.735147	3628.757541	K	E	3500	3533
PSM	HVICTSEDMFNPNYEDLLIR	1626	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4	ms_run[1]:scan=26889	59.300961	3	2466.136580	2465.135531	R	K	3304	3324
PSM	THINIVVIGHVDSGK	1627	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11255	29.219112	3	1587.874025	1587.873290	K	S	6	21
PSM	GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK	1628	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	41-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=21032	48.143217	6	5112.4656	5112.4639	R	F	323	372
PSM	AVFVDLEPTVIDEVR	1629	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=22412	50.942424	2	1700.897280	1700.898502	R	T	65	80
PSM	MVMIQDGPLPTGADKPLR	1630	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=14603	35.903792	3	1938.006924	1938.006689	K	I	196	214
PSM	SIEIPRPVDGVEVPGCGK	1631	sp|P26368|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	16-UNIMOD:4	ms_run[1]:scan=14770	36.196426	3	1907.980802	1907.977498	K	I	414	432
PSM	YPSPPMGSVSAPNLPTAEDNLEYVR	1632	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=20187	46.379827	3	2704.286344	2703.285032	R	T	105	130
PSM	GVGVALDDPYENYR	1633	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=15185	36.931093	2	1567.737278	1566.731437	K	R	885	899
PSM	TLTAVHDAILEDLVFPSEIVGK	1634	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=26203	57.933054	4	2367.276965	2366.273329	R	R	121	143
PSM	DFLAGGVAAAISK	1635	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=18911	43.971423	2	1218.662550	1218.660838	K	T	11	24
PSM	FACHSASLTVR	1636	sp|Q15233|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4	ms_run[1]:scan=7099	19.795025	3	1248.611243	1247.608091	R	N	143	154
PSM	IDEPLEGSEDR	1637	sp|P61978|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8234	22.774658	2	1259.569012	1258.567725	K	I	423	434
PSM	LLASANLEEVTMK	1638	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=15753	37.959388	2	1417.7493	1417.7481	K	Q	332	345
PSM	TGTITTFEHAHNMR	1639	sp|P13639|EF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7844	21.668459	3	1616.780062	1614.757274	K	V	482	496
PSM	AAFTAFEEAQLPR	1640	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=18069	42.347941	3	1450.728673	1449.725229	R	L	171	184
PSM	FTLDCTHPVEDGIMDAANFEQFLQER	1641	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	5-UNIMOD:4	ms_run[1]:scan=27173	59.821018	4	3083.380081	3082.380072	K	I	21	47
PSM	TPGPGAQSALR	1642	sp|P62263|RS14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=6113	17.647106	2	1053.557140	1053.556707	K	A	107	118
PSM	TPAQYDASELK	1643	sp|P07355|ANXA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8260	22.835557	2	1222.590061	1221.587733	K	A	105	116
PSM	SKVDEAVAVLQAHQAK	1644	sp|P11940|PABP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11325	29.354882	3	1693.920562	1692.915883	R	E	605	621
PSM	STILAVDNFNGIK	1645	sp|Q9Y388|RBMX2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17456	41.154122	2	1390.746526	1390.745630	R	I	89	102
PSM	QFLSQFEMQSR	1646	sp|Q16630|CPSF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17053	40.35764	2	1400.648045	1399.655435	K	K	162	173
PSM	LLDLVQQSCNYK	1647	sp|P55769|NH2L1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:4	ms_run[1]:scan=14316	35.382773	2	1481.743137	1479.739165	K	Q	22	34
PSM	HVICTSEDMLNPNYEDLLIRK	1648	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	4-UNIMOD:4	ms_run[1]:scan=15971	38.35879	4	2561.230919	2559.246145	R	S	3304	3325
PSM	YNYEPLTQDHVDTLGPLSAQTGIAVLDMCASLK	1649	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	29-UNIMOD:4	ms_run[1]:scan=26600	58.686428	3	3622.754444	3619.753836	K	E	3500	3533
PSM	AAAMANNLQK	1650	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5019	15.132	2	1030.523	1030.5230	R	G	213	223
PSM	AAFGISDSYVDGSSFDPQRR	1651	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16908	40.094	3	2174.0029	2174.0029	R	A	137	157
PSM	AAVLKPVLLGLR	1652	sp|Q9BRP1|PDD2L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=24523	54.923	2	1290.8387	1290.8387	M	D	2	14
PSM	AFITNIPFDVK	1653	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20797	47.732	2	1263.6863	1263.6863	R	W	73	84
PSM	AGGAAVVITEPEHTK	1654	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7371	20.375	2	1478.7729	1478.7729	K	E	78	93
PSM	AILVDLEPGTMDSVR	1655	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:35	ms_run[2]:scan=16713	39.751	2	1630.8236	1630.8236	R	S	63	78
PSM	ALIAAQYSGAQVR	1656	sp|P26641|EF1G_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11189	29.086	2	1346.7306	1346.7306	K	V	18	31
PSM	ARFEELNADLFR	1657	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17087	40.429	2	1479.747	1479.7470	R	G	300	312
PSM	ASPSPTDPVVPAVPIGPPPAGFR	1658	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19961	45.913	3	2225.1845	2225.1845	K	D	520	543
PSM	AVDIPHMDIEALK	1659	sp|P62906|RL10A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17619	41.444	3	1450.749	1450.7490	K	K	79	92
PSM	AVSEEQQPALK	1660	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5909	17.005	2	1198.6194	1198.6194	K	G	164	175
PSM	AYSEALAAFGNGALFVEK	1661	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23203	52.437	3	1856.9309	1856.9309	R	F	220	238
PSM	CGYPGHLTFECR	1662	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=10935	28.636	3	1495.6337	1495.6337	K	N	18	30
PSM	CPFTGNVSIR	1663	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=10981	28.721	2	1149.5601	1149.5601	K	G	60	70
PSM	DCDHADEQK	1664	sp|P62633-7|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=1958	8.5313	2	1116.4142	1116.4142	R	C	93	102
PSM	DFMIQGGDFTR	1665	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17137	40.581	2	1285.5761	1285.5761	K	G	99	110
PSM	DIDGHMVNLDKYR	1666	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11539	29.739	4	1574.7511	1574.7511	K	G	21	34
PSM	DLEEFFSTVGK	1667	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23474	52.924	2	1270.6081	1270.6081	R	V	146	157
PSM	DLLHPSPEEEK	1668	sp|P42677|RS27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8679	23.7	2	1292.6248	1292.6248	K	R	6	17
PSM	EAGDVCYADVYR	1669	sp|Q07955|SRSF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=11547	29.754	2	1416.598	1416.5980	R	D	143	155
PSM	EDGQEYAQVIK	1670	sp|P47813|IF1AX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9983	26.599	2	1278.6092	1278.6092	K	M	30	41
PSM	ELVFKEDGQEYAQVIK	1671	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15330	37.189	3	1894.9676	1894.9676	R	M	25	41
PSM	ENNVDAVHPGYGFLSER	1672	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14120	35.027	2	1902.886	1902.8860	K	A	108	125
PSM	EYWMDPEGEMKPGR	1673	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:35	ms_run[2]:scan=11633	29.913	3	1739.7283	1739.7283	R	K	87	101
PSM	EYWMDPEGEMKPGR	1674	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14098	34.99	3	1723.7334	1723.7334	R	K	87	101
PSM	FGAYIVDGLR	1675	sp|O00763-3|ACACB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17209	40.727	2	1109.5869	1109.5869	K	Q	1972	1982
PSM	FGYHIIMVEGR	1676	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14508	35.727	3	1320.6649	1320.6649	K	K	120	131
PSM	FTTTLNDFNLVAMK	1677	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:35	ms_run[2]:scan=28816	62.575	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	1678	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23557	53.085	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	GDTGGEDTAAPGR	1679	sp|Q9H773|DCTP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3584	11.71	2	1202.5164	1202.5164	R	F	10	23
PSM	GFGFVTFDDHDPVDKIVLQK	1680	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20838	47.803	4	2276.1477	2276.1477	R	Y	154	174
PSM	GHVFEESQVAGTPMFVVK	1681	sp|P13639|EF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16409	39.207	3	1960.9717	1960.9717	R	A	768	786
PSM	GPGGSSLLIEALSNSSHK	1682	sp|Q9BSH4|TACO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18070	42.349	3	1752.9006	1752.9006	R	C	142	160
PSM	GPSYGLSAEVK	1683	sp|Q15417-3|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9598	25.85	2	1106.5608	1106.5608	K	N	7	18
PSM	GQVCLPVISAENWKPATK	1684	sp|P68036-2|UB2L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=17654	41.512	3	1997.0404	1997.0404	K	T	51	69
PSM	HHEEEIVHHKK	1685	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1868	8.3778	4	1421.7164	1421.7164	K	E	73	84
PSM	HKELAPYDENWFYTR	1686	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15236	37.025	4	1967.9166	1967.9166	K	A	42	57
PSM	HPHDIIDDINSGAVECPAS	1687	sp|P30050|RL12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	16-UNIMOD:4	ms_run[2]:scan=14491	35.696	3	2045.9113	2045.9113	R	-	147	166
PSM	HVFLTGPPGVGK	1688	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10143	26.89	3	1207.6713	1207.6713	R	T	4	16
PSM	HVICTSEDMFNPNYEDLLIRK	1689	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=20972	48.038	3	2593.2305	2593.2305	R	S	3304	3325
PSM	HYGPGWVSMANAGK	1690	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:35	ms_run[2]:scan=8540	23.362	3	1489.6772	1489.6772	K	D	132	146
PSM	IAGYVTHLMK	1691	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10447	27.482	2	1131.6111	1131.6111	K	R	50	60
PSM	IALTDNALIAR	1692	sp|P18124|RL7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14712	36.094	2	1169.6768	1169.6768	R	S	167	178
PSM	IEVIEIMTDR	1693	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18911	43.971	2	1217.6326	1217.6326	K	G	131	141
PSM	IRELTAVVQK	1694	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7601	20.88	3	1155.6976	1155.6976	R	R	66	76
PSM	ISGLIYEETR	1695	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12648	31.739	2	1179.6136	1179.6136	R	G	47	57
PSM	ITVTSEVPFSK	1696	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13194	33.16	2	1206.6496	1206.6496	K	R	70	81
PSM	KFEEEGNPYYSSAR	1697	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8435	23.173	3	1675.7478	1675.7478	K	V	512	526
PSM	KGVEGLIDIENPNR	1698	sp|Q13442|HAP28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13765	34.382	3	1552.8209	1552.8209	R	V	75	89
PSM	KHPDASVNFSEFSK	1699	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9950	26.541	4	1591.7631	1591.7631	K	K	30	44
PSM	KICANDAIPK	1700	sp|Q96EY4|TMA16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=6121	17.661	2	1128.5961	1128.5961	R	T	160	170
PSM	KLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGK	1701	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	19-UNIMOD:4	ms_run[2]:scan=20128	46.277	5	3560.7875	3560.7875	R	A	108	140
PSM	KSEIEYYAMLAK	1702	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14934	36.483	3	1444.7272	1444.7272	R	T	57	69
PSM	KSNHNFLVQAGNVQLR	1703	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16756	39.833	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1704	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22537	51.16	4	1823.9755	1823.9755	R	V	3324	3340
PSM	LAAAILGGVDQIHIKPGAK	1705	sp|P22087|FBRL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14926	36.469	4	1871.0993	1871.0993	K	V	144	163
PSM	LCLNICVGESGDR	1706	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=15402	37.316	2	1491.681	1491.6810	K	L	20	33
PSM	LEHIDGVNLTVPVK	1707	sp|Q6P087-2|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14593	35.887	3	1532.8562	1532.8562	K	A	177	191
PSM	LGDLYEEEMR	1708	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12807	32.017	2	1253.5598	1253.5598	R	E	146	156
PSM	LGEMWNNTAADDKQPYEK	1709	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11412	29.511	2	2108.9473	2108.9473	K	K	129	147
PSM	LGTPELSTAER	1710	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9145	24.869	2	1172.6037	1172.6037	R	K	2151	2162
PSM	LIDLHSPSEIVK	1711	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12695	31.824	3	1349.7555	1349.7555	R	Q	88	100
PSM	LKNEIPNSHILDQYR	1712	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12119	30.77	3	1838.9639	1838.9639	R	N	210	225
PSM	LKQSLPPGLAVK	1713	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9633	25.918	2	1249.7758	1249.7758	K	E	56	68
PSM	LLIHQSLAGGIIGVK	1714	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15952	38.323	3	1517.9293	1517.9293	R	G	125	140
PSM	LNISFPATGCQK	1715	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	10-UNIMOD:4	ms_run[2]:scan=14261	35.27	2	1334.6653	1334.6653	K	L	3	15
PSM	LQLLEDDKENR	1716	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8893	24.183	3	1371.6994	1371.6994	K	Y	572	583
PSM	LQPTWNDLGDKYNSMEDAK	1717	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15041	36.671	3	2224.0106	2224.0106	R	V	95	114
PSM	LSFEDFVTMTASR	1718	sp|Q9UBV8|PEF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=24863	55.533	2	1502.7075	1502.7075	R	M	270	283
PSM	LYSENEGMASNQGK	1719	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6522	18.465	2	1526.6671	1526.6671	K	M	4	18
PSM	MDATANDVPSPYEVR	1720	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12308	31.09	2	1663.7512	1663.7512	K	G	434	449
PSM	MGPLGLDHMASSIER	1721	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15616	37.683	3	1612.7701	1612.7701	R	M	418	433
PSM	MMNGGHYTYSENR	1722	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6523	18.466	3	1558.6293	1558.6293	K	V	133	146
PSM	NDFTEEEEAQVR	1723	sp|P63208|SKP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10066	26.75	2	1465.6321	1465.6321	K	K	143	155
PSM	NPGFEIIHGLLDR	1724	sp|Q9NSD9-2|SYFB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21315	48.64	3	1479.7834	1479.7834	K	I	406	419
PSM	NTAMDAQEALAR	1725	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9521	25.677	2	1289.6034	1289.6034	R	R	182	194
PSM	SEETLDEGPPKYTK	1726	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7429	20.473	3	1592.757	1592.7570	K	S	100	114
PSM	SETAPAAPAAAPPAEKAPVK	1727	sp|P16403|H12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=8652	23.634	3	1915.0051	1915.0051	M	K	2	22
PSM	SGGGGGGGGSSWGGR	1728	sp|Q13151|ROA0_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4724	14.348	2	1191.5017	1191.5017	K	S	270	285
PSM	SHGLFGLNENQLR	1729	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13802	34.455	3	1483.7532	1483.7532	K	I	142	155
PSM	SKITVTSEVPFSK	1730	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10924	28.615	3	1421.7766	1421.7766	K	R	68	81
PSM	SMGGAAIAPPTSLVEK	1731	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14308	35.366	2	1527.7967	1527.7967	R	D	169	185
PSM	SNHNFLVQAGNVQLR	1732	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6364	18.17	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1733	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=30167	65.056	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1734	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=30950	66.892	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1735	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=31931	70.04	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1736	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=31585	68.783	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SPYQEFTDHLVK	1737	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14844	36.33	2	1462.7092	1462.7092	K	T	264	276
PSM	SQVVAGTNYFIK	1738	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13759	34.371	2	1325.698	1325.6980	K	V	45	57
PSM	TDCDIEDDRLAAMFR	1739	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=18225	42.681	3	1826.7927	1826.7927	K	E	1295	1310
PSM	TGQAPGYSYTAANK	1740	sp|P99999|CYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7030	19.657	2	1427.6681	1427.6681	K	N	41	55
PSM	TIRYPDPLIK	1741	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12363	31.186	3	1214.7023	1214.7023	R	V	146	156
PSM	TPGPGAQSALR	1742	sp|P62263|RS14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6018	17.432	2	1053.5567	1053.5567	K	A	107	118
PSM	TTGFGMIYDSLDYAKK	1743	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19765	45.56	3	1808.8655	1808.8655	K	N	69	85
PSM	TTNFAGILSQGLR	1744	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20549	47.204	3	1376.7412	1376.7412	R	I	866	879
PSM	TTPDVIFVFGFR	1745	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=25941	57.451	2	1397.7343	1397.7343	K	T	50	62
PSM	TVTAMDVVYALK	1746	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21262	48.554	2	1309.6952	1309.6952	K	R	81	93
PSM	VADPTPFHIQAEVTMK	1747	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15351	37.228	3	1782.8975	1782.8975	K	T	97	113
PSM	VANVSLLALYK	1748	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18961	44.078	2	1189.7071	1189.7071	K	G	125	136
PSM	VFSGLVSTGLK	1749	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14546	35.802	2	1106.6336	1106.6336	R	V	416	427
PSM	VGSTSENITQK	1750	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4344	13.503	2	1162.583	1162.5830	R	V	392	403
PSM	VIGHSMQNCVLK	1751	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=9427	25.5	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VIKDFMIQGGDFTR	1752	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15716	37.883	3	1625.8236	1625.8236	R	G	96	110
PSM	VKEPSVQEATSTSDILK	1753	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11320	29.344	3	1830.9575	1830.9575	K	V	230	247
PSM	VLGVPIIVQASQAEK	1754	sp|Q14498-3|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18531	43.264	2	1550.9032	1550.9032	R	N	196	211
PSM	VTHVEPWEK	1755	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7359	20.355	2	1123.5662	1123.5662	K	G	93	102
PSM	VWINTSDIILVGLR	1756	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=25624	56.89	2	1597.9192	1597.9192	K	D	69	83
PSM	VYYFNHITNASQWERPSGNSSSGGK	1757	sp|Q13526|PIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13429	33.675	4	2785.2845	2785.2845	R	N	22	47
PSM	YALYDATYETK	1758	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12458	31.349	2	1336.6187	1336.6187	R	E	82	93
PSM	YGEPGEVFINK	1759	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12670	31.779	2	1251.6136	1251.6136	K	G	320	331
PSM	YHTINGHNAEVR	1760	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3897	12.533	4	1409.68	1409.6800	K	K	174	186
PSM	YLQSLLAEVERR	1761	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18368	42.984	3	1475.8096	1475.8096	R	I	88	100
PSM	YVLEEAEQLEPR	1762	sp|Q8NAV1|PR38A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16006	38.427	2	1474.7304	1474.7304	R	V	169	181
PSM	AYIAYELNSVQHR	1763	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12270	31.023616	3	1562.785579	1562.784141	R	Q	1157	1170
PSM	KIAPYVAHNFSK	1764	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6922	19.459756	3	1373.746524	1373.745571	K	L	589	601
PSM	HVICTSEDMLNPNYEDLLIRK	1765	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=14217	35.196441	4	2576.2722	2575.2402	R	S	3304	3325
PSM	HVICTSEDMLNPNYEDLLIRK	1766	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18134	42.47029	4	2575.254328	2575.241060	R	S	3304	3325
PSM	KSNHNFLVQAGNVQLR	1767	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16905	40.089823	3	1823.977972	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1768	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15626	37.700213	4	1823.976253	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1769	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13549	33.895969	3	1823.975438	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	1770	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6950	19.516391	3	1695.880037	1695.880501	K	V	3325	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1771	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26125	57.792324	4	3592.740409	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1772	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=23320	52.651122	4	3607.712856	3606.705781	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	1773	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=32803	72.679452	5	5733.4542	5732.4622	K	Q	3401	3452
PSM	FTTTLNDFNLVAMK	1774	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:35	ms_run[1]:scan=21529	49.292792	2	1630.806800	1629.807245	R	Y	3486	3500
PSM	SDGTGTIYTELEPPCR	1775	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	15-UNIMOD:4	ms_run[1]:scan=15508	37.496325	2	1794.812849	1794.809429	K	F	4199	4215
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1776	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=29165	63.206706	3	3635.800042	3633.769486	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1777	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	29-UNIMOD:4	ms_run[1]:scan=28782	62.509528	3	3619.779196	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1778	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	29-UNIMOD:4	ms_run[1]:scan=31761	69.447973	3	3619.787919	3617.774571	K	E	3500	3533
PSM	VEGCMVQVTCGTTTLNGLWLDDAVYCPR	1779	cov|corona11687|ORF1a_USA/OR-PROV-075/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=26283	58.067795	3	3216.473492	3214.455562	K	H	3276	3304
PSM	HVICTSEDMFNPNYEDLLIRK	1780	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4	ms_run[1]:scan=20983	48.056921	3	2594.214780	2593.230495	R	S	3304	3325
PSM	LEQMPSKEDAIEHFMK	1781	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13729	34.310749	3	1931.918389	1931.912120	K	L	601	617
PSM	LISQIVSSITASLR	1782	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=26897	59.315598	3	1488.881064	1486.871893	R	F	230	244
PSM	LAETQEEISAEVAAK	1783	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13363	33.540263	2	1588.802708	1587.799182	R	A	108	123
PSM	CTLCSQPGATIGCEIK	1784	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=12035	30.626725	3	1793.809403	1793.811027	K	A	280	296
PSM	AFVAIGDYNGHVGLGVK	1785	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16437	39.253619	3	1715.901795	1715.899505	K	C	126	143
PSM	FIQENIFGICPHMTEDNKDLIQGK	1786	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	10-UNIMOD:4	ms_run[1]:scan=19028	44.200865	4	2847.380431	2846.373136	K	D	235	259
PSM	FNASQLITQR	1787	sp|Q99623|PHB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13854	34.544929	2	1176.627477	1176.625121	K	A	148	158
PSM	CGHTNNLRPK	1788	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3862	12.432251	2	1179.5642	1178.5612	K	K	115	125
PSM	QLELVEPSGWIHVPLTDNHK	1789	sp|Q9UM13|APC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=20226	46.444249	4	2312.204366	2311.196081	R	K	110	130
PSM	EAMVQAEEAAAEITR	1790	sp|O00567|NOP56_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16953	40.1747	2	1618.759617	1617.766836	K	K	423	438
PSM	HGSSEDYLHMVHR	1791	sp|Q6KC79|NIPBL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8398	23.10912	4	1566.699526	1566.699759	R	L	241	254
PSM	GCIGTFSAMNLHSGLR	1792	sp|Q6DCA0|AMERL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4	ms_run[1]:scan=15160	36.888669	3	1719.818459	1719.818495	R	E	152	168
PSM	YVENPSQVLNCER	1793	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:4	ms_run[1]:scan=12175	30.861151	2	1608.750769	1606.740956	R	R	1334	1347
PSM	LQGEVVAFDYQSK	1794	sp|Q3MHD2|LSM12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=14052	34.906395	2	1482.735651	1482.735459	R	M	25	38
PSM	IVQAEGEAEAAK	1795	sp|Q99623|PHB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=5396	15.880956	2	1216.629461	1214.614282	K	M	225	237
PSM	TTPSVVAFTADGER	1796	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13039	32.699773	2	1450.703098	1449.709973	R	L	86	100
PSM	PVICTSEDMHNPNYEDLLIR	1797	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=26809	59.152087	3	2434.127350	2431.114796	R	K	3304	3324
PSM	KSNHNFLVQAGNVQLR	1798	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12089	30.720254	4	1824.963027	1823.975464	R	V	3324	3340
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1799	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	29-UNIMOD:4	ms_run[1]:scan=31401	68.182423	3	3620.767966	3617.774571	K	E	3500	3533
PSM	HVICTSEDMLNPNYEDLLIRK	1800	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	4-UNIMOD:4	ms_run[1]:scan=23509	52.988778	3	2562.255573	2559.246145	R	S	3304	3325
PSM	AAECNIVVTQPR	1801	sp|Q08211|DHX9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4	ms_run[2]:scan=8544	23.371	2	1356.682	1356.6820	R	R	435	447
PSM	AALEAAAAAAPER	1802	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8421	23.151	2	1210.6306	1210.6306	R	G	12	25
PSM	AGNEKEEGETADTVGCCSLR	1803	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	16-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=7449	20.506	3	2181.9267	2181.9267	R	V	489	509
PSM	AIIIFVPVPQLK	1804	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=24522	54.921	2	1336.8482	1336.8482	K	S	59	71
PSM	AILVDLEPGTMDSVR	1805	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19233	44.605	3	1614.8287	1614.8287	R	S	63	78
PSM	ALYETELADAR	1806	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12339	31.145	2	1250.6143	1250.6143	K	R	80	91
PSM	AMLDQLMGTSR	1807	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:35	ms_run[2]:scan=11216	29.139	2	1237.5795	1237.5795	R	D	9	20
PSM	CCLTYCFNKPEDK	1808	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10328	27.22	2	1733.7211	1733.7211	K	-	144	157
PSM	CGDSVYAAEK	1809	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=5350	15.781	2	1098.4652	1098.4652	R	I	122	132
PSM	CYSCGEFGHIQK	1810	sp|P62633-7|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8353	23.02	3	1484.6177	1484.6177	K	D	102	114
PSM	DEILPTTPISEQK	1811	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13292	33.408	2	1469.7613	1469.7613	K	G	215	228
PSM	DFNHINVELSLLGK	1812	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20932	47.965	3	1597.8464	1597.8464	R	K	37	51
PSM	DGQVINETSQHHDDLE	1813	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7805	21.587	3	1835.7922	1835.7922	R	-	451	467
PSM	DIPGLTDTTVPR	1814	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14703	36.078	2	1283.6721	1283.6721	K	R	120	132
PSM	DKDAYSSFGSR	1815	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7113	19.827	3	1231.5469	1231.5469	K	S	49	60
PSM	DLDPNNVIIEQEER	1816	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15115	36.805	2	1682.8111	1682.8111	K	R	73	87
PSM	DNIQGITKPAIR	1817	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8861	24.104	3	1324.7463	1324.7463	R	R	25	37
PSM	DREGFFTNGLTLGAK	1818	sp|P35080-2|PROF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17509	41.246	3	1624.8209	1624.8209	K	K	55	70
PSM	DVNFEFPEFQL	1819	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=28011	61.224	2	1383.6347	1383.6347	K	-	184	195
PSM	EHALLAYTLGVK	1820	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14687	36.051	3	1313.7343	1313.7343	R	Q	135	147
PSM	EITALAPSTMK	1821	sp|P63261|ACTG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10938	28.64	2	1160.6111	1160.6111	K	I	316	327
PSM	ELGLDEGVDSLK	1822	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14701	36.075	2	1273.6402	1273.6402	K	A	206	218
PSM	FDDKPDYSYLR	1823	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11549	29.757	3	1417.6514	1417.6514	R	Q	260	271
PSM	FGQGGAGPVGGQGPR	1824	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7172	19.985	2	1340.6585	1340.6585	R	G	667	682
PSM	FIGPSPEVVR	1825	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11509	29.686	2	1099.6026	1099.6026	R	K	138	148
PSM	FKIGDQEFDHLPALLEFYK	1826	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=24671	55.191	4	2309.1732	2309.1732	R	I	71	90
PSM	FLQDYFDGNLKR	1827	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15857	38.156	3	1514.7518	1514.7518	R	Y	352	364
PSM	FNASQLITQR	1828	sp|Q99623|PHB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13772	34.396	2	1176.6251	1176.6251	K	A	148	158
PSM	FQRPGDPQSAQDK	1829	sp|Q15637-4|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4967	14.981	3	1472.7008	1472.7008	K	A	294	307
PSM	FTTTLNDFNLVAMK	1830	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26002	57.565	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FYEQVVQAIQR	1831	sp|Q9BRX2|PELO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15942	38.307	2	1379.7197	1379.7197	R	H	185	196
PSM	GADINAPDKHHITPLLSAVYEGHVSCVK	1832	sp|P58546|MTPN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	26-UNIMOD:4	ms_run[2]:scan=14210	35.183	4	3027.5236	3027.5236	K	L	58	86
PSM	GAPVNISSSDLTGR	1833	sp|P48730-2|KC1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11541	29.742	2	1372.6947	1372.6947	R	Q	376	390
PSM	GDGPICLVLAPTR	1834	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=18421	43.073	2	1367.7231	1367.7231	R	E	165	178
PSM	GGKPEPPAMPQPVPTA	1835	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11342	29.385	2	1572.797	1572.7970	K	-	228	244
PSM	GHQQLYWSHPR	1836	sp|P62273|RS29_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6727	18.975	3	1407.6796	1407.6796	M	K	2	13
PSM	GIPHLVTHDAR	1837	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6379	18.197	2	1214.652	1214.6520	K	T	135	146
PSM	HFELGGDK	1838	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6003	17.387	2	901.42938	901.4294	K	K	90	98
PSM	HGVVPLATYMR	1839	sp|P46778|RL21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12388	31.228	3	1242.6543	1242.6543	K	I	22	33
PSM	HIQSNLDFSPVNSASSEENVK	1840	sp|O14757-2|CHK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12123	30.776	3	2301.0873	2301.0873	K	Y	199	220
PSM	HSEAATAQR	1841	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1942	8.5054	2	969.46281	969.4628	R	E	86	95
PSM	IAGQVAAANK	1842	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3732	12.01	2	941.52943	941.5294	R	K	134	144
PSM	IAPYVAHNFSK	1843	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8336	22.99	3	1245.6506	1245.6506	K	L	590	601
PSM	IFDPQNPDENE	1844	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11418	29.524	2	1316.5521	1316.5521	K	-	293	304
PSM	IFVGGLNPEATEEK	1845	sp|Q99729-3|ROAA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13951	34.728	2	1502.7617	1502.7617	K	I	156	170
PSM	IGFDVVTLSGTR	1846	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18624	43.436	2	1263.6823	1263.6823	R	G	48	60
PSM	IGHPAPNFK	1847	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5702	16.559	2	979.52395	979.5240	K	A	8	17
PSM	ILDDWGETCK	1848	sp|P55145|MANF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=12463	31.359	2	1235.5492	1235.5492	K	G	143	153
PSM	IQFKPDDGISPER	1849	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10260	27.096	2	1500.7573	1500.7573	R	A	287	300
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1850	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=26842	59.214	3	3590.7109	3590.7109	R	G	3369	3401
PSM	ISGLIYEETR	1851	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12314	31.103	2	1179.6136	1179.6136	R	G	47	57
PSM	ISLLLDPGSFVESDMFVEHR	1852	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26106	57.757	3	2290.1304	2290.1304	R	C	70	90
PSM	KDCEVVMMIGLPGAGK	1853	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=17625	41.458	3	1703.8409	1703.8409	K	T	476	492
PSM	KFGDPVVQSDMK	1854	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8639	23.599	3	1349.6649	1349.6649	R	H	77	89
PSM	KGLTPSQIGVILR	1855	sp|P62277|RS13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14877	36.388	3	1380.8453	1380.8453	K	D	43	56
PSM	KGTVEGFEPADNK	1856	sp|P37108|SRP14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6545	18.508	3	1390.6729	1390.6729	K	C	43	56
PSM	KIEHDVVMK	1857	sp|Q9UNZ5|L10K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3739	12.025	3	1097.5903	1097.5903	K	A	60	69
PSM	KIEISQHAK	1858	sp|P61513|RL37A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2959	10.469	2	1052.5978	1052.5978	K	Y	28	37
PSM	KPAAATVTK	1859	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2206	8.9689	2	885.52837	885.5284	K	K	160	169
PSM	KPHIIIATPGR	1860	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6670	18.856	3	1201.7295	1201.7295	K	L	142	153
PSM	KPPLLNNADSVQAK	1861	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7328	20.299	3	1493.8202	1493.8202	K	V	748	762
PSM	KSNHNFLVQAGNVQLR	1862	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13334	33.49	4	1823.9755	1823.9755	R	V	3324	3340
PSM	LEEMFPDEVDTPR	1863	sp|Q2NL82|TSR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15999	38.414	2	1576.7079	1576.7079	R	D	480	493
PSM	LESASTSSLEDR	1864	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7208	20.061	2	1293.6048	1293.6048	K	V	392	404
PSM	LGEEAFFYHSNCKEPGIAGLMK	1865	sp|Q9P016|THYN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:4	ms_run[2]:scan=18058	42.33	4	2497.177	2497.1770	K	I	107	129
PSM	LGEMWSEQSAK	1866	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10983	28.724	2	1264.5758	1264.5758	K	D	129	140
PSM	LGGIGQFLAK	1867	sp|Q08211|DHX9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16983	40.23	2	1002.5862	1002.5862	R	A	810	820
PSM	LGLPPLTPEQQEALQK	1868	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16887	40.06	2	1760.9672	1760.9672	K	A	11	27
PSM	LHLGFIEIR	1869	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19115	44.373	2	1096.6393	1096.6393	K	E	214	223
PSM	LLETCSIALVGK	1870	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4	ms_run[2]:scan=15250	37.049	2	1302.7217	1302.7217	R	Y	295	307
PSM	LTEADYLSSHLTEGPHR	1871	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12402	31.251	4	1924.9279	1924.9279	R	V	91	108
PSM	LTTPTYGDLNHLVSATMSGVTTCLR	1872	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	23-UNIMOD:4	ms_run[2]:scan=25885	57.345	3	2707.3309	2707.3309	K	F	217	242
PSM	LVNHFVEEFK	1873	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12425	31.293	3	1260.6503	1260.6503	R	R	237	247
PSM	LVQAFQFTDK	1874	sp|Q06830|PRDX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14634	35.957	2	1195.6237	1195.6237	R	H	159	169
PSM	LYTLVTYVPVTTFK	1875	sp|P62899|RL31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22573	51.226	2	1643.9174	1643.9174	K	N	102	116
PSM	MKVELCSFSGYK	1876	sp|P83731|RL24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=13399	33.614	3	1447.684	1447.6840	-	I	1	13
PSM	MTDQEAIQDLWQWR	1877	sp|P06748|NPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=25286	56.293	3	1818.8359	1818.8359	R	K	278	292
PSM	NGDLDEVKDYVAK	1878	sp|P58546|MTPN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11857	30.306	3	1464.7096	1464.7096	K	G	12	25
PSM	NKEEAAEYAK	1879	sp|P62753|RS6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3210	11.032	2	1151.5459	1151.5459	K	L	202	212
PSM	NPQNSSQSADGLR	1880	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4544	13.956	2	1372.6331	1372.6331	R	C	54	67
PSM	NSMPASSFQQQK	1881	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:35	ms_run[2]:scan=5057	15.22	2	1367.614	1367.6140	R	L	175	187
PSM	NSMPASSFQQQK	1882	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7154	19.933	2	1351.619	1351.6190	R	L	175	187
PSM	QEMQEVQSSR	1883	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4560	13.986	2	1220.5455	1220.5456	R	S	191	201
PSM	QLYHLGVVEAYSGLTK	1884	sp|Q08211|DHX9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17223	40.748	3	1776.941	1776.9410	R	K	249	265
PSM	QNRPIPQWIR	1885	sp|Q59GN2|R39L5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11477	29.626	3	1306.7258	1306.7258	K	M	19	29
PSM	QQVAFYGQTLGQAQAHSQEQ	1886	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13485	33.778	3	2218.0403	2218.0403	R	-	553	573
PSM	SAAEPVASTPASR	1887	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5059	15.226	2	1242.6204	1242.6204	R	I	343	356
PSM	SDKTEEIAEEEETVFPK	1888	sp|Q9NR30|DDX21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14678	36.035	3	1979.9211	1979.9211	K	A	38	55
PSM	SFLLDLLNATGK	1889	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26617	58.732	2	1290.7184	1290.7184	R	D	413	425
PSM	SHDGAVHKPYNCSHCGK	1890	sp|P56270-3|MAZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=2221	8.9867	4	1952.837	1952.8370	R	S	305	322
PSM	SNHNFLVQAGNVQLR	1891	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6056	17.535	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	1892	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=29262	63.379	2	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQASNVQLR	1893	cov|corona10526|ORF1a_Switzerland/180003_484_B08/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12354	31.17	3	1725.8911	1725.8911	K	V	3325	3340
PSM	SSGCFPNMAAK	1894	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4	ms_run[2]:scan=8813	24.012	2	1168.5005	1168.5005	R	V	457	468
PSM	STTSTIESFAAQEK	1895	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13488	33.782	2	1498.7151	1498.7151	R	Q	174	188
PSM	SVFALTNGIYPHK	1896	sp|Q02878|RL6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16245	38.88	3	1445.7667	1445.7667	R	L	273	286
PSM	TEESPASDEAGEKEAK	1897	sp|P05114|HMGN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3581	11.703	3	1676.7377	1676.7377	K	S	83	99
PSM	TGPNLHGLFGR	1898	sp|P99999|CYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13350	33.519	3	1167.6149	1167.6149	K	K	29	40
PSM	TPAQAAFEK	1899	sp|Q9Y421-3|FA32A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6385	18.208	2	961.4869	961.4869	R	M	39	48
PSM	TSYAQHQQVR	1900	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3126	10.801	2	1216.5949	1216.5949	K	Q	153	163
PSM	VADGMVFGALLPCEECSGQLVFK	1901	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=25848	57.278	3	2526.1957	2526.1957	R	S	283	306
PSM	VFEVMLATDR	1902	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16538	39.444	2	1179.5958	1179.5958	K	S	28	38
PSM	VHLVGIDIFTGK	1903	sp|P63241|IF5A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19029	44.202	3	1297.7394	1297.7394	K	K	56	68
PSM	VIGHSMQNCVLK	1904	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6131	17.678	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1905	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6507	18.439	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	1906	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=7552	20.707	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VWINTSDIILVGLR	1907	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=25694	57.017	3	1597.9192	1597.9192	K	D	69	83
PSM	YLYTLVITDKEK	1908	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14677	36.033	3	1484.8126	1484.8126	R	A	41	53
PSM	YYVTIIDAPGHR	1909	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12763	31.945	3	1403.7197	1403.7197	K	D	85	97
PSM	YYVTIIDAPGHR	1910	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12776	31.966	2	1403.7197	1403.7197	K	D	85	97
PSM	RVSALNSVHCEHVEDEGESR	1911	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:4	ms_run[1]:scan=6157	17.723983	4	2309.046497	2309.045471	K	Y	1760	1780
PSM	QKADEAYLIGR	1912	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=12247	30.985962	2	1245.6356	1245.6348	R	G	78	89
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	1913	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=27032	59.554417	3	3259.5032	3258.4812	K	H	3276	3304
PSM	KSNHNFLVQAGNVQLR	1914	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13834	34.510163	3	1824.976673	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	1915	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=16174	38.745435	3	1823.976576	1823.975464	R	V	3324	3340
PSM	SNHNFLVQAGNVQLR	1916	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6172	17.750927	3	1697.888083	1695.880501	K	V	3325	3340
PSM	VIGHSMQNCVLK	1917	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=10572	27.764685	2	1400.689530	1400.690441	R	L	3340	3352
PSM	FTTTLNDFNLVAMK	1918	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=28383	61.814058	3	1613.813918	1613.812330	R	Y	3486	3500
PSM	ELLQNGMNGR	1919	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:27	ms_run[1]:scan=8203	22.693238	2	1112.5422	1112.5392	K	T	3533	3543
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1920	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	29-UNIMOD:4	ms_run[1]:scan=30097	64.915267	3	3618.756547	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1921	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	29-UNIMOD:4	ms_run[1]:scan=31226	67.646715	3	3619.775866	3617.774571	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1922	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	29-UNIMOD:4	ms_run[1]:scan=30503	65.772405	3	3617.766507	3617.774571	K	E	3500	3533
PSM	PVICTSEDMHNPNYEDLLIR	1923	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=23896	53.725031	3	2431.114573	2431.114796	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIRK	1924	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=15543	37.555874	4	2560.2242	2559.2092	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIRK	1925	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4	ms_run[1]:scan=19447	44.990676	4	2544.227849	2543.214844	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIR	1926	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4	ms_run[1]:scan=20289	46.556788	3	2416.126283	2415.119881	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	1927	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18541	43.284284	2	2433.131470	2431.114796	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	1928	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18253	42.744555	3	2431.126660	2431.114796	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	1929	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=24389	54.684191	3	2433.121305	2431.114796	R	K	3304	3324
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	1930	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23537	53.04562	3	3581.673157	3580.690130	R	G	3369	3401
PSM	HVICTSEDMFNPNYEDLLIRK	1931	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=21092	48.249701	3	2609.211855	2609.225410	R	S	3304	3325
PSM	FEELNADLFR	1932	sp|P54652|HSP72_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=19126	44.410541	2	1253.611599	1252.608802	R	G	305	315
PSM	HWPFQVINDGDKPK	1933	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12817	32.034095	4	1680.847458	1679.841990	K	V	89	103
PSM	HWPFQVINDGDKPK	1934	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12872	32.127071	2	1680.852635	1679.841990	K	V	89	103
PSM	DAGVIAGLNVLR	1935	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=19709	45.461004	3	1197.690837	1196.687721	K	I	160	172
PSM	AQFEGIVTDLIR	1936	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=22497	51.087277	2	1360.735392	1360.735065	R	R	349	361
PSM	GPGTSFEFALAIVEALNGK	1937	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=28052	61.288853	3	1919.999261	1919.999279	R	E	157	176
PSM	IEYDCELVPR	1938	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4	ms_run[1]:scan=13413	33.646081	2	1292.606197	1292.607088	R	R	301	311
PSM	SIEIPRPVDGVEVPGCGK	1939	sp|P26368|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	16-UNIMOD:4	ms_run[1]:scan=15049	36.685778	3	1907.980802	1907.977498	K	I	414	432
PSM	ELEEIVQPIISK	1940	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=17407	41.06525	2	1397.784731	1396.781347	K	L	622	634
PSM	VAHEDPMYDIIR	1941	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13853	34.543433	2	1459.691129	1457.697300	R	D	135	147
PSM	FLQEHGSDSFLAEHK	1942	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9847	26.36696	3	1744.826187	1743.821649	K	L	28	43
PSM	CGDSVYAAEK	1943	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4	ms_run[1]:scan=5433	15.955498	2	1098.465248	1098.465175	R	I	122	132
PSM	LVQAFQFTDK	1944	sp|Q06830|PRDX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14596	35.891024	2	1195.624759	1195.623724	R	H	159	169
PSM	TFSHELSDFGLESTAGEIPVVAIR	1945	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=22941	51.990187	3	2576.301596	2574.296583	K	T	306	330
PSM	FSSELEQIELHNSIR	1946	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15444	37.392492	3	1800.901960	1800.900627	R	D	85	100
PSM	TSEVPYAGINIGPVHK	1947	sp|O60841|IF2P_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14061	34.922808	3	1680.885473	1680.883521	K	K	1000	1016
PSM	LFIGGLNTETNEK	1948	sp|P38159|RBMX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14594	35.888013	2	1434.736369	1434.735459	K	A	10	23
PSM	GECQACDQLHFCR	1949	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:4,6-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=9041	24.576951	3	1680.655478	1679.660280	R	R	97	110
PSM	LNISFPATGCQK	1950	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:4	ms_run[1]:scan=14253	35.255568	2	1334.666816	1334.665272	K	L	3	15
PSM	DIPGLTDTTVPR	1951	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14759	36.177963	2	1283.673588	1283.672131	K	R	120	132
PSM	MLSSAYISDHMK	1952	sp|P56270|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11740	30.103204	2	1381.637259	1381.637008	K	V	400	412
PSM	GQVCLPVISAENWKPATK	1953	sp|P68036|UB2L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	4-UNIMOD:4	ms_run[1]:scan=17673	41.543219	3	1999.047356	1997.040432	K	T	83	101
PSM	CGHTNNLRPK	1954	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3835	12.330769	3	1178.5607	1178.5610	K	K	115	125
PSM	FLLHEPIVNK	1955	sp|O00541|PESC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11904	30.397844	3	1208.691853	1208.691744	R	F	72	82
PSM	VGDQILLAIK	1956	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=17474	41.183278	2	1068.655663	1068.654296	K	G	69	79
PSM	QKPMNVGLSETQNGGMSQEAVGNIK	1957	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12028	30.613982	3	2617.265974	2616.263585	K	V	58	83
PSM	YITDWQNVFR	1958	sp|O75340|PDCD6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=21313	48.637084	2	1341.651707	1340.651336	K	T	91	101
PSM	SDKTEEIAEEEETVFPK	1959	sp|Q9NR30|DDX21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14718	36.103029	3	1981.925663	1979.921148	K	A	38	55
PSM	MDDREDLVYQAK	1960	sp|P62258|1433E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:1	ms_run[1]:scan=12829	32.052061	2	1524.698338	1523.692609	-	L	1	13
PSM	DTTVISHSPNTSYDTALEAR	1961	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11572	29.799131	3	2178.024679	2177.023656	R	I	707	727
PSM	FACNGTVIEHPEYGEVIQLQGDQR	1962	sp|O60739|EIF1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:4	ms_run[1]:scan=16325	39.053722	3	2761.296530	2759.297329	K	K	67	91
PSM	AAGVNVEPFWPGLFAK	1963	sp|P05386|RLA1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=25383	56.458377	2	1702.891485	1701.887878	K	A	34	50
PSM	LTEVPVEPVLTVHPESK	1964	sp|Q9H307|PININ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14366	35.470835	3	1873.022503	1873.019680	K	S	537	554
PSM	VGDTLDLLIGEDKEAGTETVMR	1965	sp|Q9P0P8|MRES1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=20154	46.321077	3	2362.167441	2361.173357	K	I	184	206
PSM	VLIAAHGNSLR	1966	sp|P18669|PGAM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=6704	18.930129	3	1149.661667	1149.661841	R	G	181	192
PSM	GGAEQFMEETER	1967	sp|Q99832|TCPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11740	30.103204	2	1383.581068	1382.577244	R	S	376	388
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	1968	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	29-UNIMOD:4	ms_run[1]:scan=30886	66.727459	3	3620.771628	3617.774571	K	E	3500	3533
PSM	IMQSSSEVGYDAMAGDFVNMVEK	1969	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=24335	54.591657	3	2508.110738	2507.101848	K	G	494	517
PSM	IQPGQTFSVLACYNGTPSGVYQCAMRPNFTIK	1970	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=19763	45.556722	4	3622.697266	3620.721431	R	G	3369	3401
PSM	AESSDKLYR	1971	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=7332	20.307	2	1109.5353	1109.5353	M	V	2	11
PSM	AFYGDTLVTGFAR	1972	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19753	45.539	2	1416.7038	1416.7038	K	I	349	362
PSM	AGLQFPVGR	1973	sp|Q7L7L0|H2A3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13128	32.979	2	943.52395	943.5240	R	V	22	31
PSM	AGLQFPVGR	1974	sp|Q7L7L0|H2A3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13929	34.685	2	943.52395	943.5240	R	V	22	31
PSM	AGVPGVAAPGAPAAAPPAK	1975	sp|P53350|PLK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10003	26.636	2	1568.8675	1568.8675	K	E	20	39
PSM	ALAAAGYDVEK	1976	sp|P10412|H14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8744	23.863	2	1106.5608	1106.5608	K	N	65	76
PSM	ANPFGGASHAK	1977	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4443	13.732	2	1055.5148	1055.5148	K	G	38	49
PSM	ARPAEVGGMQLR	1978	sp|P33316-2|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7782	21.531	3	1283.6768	1283.6768	R	F	16	28
PSM	CGHTNNLRPK	1979	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=2204	8.9665	3	1195.588	1195.5880	K	K	115	125
PSM	DDNMFQIGK	1980	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:35	ms_run[2]:scan=9790	26.247	2	1082.4703	1082.4703	R	M	60	69
PSM	DFIIQTGDPTGTGR	1981	sp|Q8WUA2|PPIL4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14129	35.046	2	1476.7209	1476.7209	R	G	48	62
PSM	DREEALHQFR	1982	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6565	18.544	3	1299.632	1299.6320	R	S	463	473
PSM	DRHEASGFAR	1983	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3242	11.093	3	1144.5374	1144.5374	K	R	140	150
PSM	DSHGVAQVR	1984	sp|P62277|RS13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3314	11.216	2	967.48354	967.4835	R	F	56	65
PSM	DTNGSQFFITTVK	1985	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17200	40.71	3	1456.7198	1456.7198	K	T	146	159
PSM	DVKPDNFLMGLGK	1986	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18613	43.414	3	1432.7384	1432.7384	R	K	128	141
PSM	EAGGGGVGGPGAK	1987	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2879	10.302	2	1012.4938	1012.4938	K	S	40	53
PSM	EALLAALGYK	1988	sp|Q9BU76-2|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19661	45.375	2	1047.5964	1047.5964	R	N	76	86
PSM	ELAEQTLNNIK	1989	sp|Q92499-3|DDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11393	29.478	2	1271.6721	1271.6721	R	Q	169	180
PSM	ELAVQIYEEAR	1990	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15541	37.553	2	1319.6721	1319.6721	R	K	261	272
PSM	ELLTSFGPLK	1991	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18593	43.381	2	1103.6227	1103.6227	K	A	277	287
PSM	ELNSNHDGADETSEKEQQEAIEHIDEVQNEIDR	1992	sp|Q01105-2|SET_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17257	40.806	4	3820.6896	3820.6896	K	L	12	45
PSM	EMDEEDKAFK	1993	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6260	17.93	2	1240.5282	1240.5282	K	Q	21	31
PSM	FKGTESISK	1994	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4165	13.105	2	995.52876	995.5288	R	V	72	81
PSM	FNSLNELVDYHR	1995	sp|P62993|GRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15354	37.232	3	1505.7263	1505.7263	K	S	125	137
PSM	FPLTTESAMK	1996	sp|P62750|RL23A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11726	30.079	2	1123.5583	1123.5583	K	K	79	89
PSM	FTFPDPPPLSPPVLGLHGVTFGYQGQKPLFK	1997	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24803	55.43	4	3380.7962	3380.7962	R	N	574	605
PSM	FTTTLNDFNLVAMK	1998	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:35	ms_run[2]:scan=21006	48.099	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FVVTGSKDETIHIYDMK	1999	sp|Q9NWT1|PK1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13571	33.934	3	1981.9819	1981.9819	R	K	54	71
PSM	GAKEEHGGLIR	2000	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3300	11.193	3	1165.6204	1165.6204	R	S	68	79
PSM	GGFCNFMHLKPISR	2001	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=14903	36.429	3	1662.8123	1662.8123	R	E	166	180
PSM	GNKPWISLPR	2002	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12815	32.032	3	1166.656	1166.6560	K	G	231	241
PSM	GNLVYIIDFGLAK	2003	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=25243	56.219	2	1421.7919	1421.7919	K	K	142	155
PSM	GPIQSSGPTIQDYLNRPR	2004	sp|Q5BKY9|F133B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14791	36.238	3	1998.0283	1998.0283	R	P	21	39
PSM	GPLEPSEPAVVAAAR	2005	sp|P29372-4|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12391	31.233	2	1462.778	1462.7780	R	V	242	257
PSM	GPLMMYISK	2006	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15579	37.618	2	1038.5242	1038.5242	K	M	392	401
PSM	GPSSVEDIK	2007	sp|P06748|NPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6068	17.563	2	930.46583	930.4658	K	A	240	249
PSM	HGSSEDYLHMVHR	2008	sp|Q6KC79-3|NIPBL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8393	23.099	4	1566.6998	1566.6998	R	L	241	254
PSM	HHEEEIVHHKK	2009	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1878	8.3975	2	1421.7164	1421.7164	K	E	73	84
PSM	HSDGNLCVK	2010	sp|P49458-2|SRP09_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=3438	11.427	2	1028.4709	1028.4709	R	V	33	42
PSM	IADFGWSVHAPSSR	2011	sp|O14965|AURKA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14499	35.708	3	1528.7423	1528.7423	K	R	272	286
PSM	IAGQVAAANKK	2012	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2647	9.8763	2	1069.6244	1069.6244	R	H	134	145
PSM	IAIYELLFK	2013	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=25688	57.009	2	1108.6532	1108.6532	R	E	9	18
PSM	IANPVEGSTDR	2014	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6878	19.329	2	1157.5677	1157.5677	K	Q	289	300
PSM	IGGIGTVPVGR	2015	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10703	28.048	2	1024.6029	1024.6029	K	V	256	267
PSM	IISNASCTTNCLAPLAK	2016	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=12484	31.399	2	1832.9125	1832.9125	K	V	146	163
PSM	ILLAELEQLK	2017	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20877	47.871	2	1168.7067	1168.7067	K	G	130	140
PSM	ILTFDQLALDSPK	2018	sp|Q07020-2|RL18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20824	47.78	2	1459.7922	1459.7922	K	G	91	104
PSM	INFDKYHPGYFGK	2019	sp|P46776|RL27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12149	30.821	3	1584.7725	1584.7725	R	V	43	56
PSM	KAHLGTALK	2020	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2786	10.126	2	937.5709	937.5709	K	A	29	38
PSM	KGHAVGDIPGVR	2021	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5907	17.002	3	1204.6677	1204.6677	R	F	108	120
PSM	KGLFPFTHVK	2022	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10906	28.584	3	1172.6706	1172.6706	R	I	283	293
PSM	KHPDSSVNFAEFSK	2023	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9624	25.903	4	1591.7631	1591.7631	K	K	30	44
PSM	KLGEMWNNLNDSEK	2024	sp|O15347|HMGB3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12323	31.116	3	1676.7828	1676.7828	K	Q	126	140
PSM	KLNVTEQEK	2025	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3636	11.797	2	1087.5873	1087.5873	K	I	81	90
PSM	KMAFPSGK	2026	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35	ms_run[2]:scan=3357	11.287	2	880.44767	880.4477	R	V	3268	3276
PSM	KMAFPSGK	2027	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35	ms_run[2]:scan=3699	11.922	2	880.44767	880.4477	R	V	3268	3276
PSM	KPLPDHVSIVEPK	2028	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8484	23.266	3	1457.8242	1457.8242	K	D	202	215
PSM	KSNHNFLVQAGNVQLR	2029	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=26985	59.466	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	2030	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=29115	63.114	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KYEDICPSTHNMDVPNIK	2031	sp|P63241|IF5A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:4	ms_run[2]:scan=11214	29.136	3	2159.998	2159.9980	K	R	68	86
PSM	LAPDYDALDVANK	2032	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13908	34.643	2	1403.6933	1403.6933	R	I	140	153
PSM	LECVEPNCR	2033	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6154	17.72	2	1175.5063	1175.5063	R	S	70	79
PSM	LFIGGLNTETNEK	2034	sp|P38159-2|RBMX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14439	35.605	2	1434.7355	1434.7355	K	A	10	23
PSM	LFIGGLSFETTDDSLREHFEK	2035	sp|P51991-2|ROA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21094	48.253	4	2440.1911	2440.1911	K	W	15	36
PSM	LFQECCPHSTDR	2036	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=6425	18.291	3	1548.6449	1548.6449	K	V	156	168
PSM	LHISPSNMTNQNTNEYLEK	2037	sp|Q13547|HDAC1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11992	30.554	3	2232.0481	2232.0481	K	I	343	362
PSM	LKQENPNMR	2038	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3285	11.168	2	1128.571	1128.5710	R	L	184	193
PSM	LKVDTANPK	2039	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3729	12.003	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2040	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3735	12.017	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2041	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9762	26.185	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2042	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5287	15.658	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVPEWVDTVK	2043	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15336	37.2	3	1312.7391	1312.7391	K	L	28	39
PSM	LLSGSESSSK	2044	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3720	11.984	2	993.49785	993.4979	K	K	80	90
PSM	LLVATSVAAR	2045	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9928	26.5	2	999.60768	999.6077	K	G	672	682
PSM	LMIEMDGTENK	2046	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12083	30.712	2	1279.5788	1279.5788	K	S	93	104
PSM	LNNLVLFDK	2047	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16741	39.805	2	1074.6073	1074.6073	K	A	44	53
PSM	LPAAGVGDMVMATVKK	2048	sp|P62829|RL23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16087	38.581	3	1586.8524	1586.8524	R	G	52	68
PSM	LQDEIQNMKEEMAR	2049	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12307	31.089	3	1733.8077	1733.8077	R	H	365	379
PSM	LQIVEMPLAHK	2050	sp|P50454|SERPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13833	34.509	3	1277.7166	1277.7166	K	L	253	264
PSM	LSQYQEPLHLPGVR	2051	sp|P05165-3|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14387	35.51	3	1635.8733	1635.8733	R	V	417	431
PSM	LVNHFVEEFKR	2052	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10418	27.392	4	1416.7514	1416.7514	R	K	237	248
PSM	LVVPASQCGSLIGK	2053	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4	ms_run[2]:scan=12909	32.222	2	1427.7806	1427.7806	R	G	102	116
PSM	LVVPATQCGSLIGK	2054	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4	ms_run[2]:scan=13438	33.693	2	1441.7963	1441.7963	R	G	102	116
PSM	MDDTLFQLK	2055	sp|Q9HD42|CHM1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=24281	54.498	2	1151.5533	1151.5533	-	F	1	10
PSM	MELSAEYLR	2056	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=21815	49.884	2	1152.5485	1152.5485	-	E	1	10
PSM	MGGGSIEVSVPR	2057	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11568	29.791	2	1187.5969	1187.5969	R	F	251	263
PSM	MIKPFFHSLSEK	2058	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11674	29.983	3	1462.7643	1462.7643	K	Y	37	49
PSM	MMNGGHYTYSENRVEK	2059	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35	ms_run[2]:scan=5209	15.516	4	1930.8302	1930.8302	K	D	133	149
PSM	MSQEEVNVFR	2060	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12101	30.741	2	1237.5761	1237.5761	K	L	345	355
PSM	MTHNLLLNYGLYR	2061	sp|Q92769-3|HDAC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17345	40.957	3	1606.829	1606.8290	R	K	8	21
PSM	NAVITVPAYFNDSQR	2062	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17766	41.718	2	1693.8424	1693.8424	K	Q	188	203
PSM	NCIVLIDSTPYR	2063	sp|P62241|RS8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=16064	38.538	2	1449.7286	1449.7286	K	Q	99	111
PSM	NHPGLLLMDTTFR	2064	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17716	41.618	3	1513.7711	1513.7711	R	D	559	572
PSM	NSLESYAFNMK	2065	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:35	ms_run[2]:scan=12772	31.957	2	1318.5864	1318.5864	K	A	540	551
PSM	QAEVANQETK	2066	sp|P05114|HMGN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2761	10.08	2	1116.5411	1116.5411	K	E	62	72
PSM	QKVDSLLENLEK	2067	sp|P07910-4|HNRPC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14729	36.124	2	1414.7668	1414.7668	K	I	149	161
PSM	QNLSQFEAQAR	2068	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10131	26.868	2	1290.6317	1290.6317	R	K	163	174
PSM	QSLPPGLAVK	2069	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11723	30.072	2	1008.5968	1008.5968	K	E	58	68
PSM	REQAEEER	2070	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2036	8.6621	2	1045.4789	1045.4789	K	Y	50	58
PSM	RFDDAVVQSDMK	2071	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9198	24.99	3	1409.6609	1409.6609	R	H	77	89
PSM	RLVQSPNSYFMDVK	2072	sp|P42677|RS27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14061	34.923	3	1682.845	1682.8450	K	C	23	37
PSM	SEETLDEGPPK	2073	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6627	18.744	2	1200.551	1200.5510	K	Y	100	111
PSM	SESPKEPEQLR	2074	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5054	15.216	3	1298.6466	1298.6466	K	K	4	15
PSM	SGQGAFGNMCR	2075	sp|P36578|RL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:4	ms_run[2]:scan=7894	21.78	2	1183.4863	1183.4863	R	G	87	98
PSM	SNHNFLVQAGNVQLR	2076	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13584	33.958	4	1695.8805	1695.8805	K	V	3325	3340
PSM	SNHNFLVQAGNVQLR	2077	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7549	20.699	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SPDNPMNQR	2078	sp|Q96CT7|CC124_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5324	15.724	2	1057.4611	1057.4611	R	A	207	216
PSM	SQLEEKENK	2079	sp|P04080|CYTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2282	9.0781	2	1103.5459	1103.5459	R	K	25	34
PSM	SREDAGDNDDTEGAIGVR	2080	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6782	19.062	3	1875.8195	1875.8195	R	N	375	393
PSM	SSSGLLEWESK	2081	sp|P14866-2|HNRPL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14635	35.959	2	1221.5877	1221.5877	R	S	409	420
PSM	STESLQANVQR	2082	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6389	18.216	2	1231.6157	1231.6157	K	L	106	117
PSM	STNPGISIGDVAK	2083	sp|O15347|HMGB3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11450	29.582	2	1257.6565	1257.6565	K	K	113	126
PSM	TAFQEALDAAGDK	2084	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14895	36.418	2	1335.6307	1335.6307	K	L	9	22
PSM	TAVCDIPPR	2085	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=6912	19.437	2	1027.5121	1027.5121	K	G	351	360
PSM	TGAEHLWLTR	2086	sp|Q9UI43|MRM2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11060	28.859	3	1182.6146	1182.6146	R	H	28	38
PSM	TGSQGQCTQVR	2087	sp|P62857|RS28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=2764	10.086	2	1220.5568	1220.5568	R	V	21	32
PSM	TIAQDYGVLK	2088	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12194	30.895	2	1106.5972	1106.5972	R	A	111	121
PSM	TKAEEPSDLIGPEAPK	2089	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9953	26.546	3	1680.857	1680.8570	R	T	282	298
PSM	TLGDFAAEYAK	2090	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14802	36.26	2	1184.5714	1184.5714	K	S	109	120
PSM	TVGVEPAADGK	2091	sp|P46779|RL28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5067	15.246	2	1042.5295	1042.5295	K	G	48	59
PSM	TYHYHCALHDK	2092	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:4	ms_run[2]:scan=3710	11.961	4	1443.6354	1443.6354	R	A	102	113
PSM	VAHEDPMYDIIR	2093	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13663	34.13	3	1457.6973	1457.6973	R	D	135	147
PSM	VDWQENDFSK	2094	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12125	30.779	2	1266.5517	1266.5517	R	R	267	277
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	2095	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[2]:scan=24882	55.567	3	3242.4869	3242.4869	K	H	3276	3304
PSM	VHIGQVIMSIR	2096	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14940	36.494	3	1251.7122	1251.7122	R	T	129	140
PSM	VIGHSMQNCVLK	2097	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:4	ms_run[2]:scan=7499	20.591	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLK	2098	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:4	ms_run[2]:scan=9630	25.914	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VKDAYLVHLIQR	2099	sp|Q9Y6V7|DDX49_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12826	32.048	4	1453.8405	1453.8405	K	F	230	242
PSM	VLFSSNGGVVK	2100	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10953	28.667	2	1105.6132	1105.6132	K	G	472	483
PSM	VLSRPNAQELPSMYQR	2101	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11626	29.901	3	1887.9625	1887.9625	R	L	108	124
PSM	VPTANVSVVDLTCR	2102	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=14955	36.519	2	1529.7872	1529.7872	R	L	235	249
PSM	VQVEYKGETK	2103	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4712	14.317	3	1179.6136	1179.6136	K	S	103	113
PSM	VTAEDKGTGNK	2104	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2045	8.678	2	1118.5568	1118.5568	R	N	511	522
PSM	YDGIILPGK	2105	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13081	32.827	2	974.54368	974.5437	K	-	170	179
PSM	YHTINGHNAEVR	2106	sp|P22626|ROA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3875	12.468	3	1409.68	1409.6800	K	K	174	186
PSM	YKAEDEVQR	2107	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3911	12.579	3	1136.5462	1136.5462	K	E	525	534
PSM	YLYLTPQDYK	2108	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15393	37.304	2	1302.6496	1302.6496	R	R	1750	1760
PSM	YNCEPLTQDHVDILGPLSAQTGIAVLDMCASLK	2109	cov|corona01611|ORF1a_Bulgaria/24/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=31270	67.765	3	3628.7575	3628.7575	K	E	3500	3533
PSM	SLVQANPEVAMDSIIHMTQHISPTQR	2110	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23911	53.752835	4	2902.442979	2902.442947	R	A	2306	2332
PSM	KIAPYVAHNFSK	2111	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6933	19.482081	3	1373.746524	1373.745571	K	L	589	601
PSM	KSNHNFLVQAGNVQLR	2112	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11711	30.052102	4	1824.962680	1823.975464	R	V	3324	3340
PSM	LKVDTANPK	2113	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5009	15.104962	3	985.564804	984.560395	K	T	3352	3361
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2114	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26418	58.309172	3	3591.723324	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	2115	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21883	50.014524	3	2907.3292	2906.3142	R	P	3369	3395
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2116	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26793	59.123081	4	3590.710238	3590.710866	R	G	3369	3401
PSM	GSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	2117	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=31341	68.00012	5	5748.4577	5748.4572	K	Q	3401	3452
PSM	FTTTLNDFNLVAMK	2118	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18351	42.952909	2	1614.805027	1613.812330	R	Y	3486	3500
PSM	ELLQNGMNGR	2119	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:27	ms_run[1]:scan=7983	21.991617	2	1112.5417	1112.5392	K	T	3533	3543
PSM	ELLQNGMNGR	2120	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:27	ms_run[1]:scan=13190	33.150433	2	1112.5403	1112.5392	K	T	3533	3543
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	2121	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=31345	68.010579	3	3635.802389	3633.769486	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	2122	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=31230	67.664533	3	3634.7952	3633.7692	K	E	3500	3533
PSM	PVICTSEDMHNPNYEDLLIR	2123	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18269	42.774459	3	2431.123751	2431.114796	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	2124	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18683	43.542064	3	2433.129823	2431.114796	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	2125	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4	ms_run[1]:scan=20314	46.635435	2	2416.126072	2415.119881	R	K	3304	3324
PSM	VEGCMVQVTCGTTTLNGLWLDDAVYCPR	2126	cov|corona11687|ORF1a_USA/OR-PROV-075/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=26336	58.159815	3	3216.477509	3214.455562	K	H	3276	3304
PSM	YNYEPLTQDHVDTLGPLSAQTGIAVLDMCASLK	2127	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	29-UNIMOD:4	ms_run[1]:scan=28015	61.230041	3	3621.767149	3619.753836	K	E	3500	3533
PSM	SNHNFLVQAGNVQFR	2128	cov|corona04688|ORF1a_India/GBRC25/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=14119	35.024971	3	1729.867382	1729.864851	K	V	3325	3340
PSM	DAGVIAGLNVLR	2129	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19572	45.220143	2	1196.688522	1196.687721	K	I	160	172
PSM	DAGVIAGLNVLR	2130	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=19829	45.676672	2	1196.688522	1196.687721	K	I	160	172
PSM	ETGVDLTKDNMALQR	2131	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11109	28.940354	3	1689.835224	1689.835584	R	V	293	308
PSM	HPDASVNFSEFSK	2132	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11958	30.491433	3	1463.668481	1463.668108	K	K	31	44
PSM	KAIIIFVPVPQLK	2133	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=20371	46.822824	3	1465.948137	1464.943208	R	S	58	71
PSM	DNYVPEVSALDQEIIEVDPDTKEMLK	2134	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=25246	56.223876	3	2990.450703	2989.447800	R	L	82	108
PSM	ATENDIYNFFSPLNPVR	2135	sp|P31943|HNRH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=25644	56.925801	3	1995.969293	1995.969041	R	V	300	317
PSM	NDLAVVDVR	2136	sp|P19338|NUCL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11081	28.894992	2	999.536903	999.534909	K	I	334	343
PSM	LPAAGVGDMVMATVK	2137	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:35	ms_run[1]:scan=14129	35.045788	2	1474.754807	1474.752372	R	K	52	67
PSM	ADQGEKENPMR	2138	sp|P62913-2|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1	ms_run[1]:scan=6289	17.995648	2	1315.5814	1315.5821	M	E	2	13
PSM	ESTGAQVQVAGDMLPNSTER	2139	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:35	ms_run[1]:scan=10302	27.171573	3	2104.969693	2104.969512	R	A	125	145
PSM	GISLNPEQWSQLKEQISDIDDAVR	2140	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=24894	55.588616	3	2742.367106	2740.366788	K	K	102	126
PSM	DNIQGITKPAIR	2141	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8981	24.402707	2	1325.746519	1324.746299	R	R	25	37
PSM	IIPTLEEYQHYK	2142	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13537	33.873175	3	1533.794264	1532.787495	K	G	104	116
PSM	QAHLCVLASNCDEPMYVK	2143	sp|P25398|RS12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=11593	29.837343	3	2149.960406	2149.959482	R	L	46	64
PSM	ELSDFISYLQR	2144	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23369	52.738174	2	1370.688084	1369.687781	R	E	472	483
PSM	PIKPSPPYFGLLLASVGR	2145	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=24537	54.943712	3	1912.101659	1911.098205	R	L	533	551
PSM	NNQFQALLQYADPVSAQHAK	2146	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21129	48.314703	3	2243.111166	2242.113080	K	L	219	239
PSM	VAIHEAMEQQTISIAK	2147	sp|P33992|MCM5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11434	29.550241	3	1767.919440	1767.918920	R	A	456	472
PSM	NVALLSQLYHSPAR	2148	sp|Q15717|ELAV1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=16127	38.6536	3	1567.850184	1567.847076	K	R	192	206
PSM	NPGFEIIHGLLDR	2149	sp|Q9NSD9|SYFB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21285	48.593943	3	1479.784515	1479.783413	K	I	505	518
PSM	ALIAAQYSGAQVR	2150	sp|P26641|EF1G_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11136	28.988152	2	1347.732996	1346.730649	K	V	18	31
PSM	AQRPTATYCAVTDGIPAASEGK	2151	sp|Q6P087|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	9-UNIMOD:4	ms_run[1]:scan=11201	29.108607	3	2264.095115	2263.090296	R	I	164	186
PSM	DVDETGITVASLER	2152	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=16020	38.455497	2	1504.758087	1503.741667	R	F	341	355
PSM	CTVFHGAQVEDAFR	2153	sp|P49327|FAS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=12744	31.911898	3	1636.752439	1635.746375	K	Y	1828	1842
PSM	AVPAAAMGPSALGQSGPGSMAPWCSVSSGPSR	2154	sp|Q96J01|THOC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:1,24-UNIMOD:4	ms_run[1]:scan=24134	54.238782	3	3070.4062	3069.4102	M	Y	2	34
PSM	IAEEFEVELER	2155	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17184	40.683282	2	1364.661748	1362.666711	K	G	1044	1055
PSM	SKITVTSEVPFSK	2156	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10889	28.55388	3	1424.799481	1421.776596	K	R	68	81
PSM	PVICTSEDMHNPNYEDLLIR	2157	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=26824	59.182593	3	2434.127350	2431.114796	R	K	3304	3324
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2158	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=21210	48.462206	4	3592.691709	3590.710866	R	G	3369	3401
PSM	IEGCMVQVTCGTTTLNGLWLDDVVYCPR	2159	cov|corona07730|ORF1a_Croatia/8U-S17new/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=27032	59.554417	3	3259.503439	3256.502513	K	H	3276	3304
PSM	IQSGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2160	cov|corona06411|ORF1a_Wales/PHWC-16244B/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=23906	53.742771	3	3581.682490	3580.690130	R	G	3369	3401
PSM	VESCMVQVTCGTTTLNGLWLDDVVYCPR	2161	cov|corona02321|ORF1a_Canada/NB-233/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=24630	55.116336	3	3274.481878	3272.497427	K	H	3276	3304
PSM	AAQDRDQIYR	2162	sp|P62995-3|TRA2B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4603	14.079	3	1234.6054	1234.6054	R	R	152	162
PSM	AAVTPGKK	2163	sp|P19338|NUCL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1857	8.3575	2	770.46504	770.4650	K	A	81	89
PSM	AFLGQVLVR	2164	sp|P29372-4|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16983	40.23	2	1001.6022	1001.6022	R	R	96	105
PSM	AGLQFPVGR	2165	sp|Q7L7L0|H2A3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13398	33.613	2	943.52395	943.5240	R	V	22	31
PSM	AKEAAEQDVEK	2166	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2652	9.8886	3	1216.5935	1216.5935	R	K	199	210
PSM	ANGTSALTAQNGK	2167	sp|Q14978|NOLC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4508	13.871	2	1231.6157	1231.6157	K	A	546	559
PSM	APCAGPSREEELAAVR	2168	sp|Q9BU76-2|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:4	ms_run[2]:scan=8573	23.426	3	1711.8312	1711.8312	R	E	56	72
PSM	AVAQALEVIPR	2169	sp|P49368-2|TCPG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14822	36.294	2	1165.6819	1165.6819	R	T	401	412
PSM	AYVVLGQFLVLK	2170	sp|O75531|BAF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24945	55.682	2	1348.8119	1348.8119	K	K	42	54
PSM	CGFCHVGEEENEAR	2171	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=6858	19.268	3	1692.6621	1692.6621	K	G	211	225
PSM	DEPIHILNVAIK	2172	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17759	41.705	3	1360.7715	1360.7715	R	T	1283	1295
PSM	DESETEKEK	2173	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1984	8.5732	2	1093.4775	1093.4775	R	I	502	511
PSM	DFKPGDLIFAK	2174	sp|O75475-3|PSIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18445	43.115	3	1249.6707	1249.6707	R	M	4	15
PSM	DFTPVCTTELGR	2175	sp|P30041|PRDX6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4	ms_run[2]:scan=13864	34.565	2	1394.65	1394.6500	R	A	42	54
PSM	DFTVASPAEFVTR	2176	sp|O00763-3|ACACB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19434	44.962	2	1438.7092	1438.7092	R	F	39	52
PSM	DGFLHETLLDR	2177	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16144	38.686	3	1314.6568	1314.6568	K	R	237	248
PSM	DGWPAMCIHGDK	2178	sp|Q92841|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=12805	32.015	3	1385.5856	1385.5856	R	S	441	453
PSM	DHMVLLEFVTAAGITLGMDELYK	2179	tr|C5MKY7|C5MKY7_HCMV	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=27630	60.623	3	2565.2859	2565.2859	R	-	217	240
PSM	DKVNCSFYFK	2180	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:4	ms_run[2]:scan=11305	29.314	3	1306.6016	1306.6016	K	I	14	24
PSM	DLQNVNITLR	2181	sp|P35232|PHB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14293	35.332	2	1184.6513	1184.6513	K	I	84	94
PSM	DLQNVNITLR	2182	sp|P35232|PHB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14324	35.397	2	1184.6513	1184.6513	K	I	84	94
PSM	DQDLASCDRDR	2183	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=4237	13.258	2	1349.563	1349.5630	R	S	342	353
PSM	DSYVGDEAQSK	2184	sp|P63261|ACTG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5473	16.025	2	1197.515	1197.5150	K	R	51	62
PSM	DVVICPDASLEDAK	2185	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:4	ms_run[2]:scan=13983	34.785	2	1530.7236	1530.7236	R	K	49	63
PSM	EAAASGLPLMVIIHK	2186	sp|O95881|TXD12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19671	45.39	3	1548.8698	1548.8698	K	S	49	64
PSM	EAIEGTYIDKK	2187	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7229	20.1	2	1265.6503	1265.6503	K	C	49	60
PSM	EALCDPTVASR	2188	sp|Q9BRX2|PELO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=7868	21.715	2	1217.571	1217.5710	K	L	255	266
PSM	EDSVKPGAHLTVK	2189	sp|P51991-2|ROA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5139	15.391	3	1379.7409	1379.7409	R	K	92	105
PSM	EEAENTLQSFR	2190	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11009	28.769	2	1322.6103	1322.6103	R	Q	197	208
PSM	EKPSQGIYMVYCR	2191	sp|Q8IWS0-3|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	12-UNIMOD:4	ms_run[2]:scan=11680	29.992	2	1629.7643	1629.7643	R	K	117	130
PSM	ELLQNGMNGR	2192	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:35	ms_run[2]:scan=7751	21.424	2	1146.5452	1146.5452	K	T	3533	3543
PSM	EQISDIDDAVR	2193	sp|P53999|TCP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10827	28.428	2	1259.5994	1259.5994	K	K	115	126
PSM	EVTTLTADPPDGIK	2194	sp|Q16763|UBE2S_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11602	29.853	2	1455.7457	1455.7457	K	V	19	33
PSM	FAQPGSFEYEYAMR	2195	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17348	40.961	2	1694.7399	1694.7399	R	W	168	182
PSM	FAVGIVIGR	2196	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16718	39.761	2	930.56509	930.5651	R	N	263	272
PSM	FDSPESHVGVAWR	2197	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12260	31.007	3	1485.7001	1485.7001	R	L	197	210
PSM	FEDENFILK	2198	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16182	38.76	2	1153.5655	1153.5655	K	H	83	92
PSM	FIHDQTSPNPK	2199	sp|P53007|TXTP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4371	13.567	3	1282.6306	1282.6306	K	Y	150	161
PSM	FSDSYASVIK	2200	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12453	31.341	2	1115.5499	1115.5499	K	A	310	320
PSM	FTTTLNDFNLVAMK	2201	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	13-UNIMOD:35	ms_run[2]:scan=33284	73.544	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2202	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19493	45.072	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2203	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=26010	57.58	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FVNVVPTFGK	2204	sp|P62861|RS30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16539	39.445	2	1106.6124	1106.6124	R	K	42	52
PSM	GCTATLGNFAK	2205	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=10036	26.692	2	1138.5441	1138.5441	R	A	228	239
PSM	GCYIGQELTAR	2206	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=11676	29.986	2	1266.6027	1266.6027	K	T	258	269
PSM	GEGERPAQNEK	2207	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2129	8.8512	3	1213.5687	1213.5687	K	R	38	49
PSM	GGNFGFGDSR	2208	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9779	26.225	2	1012.4363	1012.4363	R	G	204	214
PSM	GGSISVQVNSIK	2209	sp|Q14978|NOLC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10270	27.115	2	1187.651	1187.6510	R	F	684	696
PSM	GIPHLVTHDAR	2210	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6366	18.172	3	1214.652	1214.6520	K	T	135	146
PSM	GKDSLYAQGR	2211	sp|Q969Q0|RL36L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4234	13.251	2	1093.5516	1093.5516	K	R	29	39
PSM	GPIQSSGPTIQDYLNRPR	2212	sp|Q5BKY9|F133B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14725	36.116	3	1998.0283	1998.0283	R	P	21	39
PSM	GPLATGGIK	2213	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6838	19.208	2	812.4756	812.4756	K	K	51	60
PSM	GSGGFGSTGKN	2214	sp|P33316-2|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3465	11.48	2	967.43592	967.4359	R	-	154	165
PSM	GTHELTNPGIAEVTIRPDR	2215	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11408	29.505	4	2075.076	2075.0760	R	K	247	266
PSM	GVISDILDWK	2216	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24311	54.55	2	1144.6128	1144.6128	K	T	2200	2210
PSM	GWDEALLTMSK	2217	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19927	45.851	2	1249.6013	1249.6013	R	G	174	185
PSM	GYISPYFINTSK	2218	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16744	39.809	2	1388.6976	1388.6976	R	G	222	234
PSM	HHEEEIVHHK	2219	sp|Q9UII2|ATIF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2082	8.7474	2	1293.6214	1293.6214	K	K	73	83
PSM	HIQSNLDFSPVNSASSEENVK	2220	sp|O14757-2|CHK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12107	30.75	3	2301.0873	2301.0873	K	Y	199	220
PSM	HLEPALAFQLELNR	2221	sp|O00763-3|ACACB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19050	44.238	3	1649.8889	1649.8889	R	M	1289	1303
PSM	HLSVNDLPVGR	2222	sp|P30048-2|PRDX3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10619	27.841	3	1205.6517	1205.6517	K	S	179	190
PSM	HLTDAYFK	2223	sp|Q02878|RL6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8653	23.635	2	993.49198	993.4920	K	K	211	219
PSM	HPQLLYESK	2224	sp|P48729-3|KC1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7301	20.246	2	1113.5819	1113.5819	R	L	54	63
PSM	HVVLYPLVAK	2225	sp|O00170|AIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12455	31.344	2	1137.691	1137.6910	K	S	94	104
PSM	IAGQVAAANKK	2226	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2673	9.9249	3	1069.6244	1069.6244	R	H	134	145
PSM	IDVYGFSALWK	2227	sp|Q9UBV8|PEF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24584	55.034	2	1297.6707	1297.6707	R	F	171	182
PSM	IEVEKPFAIAK	2228	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11263	29.233	3	1243.7176	1243.7176	K	E	205	216
PSM	IEYDCELVPR	2229	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:4	ms_run[2]:scan=13301	33.428	2	1292.6071	1292.6071	R	R	301	311
PSM	IGPLGLSPK	2230	sp|P30050|RL12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11983	30.536	2	880.5382	880.5382	K	K	32	41
PSM	IIGAGKPWHK	2231	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5531	16.126	2	1105.6396	1105.6396	K	N	132	142
PSM	IINDNATYCR	2232	sp|O00567|NOP56_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:4	ms_run[2]:scan=6761	19.027	2	1238.5714	1238.5714	K	L	203	213
PSM	INFDKYHPGYFGK	2233	sp|P46776|RL27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12128	30.787	4	1584.7725	1584.7725	R	V	43	56
PSM	INISEGNCPER	2234	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=7258	20.157	2	1287.5877	1287.5877	R	I	47	58
PSM	ITLDNAYMEK	2235	sp|P14618-3|KPYM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12251	30.992	2	1196.5747	1196.5747	K	C	127	137
PSM	KADIDLTK	2236	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4976	14.999	2	902.5073	902.5073	R	R	47	55
PSM	KATGAATPK	2237	sp|P10412|H14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=455	2.2173	2	843.48142	843.4814	K	K	140	149
PSM	KESYSIYVYK	2238	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10321	27.207	3	1278.6496	1278.6496	R	V	35	45
PSM	KLYGDADYLEER	2239	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11063	28.863	3	1470.6991	1470.6991	R	H	466	478
PSM	KMAFPSGK	2240	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:35	ms_run[2]:scan=5618	16.281	2	880.44767	880.4477	R	V	3268	3276
PSM	KMAFPSGK	2241	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5634	16.33	2	864.45276	864.4528	R	V	3268	3276
PSM	KMAFPSGK	2242	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5750	16.684	2	864.45276	864.4528	R	V	3268	3276
PSM	KPNEGADGQWK	2243	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4108	12.99	3	1228.5836	1228.5836	R	K	289	300
PSM	KSNHNFLVQAGNVQLR	2244	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15958	38.335	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KTSATVGPK	2245	sp|P16104|H2AX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2164	8.906	2	887.50763	887.5076	K	A	120	129
PSM	LADHFGGK	2246	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4633	14.145	2	843.4239	843.4239	R	L	206	214
PSM	LATQLTGPVMPVR	2247	sp|P26373|RL13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14416	35.564	2	1381.7752	1381.7752	K	N	146	159
PSM	LCQALAINK	2248	sp|P29372-4|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=8676	23.692	2	1029.5641	1029.5641	K	S	216	225
PSM	LGEWVGLCK	2249	sp|P25398|RS12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=14627	35.945	2	1060.5376	1060.5376	K	I	85	94
PSM	LGHAEQKDEMVPR	2250	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4779	14.47	3	1508.7406	1508.7406	R	L	362	375
PSM	LGNDFHTNKR	2251	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3370	11.309	3	1200.6	1200.6000	R	V	24	34
PSM	LIAPVAEEEATVPNNK	2252	sp|P07195|LDHB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12206	30.916	2	1693.8887	1693.8887	K	I	8	24
PSM	LIDFLECGK	2253	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=17989	42.21	2	1093.5478	1093.5478	R	T	228	237
PSM	LKHYGPGWVSMANAGK	2254	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10044	26.706	4	1714.8613	1714.8613	K	D	130	146
PSM	LKQENPNMR	2255	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3247	11.1	3	1128.571	1128.5710	R	L	184	193
PSM	LKVDTANPK	2256	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4449	13.743	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2257	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4750	14.407	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2258	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5376	15.839	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2259	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10633	27.867	3	984.5604	984.5604	K	T	3352	3361
PSM	LLEQYKEESK	2260	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6256	17.925	3	1265.6503	1265.6503	K	K	646	656
PSM	LSEHATAPTR	2261	sp|P33316-2|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3552	11.652	2	1081.5516	1081.5516	R	G	31	41
PSM	LSNIFVIGK	2262	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16940	40.153	2	989.59097	989.5910	R	G	222	231
PSM	LSSANGHEER	2263	sp|Q14498-3|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2208	8.9712	3	1098.5054	1098.5054	K	S	22	32
PSM	LSSANGHEER	2264	sp|Q14498-3|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2212	8.9759	2	1098.5054	1098.5054	K	S	22	32
PSM	LVHPGVAEVVFVK	2265	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13872	34.577	3	1392.8129	1392.8129	R	K	282	295
PSM	MGQMAMGGAMGINNR	2266	sp|Q15233-2|NONO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12523	31.475	2	1537.6622	1537.6622	R	G	295	310
PSM	MIKPFFHSLSEK	2267	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11741	30.105	2	1462.7643	1462.7643	K	Y	37	49
PSM	MKEIAEAYLGK	2268	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10634	27.868	3	1251.6533	1251.6533	K	T	127	138
PSM	MVEKDQDGGR	2269	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2231	9.0027	3	1133.5135	1133.5135	K	K	112	122
PSM	NAESNAELK	2270	sp|P18621-2|RL17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3744	12.034	2	974.46689	974.4669	K	G	59	68
PSM	NGLTHQLGGLSQGSR	2271	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8670	23.678	3	1523.7805	1523.7805	R	N	54	69
PSM	NLDAQYEMAR	2272	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9625	25.905	2	1209.5448	1209.5448	R	S	354	364
PSM	NLDIERPTYTNLNR	2273	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11810	30.223	2	1717.8747	1717.8747	R	L	216	230
PSM	NLEPEWAAAASEVK	2274	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17360	40.982	2	1513.7413	1513.7413	K	E	192	206
PSM	PGFSIADK	2275	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9222	25.034	2	833.42832	833.4283	R	K	137	145
PSM	PLVALLDGR	2276	sp|P56545-2|CTBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16937	40.148	2	952.57057	952.5706	R	D	574	583
PSM	PVICTSEDMHNPNYEDLLIR	2277	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=20405	46.911	3	2415.1199	2415.1199	R	K	3304	3324
PSM	QGQQQAGGDGKTEQK	2278	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1955	8.5268	3	1558.7336	1558.7336	R	G	205	220
PSM	QLDDLKVELSQLR	2279	sp|P42766|RL35_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17906	42.023	3	1555.857	1555.8570	K	V	20	33
PSM	QLNENKQER	2280	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2191	8.9459	2	1157.5789	1157.5789	R	D	10	19
PSM	QYTSPEEIDAQLQAEK	2281	sp|Q13442|HAP28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14643	35.973	3	1848.8741	1848.8741	R	Q	16	32
PSM	RHDAQQLQQLK	2282	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4619	14.115	3	1363.732	1363.7320	R	H	36	47
PSM	RLIDLHSPSEIVK	2283	sp|P60866|RS20_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11451	29.584	3	1505.8566	1505.8566	K	Q	87	100
PSM	RTGCIGAK	2284	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=2193	8.9483	2	861.44907	861.4491	R	H	147	155
PSM	RVDPVYIHLAER	2285	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10594	27.799	3	1466.7994	1466.7994	R	L	2139	2151
PSM	SFSRPDHLNSHVR	2286	sp|P56270-3|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5151	15.411	3	1550.7702	1550.7702	K	Q	322	335
PSM	SNHNFLVQAGNVQLR	2287	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=32098	70.667	3	1695.8805	1695.8805	K	V	3325	3340
PSM	STAMNESSSGK	2288	sp|Q9BY42|RTF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2503	9.4771	2	1097.4659	1097.4659	K	A	246	257
PSM	STLLLLLTGK	2289	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23541	53.052	2	1057.6747	1057.6747	K	L	627	637
PSM	SVTRPAFLYNPLNK	2290	sp|Q8N6N3-3|CA052_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15767	37.985	3	1618.8831	1618.8831	R	Q	65	79
PSM	TAQEVETYR	2291	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5875	16.949	2	1095.5197	1095.5197	R	R	69	78
PSM	TTSSANNPNLMYQDECDRR	2292	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	16-UNIMOD:4	ms_run[2]:scan=8293	22.905	3	2270.9644	2270.9644	R	L	569	588
PSM	TVEDDLLLQKPFQK	2293	sp|Q70Z53-2|F10C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16117	38.636	3	1672.9036	1672.9036	R	E	27	41
PSM	TVEQTATTTNK	2294	sp|P08579|RU2B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3363	11.296	2	1192.5935	1192.5935	K	K	112	123
PSM	TVLLLADQMISR	2295	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20721	47.574	2	1358.7592	1358.7592	K	I	104	116
PSM	TYHYHCALHDK	2296	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4	ms_run[2]:scan=3653	11.824	3	1443.6354	1443.6354	R	A	102	113
PSM	TYSYLTPDLWK	2297	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20446	47.012	2	1385.6867	1385.6867	K	E	247	258
PSM	VAIHEAMEQQTISIAK	2298	sp|P33992|MCM5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11426	29.538	3	1767.9189	1767.9189	R	A	456	472
PSM	VDDHLMGK	2299	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5426	15.943	2	913.43275	913.4328	R	Q	208	216
PSM	VEVTEFEDIK	2300	sp|Q01105-2|SET_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14655	35.996	2	1207.5972	1207.5972	R	S	110	120
PSM	VGEFSGANK	2301	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4944	14.916	2	907.43995	907.4399	K	E	86	95
PSM	VGMIPVPYVEK	2302	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17207	40.724	2	1230.6682	1230.6682	R	L	170	181
PSM	VHIEIGPDGR	2303	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8442	23.188	2	1091.5724	1091.5724	R	V	317	327
PSM	VIFGLFGK	2304	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20853	47.831	1	879.52182	879.5218	R	T	60	68
PSM	VIGHSMQNCVLK	2305	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:4	ms_run[2]:scan=4834	14.601	3	1384.6955	1384.6955	R	L	3340	3352
PSM	VIGHSMQNCVLKLK	2306	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:4	ms_run[2]:scan=9476	25.587	4	1625.8746	1625.8746	R	V	3340	3354
PSM	VITIMQNPR	2307	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10410	27.375	2	1070.5906	1070.5906	R	Q	67	76
PSM	VKEGMNIVEAMER	2308	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13569	33.931	3	1504.7378	1504.7378	K	F	132	145
PSM	VLPSFWIPSLTPEAK	2309	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=25525	56.711	2	1683.9236	1683.9236	K	A	158	173
PSM	VNGRPLEMIEPR	2310	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11001	28.755	3	1409.7449	1409.7449	K	T	34	46
PSM	VNTLIRPDGEK	2311	sp|P62750|RL23A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6501	18.431	2	1240.6776	1240.6776	K	K	124	135
PSM	VQQAELHTGSLPR	2312	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7738	21.379	3	1434.7579	1434.7579	K	I	826	839
PSM	VVHIMDFQR	2313	sp|P43243|MATR3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11665	29.967	3	1143.5859	1143.5859	R	G	399	408
PSM	YDIDLPNKK	2314	sp|O00244|ATOX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8938	24.301	3	1104.5815	1104.5815	K	V	31	40
PSM	YEKDIAAYR	2315	sp|P26583|HMGB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6832	19.184	2	1127.5611	1127.5611	K	A	155	164
PSM	YLKDVTLQK	2316	sp|P18621-2|RL17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7494	20.581	2	1106.6336	1106.6336	K	Q	9	18
PSM	YLYTLVITDK	2317	sp|P63173|RL38_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18268	42.773	2	1227.6751	1227.6751	R	E	41	51
PSM	HVICTSEDMLNPNYEDLLIR	2318	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=32375	71.720796	3	2433.152551	2431.151182	R	K	3304	3324
PSM	SNHNFLVQAGNVQLR	2319	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=31182	67.524934	3	1696.884039	1695.880501	K	V	3325	3340
PSM	LKVDTANPK	2320	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=5410	15.912423	2	984.560307	984.560395	K	T	3352	3361
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2321	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=24351	54.618702	3	3591.713629	3590.710866	R	G	3369	3401
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2322	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=28272	61.639796	4	3591.728200	3590.710866	R	G	3369	3401
PSM	FTTTLNDFNLVAMK	2323	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:35	ms_run[1]:scan=22784	51.624088	2	1629.810069	1629.807245	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2324	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=28155	61.452594	3	1613.813589	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2325	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:35	ms_run[1]:scan=29124	63.132907	2	1629.809141	1629.807245	R	Y	3486	3500
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	2326	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=30988	66.986117	3	3634.7922	3633.7692	K	E	3500	3533
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	2327	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=26244	58.006333	4	3633.761771	3633.769486	K	E	3500	3533
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	2328	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=30317	65.340893	5	5707.4252	5705.4512	K	Q	3401	3452
PSM	GSFLSGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	2329	cov|corona09643|ORF1a_Morocco/HMIMV-Rabat1429-04/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	8-UNIMOD:4,19-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=27165	59.806328	5	5723.4262	5721.4462	K	Q	3401	3452
PSM	PVICTSEDMHNPNYEDLLIR	2330	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=24203	54.36006	2	2417.121922	2415.119881	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	2331	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=20667	47.459244	4	2417.133565	2415.119881	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	2332	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=20709	47.550362	3	2417.135624	2415.119881	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	2333	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=18578	43.351088	2	2433.131470	2431.114796	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIR	2334	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=20620	47.333187	2	2417.135625	2415.119881	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIRK	2335	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=17896	42.000181	4	2544.225802	2543.214844	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIR	2336	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=20685	47.498413	4	2417.133565	2415.119881	R	K	3304	3324
PSM	PVICTSEDMHNPNYEDLLIRK	2337	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=18208	42.636649	4	2545.231226	2543.214844	R	S	3304	3325
PSM	LAETQEEISAEVAAK	2338	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14136	35.055932	2	1589.805648	1587.799182	R	A	108	123
PSM	KFVADGIFK	2339	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12057	30.66399	3	1023.577198	1023.575317	R	A	10	19
PSM	VQLVVGDGR	2340	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8767	23.923514	2	941.529255	941.529430	R	M	136	145
PSM	VGMIPVPYVEK	2341	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17374	41.007511	2	1230.668840	1230.668231	R	L	170	181
PSM	QADVFPDRDHFGR	2342	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=9312	25.287105	3	1559.730066	1558.727689	R	T	181	194
PSM	AFYGDTLVTGFAR	2343	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19867	45.74719	2	1416.704118	1416.703765	K	I	349	362
PSM	SSSGLLEWESK	2344	sp|P14866|HNRPL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14713	36.095547	2	1221.588426	1221.587733	R	S	542	553
PSM	GPVFAPPYEPLPENVK	2345	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=18363	42.976095	2	1753.911839	1752.908673	K	F	224	240
PSM	TATAVAHCK	2346	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:4	ms_run[1]:scan=2178	8.9260929	2	957.469948	957.470200	K	R	18	27
PSM	VNGRPLEMIEPR	2347	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11015	28.780503	3	1409.743539	1409.744919	K	T	34	46
PSM	YPIEHGIITNWDDMEK	2348	sp|P62736|ACTA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:35	ms_run[1]:scan=14137	35.057427	3	1975.898557	1975.898579	K	I	71	87
PSM	QGGLGPMNIPLVSDPKR	2349	sp|Q06830|PRDX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16970	40.207652	3	1777.952342	1777.950889	K	T	94	111
PSM	QITEEDLEGKTEEEIEMMK	2350	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	18-UNIMOD:35	ms_run[1]:scan=15296	37.130344	3	2297.029941	2297.029060	R	L	87	106
PSM	VGEFSGANK	2351	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4954	14.940953	2	907.440064	907.439946	K	E	86	95
PSM	IEEIKDFLLTAR	2352	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19366	44.832413	3	1447.811475	1446.808230	K	R	5	17
PSM	ITVTSEVPFSK	2353	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13449	33.711874	2	1206.649936	1206.649604	K	R	70	81
PSM	KESSEVYFLATQYHGR	2354	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12413	31.272569	3	1913.929433	1913.927176	R	K	225	241
PSM	VHIGQVIMSIR	2355	sp|Q96L21|RL10L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=15039	36.668152	2	1251.712618	1251.712162	R	T	129	140
PSM	FDSNNVVLIEDNGNPVGTR	2356	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16324	39.05221	3	2059.008487	2058.997047	R	I	100	119
PSM	DFIIQTGDPTGTGR	2357	sp|Q8WUA2|PPIL4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14191	35.151214	2	1476.720570	1476.720872	R	G	48	62
PSM	ANGTTVHVGIHPSK	2358	sp|Q9UNX3|RL26L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4924	14.869328	3	1417.751170	1416.747361	K	V	90	104
PSM	THTTMSGVAHR	2359	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=2623	9.8349636	3	1196.572491	1196.572040	K	A	249	260
PSM	LAALPNVYEVISK	2360	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=21003	48.09199	2	1416.803562	1415.802417	R	S	325	338
PSM	YSGSYNDYLR	2361	sp|Q96PK6|RBM14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11518	29.704015	2	1237.546208	1236.541117	R	A	648	658
PSM	KMAFPSGK	2362	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35	ms_run[1]:scan=5997	17.366869	2	881.453465	880.447674	R	V	3268	3276
PSM	GISHVIVDEIHER	2363	sp|Q08211|DHX9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10782	28.312513	3	1503.784018	1502.784141	R	D	504	517
PSM	HLPDQEQLNSLSQFK	2364	sp|Q9NSV4|DIAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=15011	36.615789	3	1784.887494	1782.890063	K	S	760	775
PSM	DLEAEHVEVEDTTLNR	2365	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12247	30.985962	3	1869.878531	1868.875201	R	C	15	31
PSM	HVICTSEDMLNPNYEDLLIRK	2366	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=16165	38.729345	4	2561.230919	2559.246145	R	S	3304	3325
PSM	VIGHSMQNCVLK	2367	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=7282	20.208976	2	1402.694874	1400.690441	R	L	3340	3352
PSM	FTTTLNDFNLVAMK	2368	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:35	ms_run[1]:scan=22724	51.502376	2	1629.810069	1629.807245	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2369	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	13-UNIMOD:35	ms_run[1]:scan=28167	61.469008	2	1629.807686	1629.807245	R	Y	3486	3500
PSM	KSNHNFLVQAGNVQLR	2370	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11554	29.767267	2	1825.966166	1823.975464	R	V	3324	3340
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRLNFTIK	2371	cov|corona06418|ORF1a_Russia/Krasnodar-80902/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=20702	47.532883	4	3625.736113	3622.737081	R	G	3369	3401
PSM	YNYEPLTQDHVDTLGPLSAQTGIAVLDMCASLK	2372	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=26439	58.351188	3	3638.747692	3635.748751	K	E	3500	3533
PSM	GTYIHALDNGLFTLGAPHKEVDEGPSPPEQFTAVK	2373	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19295	44.709462	5	3734.861167	3734.858041	K	L	67	102
PSM	SNHNFLVQAGNVQLR	2374	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16754	39.827148	2	1695.879981	1695.880501	K	V	3325	3340
PSM	AAAETQSLR	2375	sp|Q13523|PRP4B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:1	ms_run[2]:scan=8690	23.722	2	987.49852	987.4985	M	E	2	11
PSM	AAGVNVEPFWPGLFAK	2376	sp|P05386|RLA1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25474	56.621	2	1701.8879	1701.8879	K	A	34	50
PSM	AALIYTCTVCR	2377	sp|Q9Y5V0|ZN706_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=11790	30.188	2	1326.6424	1326.6424	K	T	35	46
PSM	AALQELLSK	2378	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14516	35.741	2	971.56515	971.5651	R	G	86	95
PSM	ADAGKEGNNPAENGDAK	2379	sp|P05204|HMGN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2519	9.5056	3	1656.734	1656.7340	K	T	60	77
PSM	ADILEDKDGK	2380	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5453	15.99	2	1102.5506	1102.5506	R	S	194	204
PSM	ADTQTYQPYNK	2381	sp|P84090|ERH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6280	17.975	2	1327.6044	1327.6044	R	D	74	85
PSM	AELDNELMEGK	2382	sp|Q13523|PRP4B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11834	30.266	2	1247.5704	1247.5704	K	V	118	129
PSM	AELNEFLTR	2383	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14763	36.184	2	1091.5611	1091.5611	K	E	19	28
PSM	AGEVFIHK	2384	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6127	17.673	2	899.4865	899.4865	K	D	11	19
PSM	AGFAGDDAPR	2385	sp|P63261|ACTG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6342	18.128	2	975.44101	975.4410	K	A	19	29
PSM	AGGAAVVITEPEHTKER	2386	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6331	18.107	3	1763.9166	1763.9166	K	V	78	95
PSM	AITFFTEDDKPLLR	2387	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18654	43.488	3	1664.8774	1664.8774	K	S	512	526
PSM	ALEQLNGFELAGRPMK	2388	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	15-UNIMOD:35	ms_run[2]:scan=14602	35.903	3	1788.9193	1788.9193	K	V	285	301
PSM	AQIHDLVLVGGSTR	2389	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11958	30.491	3	1464.8049	1464.8049	K	I	329	343
PSM	AVLFCLSEDKK	2390	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4	ms_run[2]:scan=12409	31.264	3	1308.6748	1308.6748	K	N	35	46
PSM	CGESGHLAK	2391	sp|P62633-7|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=2280	9.0754	2	957.43381	957.4338	R	D	40	49
PSM	CGFCHVGEEENEAR	2392	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=6850	19.24	3	1692.6621	1692.6621	K	G	211	225
PSM	CMPTFQFFK	2393	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=21201	48.447	2	1204.5409	1204.5409	K	K	73	82
PSM	DANGNSFATR	2394	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5339	15.754	2	1051.4683	1051.4683	K	L	212	222
PSM	DANQVHSTTR	2395	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2261	9.0451	2	1127.5319	1127.5319	K	R	443	453
PSM	DFSAPTLEDHFNK	2396	sp|P55081|MFAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13895	34.621	3	1519.6943	1519.6943	R	T	359	372
PSM	DGEEAGAYDGPR	2397	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7010	19.623	2	1235.5055	1235.5055	R	T	108	120
PSM	DGKEGAEEIDR	2398	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4197	13.174	3	1217.5524	1217.5524	K	H	243	254
PSM	DHPTAATK	2399	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1943	8.5068	2	839.41373	839.4137	K	M	435	443
PSM	DKLNNLVLFDK	2400	sp|P62851|RS25_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15866	38.171	3	1317.7293	1317.7293	R	A	42	53
PSM	DVNAAIATIK	2401	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11980	30.532	2	1014.571	1014.5710	K	T	327	337
PSM	DYLHLPPEIVPATLR	2402	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=22051	50.303	3	1732.9512	1732.9512	R	R	81	96
PSM	EDAANNYAR	2403	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3916	12.589	2	1022.4417	1022.4417	K	G	97	106
PSM	EGNNPAENGDAK	2404	sp|P05204|HMGN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2470	9.4093	2	1214.5164	1214.5164	K	T	65	77
PSM	ELFEFVTDPSITHENMDAYLSK	2405	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23050	52.185	3	2585.1996	2585.1996	R	A	380	402
PSM	ELGLDEGVDSLK	2406	sp|Q8WXX5|DNJC9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14680	36.038	2	1273.6402	1273.6402	K	A	206	218
PSM	ELLQDGMNGR	2407	cov|corona05915|ORF1a_Argentina/Heritas_HG001/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=6639	18.775	2	1147.5292	1147.5292	K	T	3533	3543
PSM	ELLQNGMNGR	2408	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=5598	16.25	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2409	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=5835	16.881	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2410	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=8195	22.675	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2411	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=6045	17.508	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2412	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=7074	19.738	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2413	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=15727	37.911	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2414	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8108	22.437	2	1130.5502	1130.5502	K	T	3533	3543
PSM	ELLQNGMNGR	2415	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8375	23.068	2	1130.5502	1130.5502	K	T	3533	3543
PSM	EMGFTNMTEIQHK	2416	sp|Q9NVP1|DDX18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12270	31.024	3	1564.7014	1564.7014	K	S	196	209
PSM	EPPEQELQR	2417	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6217	17.845	2	1124.5462	1124.5462	R	R	20	29
PSM	ETVAVKPTENNEEEFTSK	2418	sp|O60841|IF2P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8404	23.121	3	2050.9695	2050.9695	R	D	77	95
PSM	FEGKPLLQR	2419	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7555	20.719	3	1086.6186	1086.6186	K	H	44	53
PSM	FFEVILIDPFHK	2420	sp|P61313|RL15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25221	56.18	3	1503.8126	1503.8126	K	A	129	141
PSM	FGEVVDCTLK	2421	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:4	ms_run[2]:scan=11239	29.183	2	1166.5642	1166.5642	K	L	120	130
PSM	FGLESHAHTIQICK	2422	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:4	ms_run[2]:scan=9956	26.55	3	1639.8141	1639.8141	R	L	691	705
PSM	FKDPNAPK	2423	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3648	11.817	2	915.48142	915.4814	K	R	89	97
PSM	FLLHEPIVNK	2424	sp|O00541-2|PESC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11826	30.252	3	1208.6917	1208.6917	R	F	72	82
PSM	FPGQLNADLRK	2425	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9796	26.257	3	1257.683	1257.6830	R	L	242	253
PSM	FPLTTESAMK	2426	sp|P62750|RL23A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12085	30.715	2	1123.5583	1123.5583	K	K	79	89
PSM	FQSFQDHK	2427	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5372	15.831	2	1035.4774	1035.4774	K	L	213	221
PSM	FVIGGPQGDAGLTGR	2428	sp|P31153-2|METK2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14082	34.961	2	1443.747	1443.7470	R	K	187	202
PSM	GAVAEDGDELRTEPEAK	2429	sp|P27695|APEX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7296	20.236	3	1785.8381	1785.8381	K	K	8	25
PSM	GCWDSIHVVEVQEK	2430	sp|P47756-2|CAPZB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=13966	34.755	3	1684.7879	1684.7879	K	S	146	160
PSM	GEADRDTYR	2431	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3075	10.712	2	1081.4789	1081.4789	R	R	120	129
PSM	GGAYYPVTVK	2432	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9924	26.491	2	1053.5495	1053.5495	K	K	142	152
PSM	GGGHVAQIYAIR	2433	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8832	24.05	3	1240.6677	1240.6677	K	Q	74	86
PSM	GIPHLVTHDAR	2434	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6348	18.139	4	1214.652	1214.6520	K	T	135	146
PSM	GLQTVHINENFAK	2435	sp|Q13573|SNW1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11169	29.049	3	1469.7627	1469.7627	R	L	274	287
PSM	GPLATGGIKK	2436	sp|Q9Y2S6|TMA7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4558	13.98	2	940.57057	940.5706	K	S	51	61
PSM	GQMQKPFEDASFALR	2437	sp|Q13526|PIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15087	36.753	3	1723.8352	1723.8352	R	T	128	143
PSM	GQVKEEGINK	2438	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2939	10.429	3	1100.5826	1100.5826	K	S	509	519
PSM	GTGASGSFK	2439	sp|P10412|H14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3343	11.264	2	810.38718	810.3872	K	L	98	107
PSM	HGVVPLATYMR	2440	sp|P46778|RL21_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12415	31.276	2	1242.6543	1242.6543	K	I	22	33
PSM	HIANYISGIQTIGHR	2441	sp|Q15393-3|SF3B3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12138	30.801	3	1678.8903	1678.8903	K	V	167	182
PSM	HILLAVANDEELNQLLK	2442	sp|O75367-2|H2AY_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21290	48.601	3	1932.068	1932.0680	R	G	80	97
PSM	HLQDLMEGLTAK	2443	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15294	37.127	3	1354.6915	1354.6915	K	V	576	588
PSM	HLQLAIR	2444	sp|Q7L7L0|H2A3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7965	21.921	2	849.51847	849.5185	R	N	83	90
PSM	HQGVMVGMGQK	2445	sp|P63261|ACTG_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5842	16.893	3	1170.5638	1170.5638	R	D	40	51
PSM	HTGPNSPDTANDGFVR	2446	sp|P31943|HNRH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7046	19.688	2	1683.7601	1683.7601	K	L	99	115
PSM	HWPFMVVNDAGRPK	2447	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:35	ms_run[2]:scan=12087	30.718	3	1668.8195	1668.8195	K	V	89	103
PSM	IAEIEAEMAR	2448	sp|Q9Y295|DRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10934	28.635	2	1131.5594	1131.5594	K	T	8	18
PSM	IAFAITAIK	2449	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17270	40.829	2	946.58515	946.5852	K	G	26	35
PSM	IAVVTADGK	2450	sp|Q96E11-8|RRFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6302	18.029	2	872.49673	872.4967	K	L	67	76
PSM	ICIVGPNGVGK	2451	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=10828	28.429	2	1112.6012	1112.6012	R	S	616	627
PSM	IINDLLQSLR	2452	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19855	45.726	2	1183.6925	1183.6925	R	S	385	395
PSM	IINEVSKPLAHHIPVEK	2453	sp|P55145|MANF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8530	23.345	5	1923.0942	1923.0942	K	I	88	105
PSM	IKSEHPGLSIGDTAK	2454	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6531	18.483	4	1551.8257	1551.8257	K	K	113	128
PSM	IREDPLFIIR	2455	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16803	39.914	3	1270.7398	1270.7398	K	K	134	144
PSM	ITGEAFVQFASQELAEK	2456	sp|P52597|HNRPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=24574	55.012	3	1866.9363	1866.9363	K	A	151	168
PSM	ITITNDQNR	2457	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5611	16.269	2	1073.5465	1073.5465	K	L	524	533
PSM	IVEVLLMK	2458	sp|P38159-2|RBMX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16642	39.628	2	943.57763	943.5776	R	D	34	42
PSM	KDSETGENIR	2459	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2874	10.292	2	1147.5469	1147.5469	R	Q	625	635
PSM	KFVADGIFK	2460	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12103	30.744	3	1023.5753	1023.5753	R	A	10	19
PSM	KGDYLGK	2461	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3361	11.293	2	779.41775	779.4178	R	T	103	110
PSM	KGLTPSQIGVILR	2462	sp|P62277|RS13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14956	36.521	2	1380.8453	1380.8453	K	D	43	56
PSM	KGNYAER	2463	sp|Q99878|H2A1J_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2112	8.802	2	836.41407	836.4141	R	V	37	44
PSM	KITIGQAPTEK	2464	sp|P11586|C1TC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6169	17.746	3	1184.6765	1184.6765	R	G	543	554
PSM	KMAFPSGK	2465	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35	ms_run[2]:scan=3937	12.634	2	880.44767	880.4477	R	V	3268	3276
PSM	KMAFPSGK	2466	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35	ms_run[2]:scan=4243	13.269	2	880.44767	880.4477	R	V	3268	3276
PSM	KMAFPSGK	2467	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35	ms_run[2]:scan=4518	13.898	2	880.44767	880.4477	R	V	3268	3276
PSM	KMAFPSGK	2468	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35	ms_run[2]:scan=4846	14.638	2	880.44767	880.4477	R	V	3268	3276
PSM	KVEQDTETK	2469	sp|Q9NZI8-2|IF2B1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1990	8.5854	2	1076.535	1076.5350	K	I	162	171
PSM	KVHGSLAR	2470	sp|P62861|RS30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1993	8.5889	2	866.50863	866.5086	-	A	1	9
PSM	KVYENYPTYDLTER	2471	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11673	29.982	2	1789.8523	1789.8523	K	K	349	363
PSM	LAQEEESEAKR	2472	sp|O00541-2|PESC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3305	11.199	3	1288.6259	1288.6259	R	L	519	530
PSM	LATQLTGPVMPVR	2473	sp|P26373|RL13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14394	35.523	2	1381.7752	1381.7752	K	N	146	159
PSM	LFIVESNSSSSTR	2474	sp|P48507-2|GSH0_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11219	29.146	2	1425.71	1425.7100	K	S	73	86
PSM	LGELLGHPSFQVK	2475	sp|Q9BVI4|NOC4L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14209	35.181	3	1423.7823	1423.7823	R	E	103	116
PSM	LGNDFHTNK	2476	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4246	13.274	2	1044.4989	1044.4989	R	R	24	33
PSM	LHYCVSCAIHSK	2477	sp|P62854|RS26_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=7194	20.034	3	1473.6857	1473.6857	K	V	71	83
PSM	LISQIVSSITASLR	2478	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26784	59.107	3	1486.8719	1486.8719	R	F	230	244
PSM	LITEDVQGK	2479	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7031	19.659	2	1001.5393	1001.5393	K	N	86	95
PSM	LKHEDTNLASSTIVK	2480	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6867	19.297	3	1654.889	1654.8890	K	E	294	309
PSM	LKVDTANPK	2481	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3941	12.643	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2482	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5332	15.741	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2483	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13960	34.744	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2484	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9454	25.55	3	984.5604	984.5604	K	T	3352	3361
PSM	LLADQAEAR	2485	sp|P84098|RL19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6063	17.553	2	985.51926	985.5193	K	R	154	163
PSM	LLLPGELAK	2486	sp|Q8N257|H2B3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15062	36.708	2	952.59572	952.5957	R	H	101	110
PSM	LLQSQLQVK	2487	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9320	25.301	2	1055.6339	1055.6339	K	K	25	34
PSM	LLYNRPGTVSSLK	2488	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9291	25.239	3	1446.8195	1446.8195	K	K	112	125
PSM	LRECLPLIIFLR	2489	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=24452	54.796	3	1541.9116	1541.9116	K	N	38	50
PSM	LSKEDIER	2490	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4913	14.836	2	988.51892	988.5189	R	M	510	518
PSM	LTPEEEEILNK	2491	sp|P62241|RS8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12248	30.987	2	1313.6715	1313.6715	K	K	129	140
PSM	LVEQLKEER	2492	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5974	17.268	3	1142.6295	1142.6295	K	E	161	170
PSM	LVILANNCPALR	2493	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=14823	36.296	2	1352.7598	1352.7598	K	K	45	57
PSM	LVILANNCPALRK	2494	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=11483	29.635	3	1480.8548	1480.8548	K	S	45	58
PSM	LYSILQGDSPTK	2495	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13384	33.584	2	1320.6925	1320.6925	K	W	477	489
PSM	MELSAEYLR	2496	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[2]:scan=17342	40.95	2	1168.5434	1168.5434	-	E	1	10
PSM	MFIGGLSWDTTKK	2497	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17501	41.231	3	1482.7541	1482.7541	K	D	99	112
PSM	MIFDVESMKK	2498	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13159	33.073	3	1226.6039	1226.6039	K	A	675	685
PSM	MLDMGFEPQIR	2499	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:35	ms_run[2]:scan=16681	39.697	2	1351.6264	1351.6264	R	K	253	264
PSM	MLSSAYISDHMK	2500	sp|P56270-3|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11744	30.109	2	1381.637	1381.6370	K	V	377	389
PSM	MNVLADALK	2501	sp|P62244|RS15A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15168	36.903	2	973.52665	973.5267	R	S	4	13
PSM	MVEKDQDGGR	2502	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2242	9.0179	2	1133.5135	1133.5135	K	K	112	122
PSM	NAEEFTKK	2503	sp|P68036-2|UB2L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3233	11.079	2	965.48181	965.4818	K	Y	107	115
PSM	NCTIVSPDAGGAK	2504	sp|P60891|PRPS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:4	ms_run[2]:scan=6785	19.069	2	1288.6082	1288.6082	R	R	164	177
PSM	NDLAVVDVR	2505	sp|P19338|NUCL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10988	28.732	2	999.53491	999.5349	K	I	334	343
PSM	NGPLEVAGAAVSAGHGLPAK	2506	sp|O75367-2|H2AY_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14111	35.014	3	1814.9639	1814.9639	K	F	249	269
PSM	NGQDLGVAFK	2507	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10776	28.298	2	1047.5349	1047.5349	K	I	405	415
PSM	NIDDGTSDRPYSHALVAGIDR	2508	sp|P61353|RL27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11833	30.264	4	2271.088	2271.0880	K	Y	28	49
PSM	NILFVITKPDVYK	2509	sp|Q13765|NACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18391	43.023	3	1548.8916	1548.8916	K	S	101	114
PSM	NVALLSQLYHSPAR	2510	sp|Q15717|ELAV1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16053	38.52	3	1567.8471	1567.8471	K	R	192	206
PSM	PGLVDSNPAPPESQEK	2511	sp|Q14061|COX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8546	23.373	3	1663.8053	1663.8053	M	K	2	18
PSM	QINWTVLYR	2512	sp|P83731|RL24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19545	45.171	2	1191.64	1191.6400	R	R	48	57
PSM	QINWTVLYR	2513	sp|P83731|RL24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19642	45.341	2	1191.64	1191.6400	R	R	48	57
PSM	QTLMWSATWPK	2514	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19906	45.814	2	1347.6645	1347.6645	R	E	274	285
PSM	QVAPEKPVK	2515	sp|P53999|TCP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3049	10.665	2	994.58113	994.5811	K	K	30	39
PSM	QYEMGECTR	2516	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:4	ms_run[2]:scan=6307	18.041	2	1172.459	1172.4590	R	G	157	166
PSM	RINEEEEK	2517	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2270	9.0634	2	1045.504	1045.5040	K	K	69	77
PSM	SEHPGLSIGDTAK	2518	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7238	20.116	3	1310.6466	1310.6466	K	K	115	128
PSM	SFSRPDHLNSHVR	2519	sp|P56270-3|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5122	15.361	4	1550.7702	1550.7702	K	Q	322	335
PSM	SGKYDLDFK	2520	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9533	25.705	3	1071.5237	1071.5237	R	S	254	263
PSM	SGVNSELVKR	2521	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5170	15.447	2	1087.5986	1087.5986	R	I	169	179
PSM	SGVSLAALK	2522	sp|P10412|H14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11230	29.167	2	844.50182	844.5018	R	K	55	64
PSM	SGVSLAALKK	2523	sp|P10412|H14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7968	21.928	3	972.59678	972.5968	R	A	55	65
PSM	SICEVLDLER	2524	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4	ms_run[2]:scan=17374	41.008	2	1232.6071	1232.6071	K	S	159	169
PSM	SITNTTVCTK	2525	sp|Q15637-4|SF01_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=5413	15.919	2	1123.5543	1123.5543	R	C	272	282
PSM	SKGQESFK	2526	sp|P06748|NPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2319	9.1589	2	909.4556	909.4556	R	K	222	230
PSM	SLGTADVHFER	2527	sp|Q86V81|THOC4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9404	25.458	3	1230.5993	1230.5993	R	K	145	156
PSM	SNHNFLVQAGNVQLR	2528	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=31388	68.154	3	1695.8805	1695.8805	K	V	3325	3340
PSM	SNLELFKEELK	2529	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14466	35.651	3	1348.7238	1348.7238	K	Q	202	213
PSM	SPENTEGKDGSK	2530	sp|Q15651-2|HMGN3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1967	8.547	3	1247.563	1247.5630	K	V	6	18
PSM	SPILVATAVAAR	2531	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13615	34.015	2	1167.6976	1167.6976	K	G	476	488
PSM	STSSHGTDEMESSSYR	2532	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5253	15.602	2	1759.6955	1759.6955	R	D	180	196
PSM	TAGEEEMIK	2533	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6543	18.505	2	1006.4641	1006.4641	K	I	171	180
PSM	TASVFLLEK	2534	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15286	37.113	2	1006.5699	1006.5699	K	D	78	87
PSM	TATAVAHCK	2535	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=2186	8.94	2	957.4702	957.4702	K	R	18	27
PSM	THINIVVIGHVDSGK	2536	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14905	36.432	3	1587.8733	1587.8733	K	S	6	21
PSM	TICSHVQNMIK	2537	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=6211	17.834	3	1345.6482	1345.6482	R	G	72	83
PSM	TKGTSSFGK	2538	sp|P61927|RL37_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2391	9.2755	2	911.47125	911.4712	M	R	2	11
PSM	TLSDYNIQK	2539	sp|P62987|RL40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8476	23.251	2	1080.5451	1080.5451	R	E	55	64
PSM	TNEGVIEFR	2540	sp|Q13247-3|SRSF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11439	29.561	2	1063.5298	1063.5298	R	S	146	155
PSM	VADNSFDAKR	2541	sp|Q14978|NOLC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4365	13.556	2	1121.5465	1121.5465	R	G	639	649
PSM	VDTANPKTPK	2542	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2737	10.033	2	1069.5768	1069.5768	K	Y	3354	3364
PSM	VGGTSDVEVNEK	2543	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5535	16.132	2	1232.5885	1232.5885	K	K	406	418
PSM	VIGHSMQNCVLK	2544	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=5588	16.234	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLK	2545	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=7203	20.05	2	1400.6904	1400.6904	R	L	3340	3352
PSM	VLDCGAAPGAWSQVAVQK	2546	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=14990	36.579	3	1855.9251	1855.9251	R	V	76	94
PSM	VLEGMEVVR	2547	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11520	29.706	2	1030.5481	1030.5481	K	K	172	181
PSM	VLIAAHGNSLR	2548	sp|P15259|PGAM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6708	18.94	3	1149.6618	1149.6618	R	G	181	192
PSM	VLIANNGIAAVK	2549	sp|O00763-3|ACACB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11546	29.753	2	1181.7132	1181.7132	K	C	61	73
PSM	VLNMMPEEK	2550	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10801	28.371	2	1089.5199	1089.5199	K	L	179	188
PSM	VLNTNIDGR	2551	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7385	20.397	2	1000.5302	1000.5302	R	R	15	24
PSM	VLTVINQTQK	2552	sp|P42766|RL35_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8308	22.931	2	1142.6659	1142.6659	R	E	57	67
PSM	VSFELFADK	2553	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18814	43.784	2	1054.5335	1054.5335	R	V	20	29
PSM	VSVIQDFVK	2554	sp|Q9UFW8|CGBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16638	39.622	2	1033.5808	1033.5808	K	M	101	110
PSM	VTTHPLAK	2555	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2987	10.534	2	865.50215	865.5022	K	D	123	131
PSM	VVDALNQGLPR	2556	sp|Q14807-2|KIF22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11515	29.697	2	1180.6564	1180.6564	K	V	239	250
PSM	VVDLMAHMASK	2557	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10910	28.59	3	1200.5995	1200.5995	R	E	324	335
PSM	VVFAELACR	2558	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=14044	34.894	2	1063.5485	1063.5485	R	E	713	722
PSM	WNLDELPKFEK	2559	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18777	43.716	3	1417.7242	1417.7242	K	N	46	57
PSM	YKAEDEVQR	2560	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3912	12.58	2	1136.5462	1136.5462	K	E	525	534
PSM	YMACCLLYR	2561	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=14876	36.386	2	1248.5454	1248.5454	K	G	312	321
PSM	YSEMSEEKR	2562	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3622	11.773	2	1157.5023	1157.5023	K	A	833	842
PSM	YSLIPDEEEEKEEAK	2563	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11120	28.959	3	1807.8364	1807.8364	K	S	131	146
PSM	VLIANNGIAAVK	2564	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11713	30.054788	2	1181.714039	1181.713208	K	C	121	133
PSM	NHPGLLLMDTTFR	2565	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17694	41.579875	3	1513.772620	1513.771133	R	D	559	572
PSM	VEGRPGASLPPLDLQALEK	2566	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18546	43.29148	3	1989.091490	1989.089491	R	E	974	993
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPR	2567	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=24858	55.52586	4	3258.481627	3258.481778	K	H	3276	3304
PSM	HVICTSEDMLNPNYEDLLIR	2568	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=15907	38.243876	4	2448.144533	2447.146097	R	K	3304	3324
PSM	KSNHNFLVQAGNVQLR	2569	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19433	44.960506	3	1823.975691	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	2570	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12691	31.815242	2	1824.974949	1823.975464	R	V	3324	3340
PSM	KSNHNFLVQAGNVQLR	2571	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=28152	61.449056	4	1824.986526	1823.975464	R	V	3324	3340
PSM	LKVDTANPK	2572	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6063	17.553174	2	984.560902	984.560395	K	T	3352	3361
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2573	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=25451	56.576334	3	3592.711072	3590.710866	R	G	3369	3401
PSM	FTTTLNDFNLVAMK	2574	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23927	53.783941	3	1613.813681	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2575	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=28576	62.147935	3	1613.813918	1613.812330	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2576	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:35	ms_run[1]:scan=25949	57.466086	2	1631.818596	1629.807245	R	Y	3486	3500
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	2577	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	29-UNIMOD:4	ms_run[1]:scan=30844	66.598307	3	3617.799093	3617.774571	K	E	3500	3533
PSM	PVICTSEDMHNPNYEDLLIRK	2578	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=15971	38.35879	4	2561.2302	2559.2092	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIRK	2579	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=16165	38.729345	4	2561.2302	2559.2092	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIRK	2580	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4	ms_run[1]:scan=18607	43.404452	4	2545.230992	2543.214844	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIRK	2581	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4	ms_run[1]:scan=18114	42.432713	3	2545.228797	2543.214844	R	S	3304	3325
PSM	PVICTSEDMHNPNYEDLLIRK	2582	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=15784	38.020305	4	2561.2302	2559.2092	R	S	3304	3325
PSM	VEGCMVQVTCGTTTLNGLWLDDAVYCPR	2583	cov|corona11687|ORF1a_USA/OR-PROV-075/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=26400	58.276893	3	3216.477509	3214.455562	K	H	3276	3304
PSM	HVICTSEDMFNPNYEDLLIRK	2584	cov|corona00421|ORF1a_Turkey/HSGM-439/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4	ms_run[1]:scan=14767	36.192413	3	2594.246519	2593.230495	R	S	3304	3325
PSM	VEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICISEDMLNPNYEDLLIR	2585	cov|corona03602|ORF1a_USA/FL-BPHL-0381/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	4-UNIMOD:4,10-UNIMOD:4,26-UNIMOD:4,32-UNIMOD:4,37-UNIMOD:35	ms_run[1]:scan=24238	54.420795	5	5685.6832	5683.6582	K	K	3276	3324
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2586	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21858	49.964991	3	3581.674845	3580.653745	R	G	3369	3401
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2587	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21863	49.975106	3	3583.673957	3580.653745	R	G	3369	3401
PSM	QQVPSGESAILDR	2588	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10684	27.984359	2	1399.712757	1398.710307	K	V	270	283
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	2589	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15344	37.214954	3	3768.880487	3766.872371	R	I	356	395
PSM	WNLDELPKFEK	2590	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18785	43.728408	3	1417.725626	1417.724166	K	N	46	57
PSM	DVNAAIATIK	2591	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11936	30.453558	2	1014.572372	1014.570960	K	T	327	337
PSM	FAVGIVIGR	2592	sp|Q96AE4|FUBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16934	40.14111	2	930.565115	930.565087	R	N	285	294
PSM	YALTGDEVK	2593	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8490	23.276823	2	994.497447	994.497127	K	K	54	63
PSM	LIEGLSHEVIVSAACGR	2594	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:4	ms_run[1]:scan=15225	37.003018	3	1810.944766	1809.940718	R	N	195	212
PSM	GGGGNFGPGPGSNFR	2595	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9884	26.421997	2	1376.629053	1376.622161	R	G	214	229
PSM	SGVSLAALK	2596	sp|P16403|H12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11441	29.563695	2	844.502169	844.501818	R	K	55	64
PSM	VVFAELACR	2597	sp|Q8NE71|ABCF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4	ms_run[1]:scan=14154	35.088734	2	1063.549944	1063.548451	R	E	751	760
PSM	ALVNQLHER	2598	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6521	18.46369	2	1078.588650	1078.588342	K	V	51	60
PSM	GTDIMYTGTLDCWRK	2599	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4	ms_run[1]:scan=15827	38.098573	3	1816.832398	1815.828391	K	I	246	261
PSM	LYSILQGDSPTK	2600	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13571	33.934069	2	1320.694547	1320.692532	K	W	477	489
PSM	DHLVTAYNHLFETK	2601	sp|Q00688|FKBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13820	34.484336	3	1686.839703	1686.836570	K	R	57	71
PSM	LEIEPEWAYGK	2602	sp|Q00688|FKBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17427	41.100093	2	1333.654471	1333.655418	R	K	190	201
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	2603	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4,13-UNIMOD:35,16-UNIMOD:4	ms_run[1]:scan=24605	55.071124	3	3229.4532	3229.4222	R	C	257	285
PSM	GALQNIIPASTGAAK	2604	sp|P04406|G3P_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13909	34.644195	2	1410.783431	1410.783078	R	A	201	216
PSM	YASINTHLGIEQSR	2605	sp|P48730|KC1D_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10540	27.707404	3	1587.803651	1587.800519	R	R	179	193
PSM	GHVFEESQVAGTPMFVVK	2606	sp|P13639|EF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	14-UNIMOD:35	ms_run[1]:scan=13924	34.673799	3	1977.961264	1976.966599	R	A	768	786
PSM	MMCGAPSATQPATAETQHIADQVR	2607	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:1,3-UNIMOD:4	ms_run[1]:scan=16812	39.931139	2	2614.182469	2612.178142	-	S	1	25
PSM	MIKPFFHSLSEK	2608	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11857	30.30643	3	1462.765055	1462.764257	K	Y	37	49
PSM	AVGIWHCGSCMK	2609	sp|P61513|RL37A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=9401	25.454356	3	1405.612570	1404.610082	R	T	51	63
PSM	KADIDLTK	2610	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=4971	14.989077	2	902.508233	902.507297	R	R	47	55
PSM	RADVILSDMAPNATGFR	2611	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16151	38.699233	3	1833.925619	1832.920317	R	D	147	164
PSM	GPLATGGIK	2612	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6992	19.592386	2	812.475940	812.475603	K	K	51	60
PSM	CGHTNNLRPK	2613	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3901	12.54759	3	1178.5607	1178.5610	K	K	115	125
PSM	AAESVSKPDVSEEAPGPSK	2614	sp|Q9BY42|RTF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6759	19.024101	3	1883.911832	1883.911252	K	V	204	223
PSM	VTVEPHPELR	2615	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7260	20.159759	3	1175.629687	1175.629872	K	V	149	159
PSM	TPENFPCK	2616	sp|P00747|PLMN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4	ms_run[1]:scan=6424	18.289494	2	991.443445	991.443317	R	N	310	318
PSM	GSLGSQGAKDEPEEELQK	2617	sp|Q13428|TCOF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7443	20.497695	3	1901.900351	1900.901415	K	G	1406	1424
PSM	SYGRPPPDVEGMTSLK	2618	sp|Q01130|SRSF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=15112	36.79789	2	1774.8557	1774.8555	M	V	2	18
PSM	FQLPGHEAATLR	2619	sp|Q9Y330|ZBT12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11469	29.611389	3	1338.706159	1338.704434	R	N	10	22
PSM	KDDEENYLDLFSHK	2620	sp|Q07666|KHDR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16694	39.716474	3	1751.801198	1751.800245	K	N	139	153
PSM	SGNTGIATTFINK	2621	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12353	31.168545	2	1322.685737	1322.683030	R	A	526	539
PSM	TPAQAAFEK	2622	sp|Q9Y421|FA32A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6460	18.36071	2	961.487444	961.486896	R	M	59	68
PSM	VKDLESLFHR	2623	sp|Q03252|LMNB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12831	32.055026	3	1242.673239	1242.672071	R	S	149	159
PSM	ELLQNGMNGR	2624	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:35	ms_run[1]:scan=10612	27.82843	2	1147.542108	1146.545157	K	T	3533	3543
PSM	IGEGTYGTVFK	2625	sp|Q00535|CDK5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12740	31.905943	2	1170.598681	1170.592090	K	A	10	21
PSM	ITAEEMYDIFGK	2626	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22337	50.819608	2	1416.654392	1415.664268	K	Y	30	42
PSM	QFVTPADVVSGNPK	2627	sp|Q14651|PLSI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13470	33.75101	2	1459.753612	1457.751444	K	L	349	363
PSM	GKVEIDQQQLTQQQLNGN	2628	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11470	29.61292	2	2041.008827	2040.023596	R	-	348	366
PSM	VESCMVQVTCGTTTLNGLWLDDVVYCPR	2629	cov|corona02321|ORF1a_Canada/NB-233/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4,5-UNIMOD:35,10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=23432	52.847202	3	3291.479411	3288.492342	K	H	3276	3304
PSM	HGEVCPAGWKPGSETIIPDPAGK	2630	sp|Q13162|PRDX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4	ms_run[1]:scan=8942	24.308909	4	2405.179506	2402.168880	K	L	241	264
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2631	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=24751	55.337995	3	3590.706738	3590.710866	R	G	3369	3401
PSM	AAPGAEFAPNKR	2632	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6043	17.503	3	1227.636	1227.6360	R	R	368	380
PSM	ADYEIASK	2633	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6282	17.977	2	895.42871	895.4287	R	E	69	77
PSM	AEPVEVVAPR	2634	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8733	23.831	2	1065.5819	1065.5819	K	G	487	497
PSM	AIVAGDQNVEYK	2635	sp|Q13642-5|FHL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8423	23.153	2	1305.6565	1305.6565	K	G	123	135
PSM	ALDPADQHLR	2636	sp|Q7Z7K0|COXM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=10589	27.792	2	1176.5887	1176.5887	M	H	2	12
PSM	ALGFMYIR	2637	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18439	43.106	2	969.51061	969.5106	R	Y	159	167
PSM	AQIEDTLRR	2638	sp|Q96CT7|CC124_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6777	19.056	2	1100.5938	1100.5938	R	D	98	107
PSM	ATVEELKEK	2639	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4589	14.047	3	1045.5655	1045.5655	K	L	225	234
PSM	CKHFELGGDK	2640	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=4667	14.213	3	1189.555	1189.5550	R	K	88	98
PSM	CLGPPTTPGPYR	2641	sp|P29372-4|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=10259	27.095	2	1314.6391	1314.6391	R	S	56	68
PSM	CNEAGDIEAK	2642	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=4708	14.309	2	1105.471	1105.4710	R	S	159	169
PSM	DASTLQSQK	2643	sp|O00479|HMGN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3507	11.56	2	976.48254	976.4825	R	A	74	83
PSM	EAILEYILHQK	2644	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21278	48.58	3	1355.7449	1355.7449	R	K	68	79
PSM	EDTEEHHLR	2645	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2399	9.2891	2	1164.516	1164.5160	K	D	114	123
PSM	EEGGSGGGGGGDEDGSLGSR	2646	sp|O43541-4|SMAD6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10009	26.644	2	1735.6881	1735.6881	R	A	23	43
PSM	EKGTEPPFSGIYLNNK	2647	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14024	34.86	3	1792.8996	1792.8996	R	E	68	84
PSM	EKLEATINELV	2648	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18473	43.162	2	1257.6816	1257.6816	K	-	95	106
PSM	ELGITALHIK	2649	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13598	33.985	2	1093.6495	1093.6495	K	L	87	97
PSM	ELLQDGMNGR	2650	cov|corona05915|ORF1a_Argentina/Heritas_HG001/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9369	25.396	2	1131.5343	1131.5343	K	T	3533	3543
PSM	ELLQNGMNGR	2651	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:35	ms_run[2]:scan=7998	22.049	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2652	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:35	ms_run[2]:scan=15160	36.889	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELLQNGMNGR	2653	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7906	21.808	2	1130.5502	1130.5502	K	T	3533	3543
PSM	ELLQNGMNGR	2654	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9849	26.369	2	1130.5502	1130.5502	K	T	3533	3543
PSM	ENFCNIHVSLVPQPSSTGEQK	2655	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:4	ms_run[2]:scan=15309	37.152	3	2370.1274	2370.1274	R	T	173	194
PSM	EPPEQELQR	2656	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6536	18.49	2	1124.5462	1124.5462	R	R	20	29
PSM	EQQEAIEHIDEVQNEIDRLNEQASEEILK	2657	sp|Q01105-2|SET_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=23722	53.389	4	3448.6594	3448.6594	K	V	27	56
PSM	ESYSIYVYK	2658	sp|Q8N257|H2B3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13008	32.6	2	1150.5546	1150.5546	K	V	36	45
PSM	ESYSVYVYK	2659	sp|Q99880|H2B1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11616	29.884	2	1136.539	1136.5390	K	V	36	45
PSM	EVDEQMLNVQNK	2660	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=7415	20.449	2	1461.677	1461.6770	K	N	325	337
PSM	FKDPNAPK	2661	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3647	11.816	3	915.48142	915.4814	K	R	89	97
PSM	FLYECPWR	2662	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=17177	40.673	2	1169.5328	1169.5328	R	R	618	626
PSM	FQLPGHEAATLR	2663	sp|Q9Y330|ZBT12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11401	29.492	3	1338.7044	1338.7044	R	N	10	22
PSM	FTTTLNDFNLVAMK	2664	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:35	ms_run[2]:scan=24977	55.739	3	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2665	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=28994	62.894	3	1613.8123	1613.8123	R	Y	3486	3500
PSM	FVNVVPTFGKK	2666	sp|P62861|RS30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12874	32.134	3	1234.7074	1234.7074	R	K	42	53
PSM	FYQASTSELYGK	2667	sp|O60547-2|GMDS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11456	29.59	2	1392.6561	1392.6561	K	V	120	132
PSM	FYSVNVDYSK	2668	sp|O00483|NDUA4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12489	31.409	2	1220.5714	1220.5714	K	L	64	74
PSM	GAAPNVVYTYTGK	2669	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11634	29.914	2	1339.6772	1339.6772	K	R	67	80
PSM	GAEIIVCTPGR	2670	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=10281	27.133	2	1171.6019	1171.6019	R	M	495	506
PSM	GFHTTIDIGVK	2671	sp|Q15417-3|CNN3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11669	29.973	3	1186.6346	1186.6346	K	Y	87	98
PSM	GFLKEEDLTEK	2672	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10267	27.108	3	1307.6609	1307.6609	K	K	395	406
PSM	GGDAPAAGEDA	2673	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4377	13.578	2	929.37265	929.3727	K	-	115	126
PSM	GHYTIGK	2674	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3716	11.976	2	774.40244	774.4024	R	E	106	113
PSM	GIVEFSGKPAAR	2675	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8261	22.837	3	1230.6721	1230.6721	K	K	102	114
PSM	GKFEDMAK	2676	sp|P09429|HMGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5160	15.426	2	924.4375	924.4375	K	A	58	66
PSM	GQIGAPMPGK	2677	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7147	19.92	2	954.49569	954.4957	K	V	1110	1120
PSM	GQLGHGDTKR	2678	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1979	8.5666	3	1067.5472	1067.5472	K	V	180	190
PSM	GTGIVSAPVPK	2679	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8751	23.885	2	1024.5917	1024.5917	R	K	201	212
PSM	GYGCSCDQLR	2680	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=6710	18.943	2	1214.4808	1214.4808	K	E	4378	4388
PSM	HDAQQLQQLK	2681	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5583	16.221	3	1207.6309	1207.6309	R	H	37	47
PSM	HFTILDAPGHK	2682	sp|P15170|ERF3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8682	23.704	3	1234.6459	1234.6459	K	S	153	164
PSM	HMYHSLYLK	2683	sp|P84098|RL19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7407	20.437	3	1190.5906	1190.5906	R	V	118	127
PSM	HPDASVNFSEFSK	2684	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11857	30.306	3	1463.6681	1463.6681	K	K	31	44
PSM	HPELADK	2685	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2833	10.209	2	808.40792	808.4079	K	N	32	39
PSM	HPFAQAVGR	2686	sp|O43837|IDH3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5383	15.851	2	981.51445	981.5144	R	N	309	318
PSM	HSDLVTK	2687	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2476	9.4202	2	798.42357	798.4236	R	E	1429	1436
PSM	HWPFMVVNDAGRPK	2688	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13739	34.332	3	1652.8246	1652.8246	K	V	89	103
PSM	IIVGDATEK	2689	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6505	18.436	2	944.51786	944.5179	K	D	277	286
PSM	IKGEHPGLSIGDVAK	2690	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8345	23.006	4	1519.8358	1519.8358	K	K	113	128
PSM	ILIATDVASR	2691	sp|Q9Y6V7|DDX49_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11255	29.219	2	1057.6132	1057.6132	R	G	301	311
PSM	IMLPWDPTGK	2692	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20880	47.878	2	1156.5951	1156.5951	K	I	188	198
PSM	IMNVIGEPIDER	2693	sp|P06576|ATPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14702	36.076	2	1384.7021	1384.7021	R	G	144	156
PSM	IPAMTIAK	2694	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9692	26.019	2	843.48881	843.4888	K	N	474	482
PSM	IPDWFLNR	2695	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20068	46.146	2	1059.5502	1059.5502	K	Q	79	87
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2696	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=26881	59.286	3	3590.7109	3590.7109	R	G	3369	3401
PSM	IVATKPLYVALAQR	2697	sp|P11940-2|PABP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14100	34.993	3	1541.9293	1541.9293	R	K	357	371
PSM	IYVSANSGAR	2698	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5807	16.822	2	1036.5302	1036.5302	R	I	1714	1724
PSM	KASGPPVSELITK	2699	sp|P10412|H14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9663	25.97	3	1325.7555	1325.7555	R	A	34	47
PSM	KDCEVVMMIGLPGAGK	2700	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:4	ms_run[2]:scan=17617	41.441	3	1703.8409	1703.8409	K	T	476	492
PSM	KFGQGSR	2701	sp|P62273|RS29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2199	8.9562	2	778.40859	778.4086	R	S	13	20
PSM	KGQGGAGAGDDEEED	2702	sp|P46781|RS9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2642	9.8692	2	1433.5543	1433.5543	K	-	180	195
PSM	KLEDGPK	2703	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2295	9.0972	2	785.42832	785.4283	K	F	386	393
PSM	KLEDGPK	2704	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2304	9.1118	2	785.42832	785.4283	K	F	386	393
PSM	KMAFPSGK	2705	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5998	17.368	2	864.45276	864.4528	R	V	3268	3276
PSM	KPVSSYLR	2706	sp|Q00059-2|TFAM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6388	18.215	2	948.53927	948.5393	K	F	52	60
PSM	KSLESINSR	2707	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4169	13.113	2	1032.5564	1032.5564	K	L	9	18
PSM	KSNHNFLVQAGNVQLR	2708	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22095	50.378	3	1823.9755	1823.9755	R	V	3324	3340
PSM	KTAEAGGVTGK	2709	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2232	9.0039	3	1017.5455	1017.5455	K	G	87	98
PSM	KYGLNMCR	2710	sp|P62273|RS29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=7093	19.78	3	1040.4896	1040.4896	R	Q	33	41
PSM	LAPGGHVGR	2711	sp|P36578|RL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3273	11.145	2	862.47733	862.4773	K	F	240	249
PSM	LEAMCFDGVK	2712	sp|P47813|IF1AX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=13615	34.015	2	1168.5257	1168.5257	R	R	47	57
PSM	LEEGPPVTTVLTR	2713	sp|P08559-3|ODPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14255	35.259	2	1410.7718	1410.7718	R	E	46	59
PSM	LEGQAQAEAK	2714	sp|O00541-2|PESC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3513	11.572	2	1043.5247	1043.5247	K	A	250	260
PSM	LFEGNALLR	2715	sp|P46781|RS9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14998	36.593	2	1031.5764	1031.5764	R	R	71	80
PSM	LGFITNNSSK	2716	sp|A6NDG6|PGP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9875	26.406	2	1079.5611	1079.5611	R	T	63	73
PSM	LHIFNAK	2717	sp|Q8IWS0-3|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7620	20.937	2	841.48102	841.4810	K	K	227	234
PSM	LIVNVNDLR	2718	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15224	37.002	2	1054.6135	1054.6135	R	R	47	56
PSM	LKQSLPPGLAVK	2719	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9616	25.889	3	1249.7758	1249.7758	K	E	56	68
PSM	LKQSLPPGLAVK	2720	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10020	26.663	2	1249.7758	1249.7758	K	E	56	68
PSM	LKVDTANPK	2721	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4253	13.291	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2722	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7811	21.598	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2723	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8801	23.99	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2724	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13158	33.072	3	984.5604	984.5604	K	T	3352	3361
PSM	LLQAQGVEVPSKDSLPK	2725	sp|O60841|IF2P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11966	30.506	3	1808.0044	1808.0044	K	K	425	442
PSM	LSDQFHDILIR	2726	sp|O75340-2|PDCD6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15080	36.74	3	1355.7197	1355.7197	R	K	124	135
PSM	LSESQLSFR	2727	sp|Q96PK6|RBM14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11818	30.238	2	1065.5455	1065.5455	R	R	617	626
PSM	LSKEEIER	2728	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4413	13.659	2	1002.5346	1002.5346	R	M	510	518
PSM	LSYNTASNK	2729	sp|P49207|RL34_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4862	14.682	2	996.48762	996.4876	R	T	11	20
PSM	LTGVFAPR	2730	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10440	27.46	2	859.49159	859.4916	K	P	23	31
PSM	MAFPSGK	2731	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=10058	26.736	1	752.35271	752.3527	K	V	3269	3276
PSM	MDSTEPPYSQK	2732	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6373	18.185	2	1281.5547	1281.5547	K	R	155	166
PSM	MLSSAYISDHMK	2733	sp|P56270-3|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11714	30.056	3	1381.637	1381.6370	K	V	377	389
PSM	MREESGAR	2734	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2075	8.7342	2	934.42906	934.4291	K	I	39	47
PSM	MVDPEKPQLGMIDR	2735	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12437	31.313	3	1627.8062	1627.8062	K	W	143	157
PSM	MVPAGMGAGLER	2736	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10975	28.71	2	1187.5791	1187.5791	R	M	493	505
PSM	NFAFLEFR	2737	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22193	50.559	2	1042.5236	1042.5236	K	S	196	204
PSM	NMSVHLSPCFR	2738	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:4	ms_run[2]:scan=11959	30.493	2	1346.6224	1346.6224	K	D	108	119
PSM	NPPPNSDPNLR	2739	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5159	15.425	2	1219.5945	1219.5945	R	R	393	404
PSM	NQEDIILFR	2740	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17229	40.76	2	1146.6033	1146.6033	K	D	103	112
PSM	PGREDVGAAGAR	2741	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3425	11.401	3	1154.5792	1154.5792	R	R	5	17
PSM	PLEMIEPR	2742	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11703	30.037	2	983.511	983.5110	R	T	38	46
PSM	PSETPQAEVGPTGCPHR	2743	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	14-UNIMOD:4	ms_run[2]:scan=6195	17.801	3	1818.8319	1818.8319	M	S	2	19
PSM	PSGKPLPK	2744	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2375	9.2472	2	822.49634	822.4963	K	S	188	196
PSM	PVQDLIK	2745	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9309	25.28	2	811.48035	811.4804	K	M	668	675
PSM	PVWGGGNK	2746	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6346	18.136	2	813.41334	813.4133	M	C	2	10
PSM	QCEINYVK	2747	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4	ms_run[2]:scan=7541	20.677	2	1052.4961	1052.4961	K	K	204	212
PSM	QGYENLCCLR	2748	sp|P41223|BUD31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=11691	30.013	2	1311.57	1311.5700	K	C	95	105
PSM	QQYESVAAK	2749	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4695	14.28	2	1022.5033	1022.5033	R	N	274	283
PSM	QSLPPGLAVK	2750	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10605	27.818	2	1008.5968	1008.5968	K	E	58	68
PSM	QSLPPGLAVK	2751	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11022	28.793	2	1008.5968	1008.5968	K	E	58	68
PSM	QSLPPGLAVK	2752	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11366	29.431	2	1008.5968	1008.5968	K	E	58	68
PSM	QTVAVGVIK	2753	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8578	23.436	2	913.55967	913.5597	R	A	431	440
PSM	QVHPDTGISSK	2754	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3721	11.985	3	1167.5884	1167.5884	K	A	48	59
PSM	QVQSLTCEVDALK	2755	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=14806	36.266	2	1489.7446	1489.7446	R	G	322	335
PSM	RFVNVVPTFGK	2756	sp|P62861|RS30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13403	33.624	2	1262.7135	1262.7135	R	K	41	52
PSM	RVLQALEGLK	2757	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11479	29.629	2	1125.687	1125.6870	R	M	102	112
PSM	SEIEYYAMLAK	2758	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18098	42.401	2	1316.6322	1316.6322	K	T	58	69
PSM	SISLYYTGEK	2759	sp|P19338|NUCL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12537	31.511	2	1159.5761	1159.5761	R	G	458	468
PSM	SITNTTVCTK	2760	sp|Q15637-4|SF01_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	8-UNIMOD:4	ms_run[2]:scan=5390	15.863	2	1123.5543	1123.5543	R	C	272	282
PSM	SKTAGEEEMIK	2761	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4928	14.875	3	1221.5911	1221.5911	K	I	169	180
PSM	SLDDDLDGVPLDATEDSKK	2762	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14572	35.85	3	2031.9484	2031.9484	K	N	731	750
PSM	SLESTTLTEK	2763	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7804	21.586	2	1107.5659	1107.5659	K	E	152	162
PSM	SNHNFLVQAGNVQFR	2764	cov|corona08216|ORF1a_India/GBRC131/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13975	34.771	3	1729.8649	1729.8649	K	V	3325	3340
PSM	SQDSMSSDTAR	2765	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3494	11.539	2	1183.4775	1183.4775	R	T	599	610
PSM	STCIYGGAPK	2766	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:4	ms_run[2]:scan=6884	19.345	2	1052.4961	1052.4961	K	G	198	208
PSM	STTTGHLIYK	2767	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5796	16.797	3	1119.5924	1119.5924	K	C	21	31
PSM	SWEEQMIEVGRK	2768	sp|Q00059-2|TFAM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14547	35.803	3	1490.7188	1490.7188	K	D	185	197
PSM	TAIHEVMEQGR	2769	sp|P25205|MCM3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7016	19.634	2	1269.6136	1269.6136	R	V	420	431
PSM	TAVAPIER	2770	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5948	17.157	2	855.48142	855.4814	K	V	24	32
PSM	TFREWDFDLK	2771	sp|Q96EY4|TMA16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17574	41.364	3	1355.651	1355.6510	K	K	142	152
PSM	TGAAPIIDVVR	2772	sp|P46776|RL27A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13506	33.817	2	1110.6397	1110.6397	K	S	95	106
PSM	TGDEEMLKDK	2773	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5232	15.556	3	1164.5333	1164.5333	K	G	53	63
PSM	TGNAWHSK	2774	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2482	9.4352	2	899.42496	899.4250	K	N	622	630
PSM	THKEVTEQLQAK	2775	sp|Q8TAV0-5|FA76A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3650	11.82	3	1410.7467	1410.7467	K	N	190	202
PSM	TSEVNCYR	2776	sp|P62633-7|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4	ms_run[2]:scan=4756	14.419	2	1027.4393	1027.4393	K	C	136	144
PSM	TSTAPAASPNVR	2777	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4710	14.315	2	1170.5993	1170.5993	R	R	19	31
PSM	TTYLVLDEADR	2778	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14343	35.429	2	1294.6405	1294.6405	R	M	242	253
PSM	TVAGGAWTYNTTSAVTVK	2779	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14420	35.57	2	1825.921	1825.9210	K	S	63	81
PSM	VCVIDEIGK	2780	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4	ms_run[2]:scan=12338	31.143	2	1031.5321	1031.5321	R	M	109	118
PSM	VETFSGVYKK	2781	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7482	20.564	3	1156.6128	1156.6128	K	L	170	180
PSM	VGHVTER	2782	sp|Q14498-3|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2165	8.9073	2	796.41915	796.4192	K	T	301	308
PSM	VGIQQGLLSQSTR	2783	sp|Q9BY77-2|PDIP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12423	31.29	2	1385.7627	1385.7627	R	T	34	47
PSM	VHELNEEIGK	2784	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6216	17.844	3	1166.5932	1166.5932	R	L	126	136
PSM	VHIEIGPDGR	2785	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8372	23.061	3	1091.5724	1091.5724	R	V	317	327
PSM	VIAHGKDHPTAATK	2786	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2181	8.9301	3	1444.7787	1444.7787	K	M	429	443
PSM	VVGAVIDQGLITR	2787	sp|E9PRG8|CK098_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15129	36.83	2	1339.7823	1339.7823	R	H	36	49
PSM	WNQDTMEQK	2788	sp|Q15637-4|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6984	19.578	2	1178.5026	1178.5026	R	T	22	31
PSM	YALTGDEVKK	2789	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6336	18.117	2	1122.5921	1122.5921	K	I	54	64
PSM	YLYTLVITDKEK	2790	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15036	36.664	3	1484.8126	1484.8126	R	A	41	53
PSM	YSEMSEEKR	2791	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3628	11.784	3	1157.5023	1157.5023	K	A	833	842
PSM	IGLAEEIR	2792	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11282	29.270208	2	899.508435	899.507632	R	H	1724	1732
PSM	YLYLTPQDYK	2793	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15250	37.048861	2	1302.651517	1302.649604	R	R	1750	1760
PSM	KMAFPSGK	2794	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35	ms_run[1]:scan=5600	16.252372	2	880.445650	880.447674	R	V	3268	3276
PSM	KMAFPSGK	2795	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35	ms_run[1]:scan=4076	12.928971	2	880.447536	880.447674	R	V	3268	3276
PSM	HVICTSEDMLNPNYEDLLIR	2796	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=15834	38.111666	4	2448.144533	2447.146097	R	K	3304	3324
PSM	LKVDTANPK	2797	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4293	13.38232	3	984.559794	984.560395	K	T	3352	3361
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2798	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=26115	57.772165	3	3592.741756	3590.710866	R	G	3369	3401
PSM	FTTTLNDFNLVAMK	2799	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:35	ms_run[1]:scan=23072	52.219744	3	1629.807763	1629.807245	R	Y	3486	3500
PSM	ELLQNGMNGR	2800	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35	ms_run[1]:scan=10085	26.787417	2	1147.548250	1146.545157	K	T	3533	3543
PSM	HWPFMVVNDAGRPK	2801	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13861	34.558012	4	1653.828850	1652.824566	K	V	89	103
PSM	IINEPTAAAIAYGLDR	2802	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=19520	45.123007	3	1686.896218	1686.894085	R	T	172	188
PSM	KFGNPGEK	2803	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=2846	10.232409	2	875.449979	875.450117	K	L	33	41
PSM	TTYLVLDEADR	2804	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14463	35.646111	2	1294.642110	1294.640496	R	M	242	253
PSM	EHALLAYTLGVK	2805	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15010	36.614287	3	1313.734149	1313.734337	R	Q	135	147
PSM	EHALLAYTLGVK	2806	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15052	36.690318	2	1313.734802	1313.734337	R	Q	135	147
PSM	GYGFITFSDSECAKK	2807	sp|Q14498|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4	ms_run[1]:scan=14777	36.209524	2	1709.780114	1708.776673	K	A	292	307
PSM	LGHAEQKDEMVPR	2808	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4863	14.683846	3	1508.740853	1508.740562	R	L	362	375
PSM	CTLCSQPGATIGCEIK	2809	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=12135	30.796547	3	1793.809403	1793.811027	K	A	280	296
PSM	CNEAGDIEAK	2810	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4	ms_run[1]:scan=4738	14.376052	2	1105.471431	1105.470988	R	S	159	169
PSM	KDGFLHETLLDR	2811	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12300	31.078489	3	1442.753188	1442.751778	R	R	236	248
PSM	HKELAPYDENWFYTR	2812	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15379	37.277414	3	1967.917718	1967.916612	K	A	42	57
PSM	TYHEVVDEIYFK	2813	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14819	36.290436	2	1541.741038	1541.740210	K	V	81	93
PSM	NLQLFMENK	2814	sp|Q969P6|TOP1M_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15790	38.029365	2	1136.573615	1135.569580	K	D	386	395
PSM	ALVAYYQK	2815	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9241	25.088208	2	954.518205	954.517468	K	Y	91	99
PSM	GFGYGQGAGALVHAQ	2816	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13313	33.450645	2	1431.690519	1431.689512	K	-	179	194
PSM	CGESGHLAR	2817	sp|P62633|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5288	15.658872	2	968.4120	968.4129	R	E	161	170
PSM	STNPGISIGDVAK	2818	sp|O15347|HMGB3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11626	29.900926	2	1257.657989	1257.656481	K	K	113	126
PSM	LTMQVSSLQR	2819	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11271	29.24731	2	1161.618726	1161.617593	R	E	66	76
PSM	MIAGQVLDINLAAEPK	2820	sp|P07910|HNRPC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20138	46.294871	2	1682.909140	1681.907293	R	V	74	90
PSM	GMKDDDYDDQLC	2821	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4	ms_run[1]:scan=9422	25.492593	2	1474.540867	1473.538810	K	-	398	410
PSM	TNIIPVLEDAR	2822	sp|A6NHQ2|FBLL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16502	39.375314	2	1240.686985	1239.682302	R	H	220	231
PSM	MIKPFFHSLSEK	2823	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11697	30.025896	2	1462.764103	1462.764257	K	Y	37	49
PSM	LKQSLPPGLAVK	2824	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10077	26.773157	2	1249.776735	1249.775808	K	E	56	68
PSM	QSLPPGLAVK	2825	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12045	30.644011	2	1008.597712	1008.596781	K	E	58	68
PSM	LLADQAEAR	2826	sp|P84098|RL19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6149	17.709439	2	985.520423	985.519259	K	R	154	163
PSM	RADVILSDMAPNATGFR	2827	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16035	38.48837	3	1833.925619	1832.920317	R	D	147	164
PSM	HSGNITFDEIVNIAR	2828	sp|P30050|RL12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=19658	45.370653	3	1684.854590	1684.853283	K	Q	100	115
PSM	CQSLTEDLEFRK	2829	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4	ms_run[1]:scan=12511	31.44964	3	1525.728166	1524.724243	R	S	198	210
PSM	GPSYGLSAEVK	2830	sp|Q99439|CNN2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9679	25.995108	2	1106.560487	1106.560789	K	N	9	20
PSM	VHEYNVLLETLSR	2831	sp|P30533|AMRP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=18612	43.412004	3	1572.833568	1571.830757	K	T	183	196
PSM	VGIQQGLLSQSTR	2832	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12355	31.171538	2	1385.764560	1385.762677	R	T	34	47
PSM	STILAVDNFNGIK	2833	sp|Q9Y388|RBMX2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17497	41.222847	2	1390.746526	1390.745630	R	I	89	102
PSM	KPHTLLQR	2834	sp|P49915|GUAA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=3573	11.689417	3	991.5918	991.5922	K	V	478	486
PSM	IADAIENK	2835	sp|Q9NVN8|GNL3L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=5201	15.501667	2	872.460923	872.460347	K	T	470	478
PSM	IIQGQGVDEPLSETGFK	2836	sp|Q9NQ88|TIGAR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14611	35.91553	2	1817.923280	1816.920694	K	Q	21	38
PSM	VSRPENEQLR	2837	sp|Q8ND56|LS14A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4193	13.164796	3	1226.636566	1226.636748	K	N	244	254
PSM	TPAQAAFEK	2838	sp|Q9Y421|FA32A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6328	18.102703	2	961.487444	961.486896	R	M	59	68
PSM	EVTTLTADPPDGIK	2839	sp|Q16763|UBE2S_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11682	29.997803	2	1456.748116	1455.745690	K	V	19	33
PSM	KIEELSK	2840	sp|Q96DC9|OTUB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=3402	11.360513	2	845.4848	845.4853	R	R	31	38
PSM	GSLLSEADVRALGGLACDLPGR	2841	sp|Q13421|MSLN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	17-UNIMOD:4	ms_run[1]:scan=24764	55.360876	3	2226.1302	2226.1422	R	F	174	196
PSM	FEAHPNDLYVEGLPENIPFR	2842	sp|P78347|GTF2I_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20930	47.962249	3	2357.145912	2356.148797	K	S	495	515
PSM	AYAALAALEK	2843	sp|Q12906|ILF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14285	35.317736	2	1019.564869	1019.565147	K	L	578	588
PSM	GHHEMTVLVTDRGSPPR	2844	sp|Q6V1P9|PCD23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	5-UNIMOD:35	ms_run[1]:scan=12799	32.003241	3	1903.9432	1903.9322	R	N	1258	1275
PSM	ITNIIEYLTYEVFTYSVR	2845	sp|Q96JB1|DYH8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=24764	55.360876	3	2224.163751	2223.146337	R	G	3733	3751
PSM	LKEEISK	2846	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=3402	11.360513	2	845.485356	845.485834	K	M	611	618
PSM	KMAFPSGK	2847	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=3421	11.395623	2	865.452476	864.452759	R	V	3268	3276
PSM	THINIVVIGHVDSGK	2848	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14627	35.944692	3	1590.898420	1587.873290	K	S	6	21
PSM	FTTTLNDFNLVAMK	2849	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=26390	58.256581	2	1616.818491	1613.812330	R	Y	3486	3500
PSM	ELLQNGMNGR	2850	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	7-UNIMOD:35	ms_run[1]:scan=12584	31.605058	2	1149.560753	1146.545157	K	T	3533	3543
PSM	IQPGQTFSVLACYNGSPSGVYQCAMR	2851	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=21152	48.357134	3	2908.321968	2906.314970	R	P	3369	3395
PSM	LVNLQHLDLLNNK	2852	sp|Q96AG4|LRC59_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17347	40.959819	3	1532.869615	1532.867477	R	L	84	97
PSM	VIGHSMQNCVLK	2853	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=10091	26.798669	2	1402.694364	1400.690441	R	L	3340	3352
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	2854	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=24016	53.990652	3	3566.682928	3564.658830	R	G	3369	3401
PSM	IQPGQTFSVLACYNGTPSGVYQCAMRPNFTIK	2855	cov|corona11261|ORF1a_Spain/Albacete-COV003777/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=22299	50.754225	3	3622.706686	3620.721431	R	G	3369	3401
PSM	PVICTSEDMHNPNYEDLLIR	2856	cov|corona02208|ORF1a_Taiwan/TSGH-32/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4	ms_run[1]:scan=25880	57.337321	2	2418.137303	2415.119881	R	K	3304	3324
PSM	KSNHNFLVQAGNVQLR	2857	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20268	46.514522	3	1823.977158	1823.975464	R	V	3324	3340
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	2858	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14582	35.867451	3	3769.881039	3766.872371	R	I	356	395
PSM	AAIISAEGDSK	2859	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6350	18.141	2	1060.5401	1060.5401	K	A	209	220
PSM	AASQDHVR	2860	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1843	8.3304	2	882.43078	882.4308	R	G	105	113
PSM	ADEGISFR	2861	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9204	25.001	2	893.4243	893.4243	K	G	121	129
PSM	AEGSEKEESR	2862	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1890	8.4199	2	1120.4996	1120.4996	R	R	272	282
PSM	AGPIWDLR	2863	sp|O43390-3|HNRPR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16592	39.542	2	926.4974	926.4974	K	L	150	158
PSM	AGTHILCIK	2864	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=7643	21.013	3	1011.5535	1011.5535	R	D	733	742
PSM	AHLGTALK	2865	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3874	12.467	2	809.47594	809.4759	K	A	30	38
PSM	ALAAFLKK	2866	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9534	25.706	2	860.54837	860.5484	R	S	17	25
PSM	ALAEFEEK	2867	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8845	24.073	2	935.46001	935.4600	K	M	57	65
PSM	ALEAVFGK	2868	sp|P38159-2|RBMX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11840	30.277	2	833.4647	833.4647	K	Y	23	31
PSM	ALGAEIVR	2869	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8781	23.951	2	827.4865	827.4865	R	T	183	191
PSM	ALVAYYQK	2870	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9199	24.991	2	954.51747	954.5175	K	Y	91	99
PSM	APAMFNIR	2871	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13173	33.109	2	918.47456	918.4746	K	N	35	43
PSM	ARLEIEPEWAYGK	2872	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15182	36.927	3	1560.7936	1560.7936	K	K	188	201
PSM	ATVTPSPVK	2873	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5056	15.219	2	898.51238	898.5124	K	G	176	185
PSM	AVLSAEQLRDEEVHAGLGELLR	2874	sp|P50454|SERPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19842	45.701	4	2404.271	2404.2710	K	S	95	117
PSM	AVTTPGKK	2875	sp|P19338|NUCL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2135	8.8616	2	800.4756	800.4756	K	G	103	111
PSM	AYGELPEHAK	2876	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5856	16.917	3	1113.5455	1113.5455	K	I	105	115
PSM	CAQGCICK	2877	sp|P80297|MT1X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3344	11.266	2	995.39869	995.3987	K	G	44	52
PSM	CPEVFQGVEK	2878	sp|Q9Y330|ZBT12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4	ms_run[2]:scan=10055	26.728	2	1191.5594	1191.5594	K	L	338	348
PSM	DAQPSFSAEDIAK	2879	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12420	31.283	2	1377.6412	1377.6412	K	I	271	284
PSM	DAVTYTEHAK	2880	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4765	14.438	2	1133.5353	1133.5353	R	R	69	79
PSM	DDNMFQIGK	2881	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13716	34.272	2	1066.4753	1066.4753	R	M	60	69
PSM	DGWPAMGIHGDK	2882	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12047	30.647	3	1282.5765	1282.5765	R	S	364	376
PSM	DIGFIKLD	2883	sp|P62273|RS29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20301	46.586	2	919.50148	919.5015	K	-	49	57
PSM	DKECGQLLISENQK	2884	sp|Q8IWS0-3|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=8642	23.608	3	1660.809	1660.8090	R	V	25	39
PSM	DRENYDR	2885	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2500	9.4701	2	966.41552	966.4155	R	G	510	517
PSM	DSLYAQGK	2886	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5419	15.931	2	880.42905	880.4290	K	R	31	39
PSM	EAAGEGPALYEDPPDQK	2887	sp|P27695|APEX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10199	26.988	2	1785.8057	1785.8057	K	T	36	53
PSM	EALLSSAVDHGSDEVK	2888	sp|P78371-2|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10622	27.846	3	1655.8002	1655.8002	R	F	92	108
PSM	EANQAINPK	2889	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3579	11.7	2	983.50361	983.5036	R	L	462	471
PSM	EAPGPAGGGGGGSR	2890	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2795	10.141	2	1125.5163	1125.5163	R	W	14	28
PSM	EDSQRPGAHLTVK	2891	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4379	13.584	2	1436.7372	1436.7372	R	K	93	106
PSM	EINNPMFR	2892	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11350	29.402	2	1019.4859	1019.4859	R	F	453	461
PSM	ELLQNGMNGR	2893	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:35	ms_run[2]:scan=16705	39.736	2	1146.5452	1146.5452	K	T	3533	3543
PSM	ELPIAPSHVIEMSSSR	2894	sp|Q96EV2|RBM33_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14679	36.036	3	1751.8876	1751.8876	R	C	710	726
PSM	ELSPDIAHLASLK	2895	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16152	38.701	3	1392.7613	1392.7613	R	T	193	206
PSM	EMDEEDKAFK	2896	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35	ms_run[2]:scan=4655	14.191	2	1256.5231	1256.5231	K	Q	21	31
PSM	EQGVLSFWR	2897	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20253	46.492	2	1120.5665	1120.5665	K	G	64	73
PSM	ESDLNGAQIK	2898	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6263	17.939	2	1073.5353	1073.5353	K	L	125	135
PSM	ESTLHLVLR	2899	sp|P62987|RL40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11353	29.406	3	1066.6135	1066.6135	K	L	64	73
PSM	EVTPEGLQMVK	2900	sp|P22234|PUR6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12407	31.261	2	1229.6326	1229.6326	K	K	236	247
PSM	FHQLDIDDLQSIR	2901	sp|P16152|CBR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17524	41.27	3	1598.8053	1598.8053	R	A	59	72
PSM	FTTTLNDFNLVAMK	2902	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:35	ms_run[2]:scan=21399	48.898	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FTTTLNDFNLVAMK	2903	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=29954	64.638	2	1613.8123	1613.8123	R	Y	3486	3500
PSM	GAFGKPQGTVAR	2904	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5033	15.169	2	1187.6411	1187.6411	R	V	117	129
PSM	GCEVVVSGK	2905	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=4956	14.948	2	933.45897	933.4590	K	L	133	142
PSM	GFAFVQYVNER	2906	sp|P07910-4|HNRPC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18546	43.291	2	1328.6513	1328.6513	K	N	51	62
PSM	GHVELSEAR	2907	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4282	13.358	2	996.49886	996.4989	R	L	28	37
PSM	GKDSLYAQGK	2908	sp|P83881|RL36A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3727	12.001	3	1065.5455	1065.5455	K	R	29	39
PSM	GKLHIFNAK	2909	sp|Q8IWS0-3|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6123	17.664	3	1026.5974	1026.5974	R	K	225	234
PSM	GPLLYCARPPQDLK	2910	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:4	ms_run[2]:scan=11987	30.544	3	1626.8552	1626.8552	K	I	385	399
PSM	GSAITGPVAK	2911	sp|P62829|RL23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5563	16.184	2	899.50763	899.5076	K	E	114	124
PSM	GSGTNGYVQR	2912	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4113	13.001	2	1037.489	1037.4890	R	N	12	22
PSM	HAIPIIK	2913	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7101	19.798	2	790.50651	790.5065	K	E	193	200
PSM	HCSQVDSVR	2914	sp|Q14247-3|SRC8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=2835	10.212	2	1086.4876	1086.4876	K	G	111	120
PSM	HEQGLSTALSVEK	2915	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8788	23.964	3	1397.7151	1397.7151	K	T	257	270
PSM	HGRPGIGATHSSR	2916	sp|P62841|RS15_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2180	8.9288	2	1331.6807	1331.6807	K	F	128	141
PSM	HLNLEYHSSMIADAVKK	2917	sp|O43837|IDH3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11112	28.945	4	1954.9935	1954.9935	R	V	335	352
PSM	HSSTPNSSEFSR	2918	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4799	14.521	2	1334.5851	1334.5851	K	K	143	155
PSM	HVICTSEDMLNPNYEDLLIRK	2919	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=18138	42.479	2	2559.2461	2559.2461	R	S	3304	3325
PSM	IADAIENK	2920	sp|Q9NVN8|GNL3L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5143	15.397	2	872.46035	872.4603	K	T	470	478
PSM	IFAPNHVVAK	2921	sp|Q02543|RL18A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7217	20.08	3	1094.6237	1094.6237	R	S	32	42
PSM	IGDEDVGR	2922	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4891	14.781	2	859.40356	859.4036	R	V	52	60
PSM	IGIEIIKR	2923	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10521	27.672	3	940.60695	940.6070	K	T	463	471
PSM	IGLAEEIR	2924	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11160	29.033	2	899.50763	899.5076	R	H	1724	1732
PSM	IGSTIFGER	2925	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11617	29.885	2	978.51345	978.5134	R	D	242	251
PSM	IHGVGFK	2926	sp|P62899|RL31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5581	16.218	2	756.42826	756.4283	R	K	33	40
PSM	INEKPQVIADYESGR	2927	sp|O60869-2|EDF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10042	26.704	3	1717.8635	1717.8635	K	A	99	114
PSM	IPASQTSVPFDHLGK	2928	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11818	30.238	3	1595.8308	1595.8308	R	-	402	417
PSM	IQAESGCK	2929	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=2443	9.365	2	891.41202	891.4120	R	I	103	111
PSM	IQPQMDMVEK	2930	sp|Q9HA64|KT3K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9965	26.565	2	1217.5784	1217.5784	R	E	173	183
PSM	ISKEEAMR	2931	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3260	11.124	2	962.48552	962.4855	R	W	157	165
PSM	IVEMSTSK	2932	sp|P63241|IF5A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5053	15.215	2	893.45282	893.4528	K	T	40	48
PSM	IYQYVINK	2933	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10148	26.897	2	1039.5702	1039.5702	K	E	93	101
PSM	KAQCPIVER	2934	sp|P46782|RS5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=4198	13.175	3	1099.5808	1099.5808	R	L	63	72
PSM	KDDEVQVVR	2935	sp|P61254|RL26_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4732	14.365	2	1086.5669	1086.5669	R	G	51	60
PSM	KESSEVYFLATQYHGR	2936	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12381	31.215	3	1913.9272	1913.9272	R	K	225	241
PSM	KGDSSAEELK	2937	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2800	10.15	2	1062.5193	1062.5193	K	L	136	146
PSM	KLPEYNPR	2938	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6151	17.715	3	1015.5451	1015.5451	K	T	513	521
PSM	KMAFPSGK	2939	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35	ms_run[2]:scan=5112	15.341	2	880.44767	880.4477	R	V	3268	3276
PSM	KPNEGADGQWK	2940	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4054	12.869	2	1228.5836	1228.5836	R	K	289	300
PSM	KPVTVHSR	2941	sp|P84098|RL19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1952	8.523	3	922.53485	922.5348	R	A	53	61
PSM	KPVTVHSR	2942	sp|P84098|RL19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1966	8.5455	2	922.53485	922.5348	R	A	53	61
PSM	KSFNDDAMLIEK	2943	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11001	28.755	3	1409.6861	1409.6861	K	F	237	249
PSM	KSNHNFLVQAGNVQLR	2944	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25633	56.903	4	1823.9755	1823.9755	R	V	3324	3340
PSM	KTATAVAHCK	2945	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=1901	8.4396	3	1085.5652	1085.5652	K	R	17	27
PSM	KVGIVGK	2946	sp|P61513|RL37A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3516	11.575	2	699.46431	699.4643	K	Y	7	14
PSM	KVSYSHIQSK	2947	sp|P27816-4|MAP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2947	10.447	3	1175.6299	1175.6299	K	C	718	728
PSM	LAYIAHPK	2948	sp|P47914|RL29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5569	16.195	2	911.52289	911.5229	R	L	96	104
PSM	LCFSTAQHAS	2949	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=8460	23.22	2	1120.4971	1120.4971	K	-	447	457
PSM	LEIEPEWAYGK	2950	sp|Q00688|FKBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17487	41.205	2	1333.6554	1333.6554	R	K	190	201
PSM	LFCVGFTK	2951	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=15031	36.653	2	970.49462	970.4946	R	K	137	145
PSM	LFDFVNAK	2952	sp|Q08945|SSRP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16649	39.638	2	952.50182	952.5018	K	K	414	422
PSM	LHLTPSQAAQLPLHLHLHR	2953	sp|Q6P087-2|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13999	34.815	4	2181.2283	2181.2283	R	L	283	302
PSM	LIEVDDER	2954	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7884	21.753	2	987.48729	987.4873	K	K	15	23
PSM	LIHPDEDISLEER	2955	sp|O43670-3|ZN207_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11630	29.909	3	1564.7733	1564.7733	K	R	280	293
PSM	LIHPDEDISLEER	2956	sp|O43670-3|ZN207_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11684	30	3	1564.7733	1564.7733	K	R	280	293
PSM	LINELNER	2957	sp|Q9Y388|RBMX2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8461	23.222	2	999.53491	999.5349	K	E	9	17
PSM	LKVDTANPK	2958	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6149	17.709	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2959	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6483	18.401	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2960	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5017	15.125	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2961	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11178	29.065	2	984.5604	984.5604	K	T	3352	3361
PSM	LKVDTANPK	2962	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17078	40.41	3	984.5604	984.5604	K	T	3352	3361
PSM	LKVPEWVDTVK	2963	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15379	37.277	2	1312.7391	1312.7391	K	L	28	39
PSM	LLCGLLAER	2964	sp|P14174|MIF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=16308	39.023	2	1043.5798	1043.5798	K	L	79	88
PSM	LLGGLAVR	2965	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12004	30.574	2	797.51232	797.5123	K	R	109	117
PSM	LLQDFFNGR	2966	sp|P0DMV8|HS71A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18228	42.689	2	1108.5665	1108.5665	K	D	349	358
PSM	LMEEIMSEK	2967	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11926	30.437	2	1108.5144	1108.5144	R	E	332	341
PSM	LPELLLK	2968	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16291	38.99	2	824.53714	824.5371	K	N	218	225
PSM	LPLQDVYK	2969	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12112	30.76	2	974.54368	974.5437	R	I	248	256
PSM	LQDEIQNMKEEMAR	2970	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12429	31.298	3	1733.8077	1733.8077	R	H	365	379
PSM	LQGIVLQR	2971	sp|Q86XR2-5|NIBA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12533	31.5	2	925.5709	925.5709	R	S	226	234
PSM	LQWFQNHLDPQK	2972	sp|Q96EY4|TMA16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14174	35.123	3	1552.7787	1552.7787	K	K	55	67
PSM	LSVDYGKK	2973	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5366	15.818	2	908.49673	908.4967	R	S	157	165
PSM	LTDRDIIVLQR	2974	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12548	31.532	3	1340.7776	1340.7776	K	G	268	279
PSM	LTFLVAQK	2975	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13425	33.669	2	918.55385	918.5539	R	D	1327	1335
PSM	LVIPSELGYGER	2976	sp|P26885|FKBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16625	39.597	2	1331.7085	1331.7085	K	G	104	116
PSM	LYDIDVAK	2977	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11406	29.502	2	935.4964	935.4964	K	V	116	124
PSM	MDLGECLK	2978	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:4	ms_run[2]:scan=11283	29.272	2	964.43579	964.4358	R	V	54	62
PSM	MDLGECTK	2979	sp|Q9NQ29-2|LUC7L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:4	ms_run[2]:scan=6791	19.077	2	952.3994	952.3994	R	I	54	62
PSM	MIKPFFHSLSEK	2980	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11653	29.947	4	1462.7643	1462.7643	K	Y	37	49
PSM	MVNHFIAEFK	2981	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12972	32.465	3	1234.6169	1234.6169	R	R	237	247
PSM	NAAALSQALR	2982	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9387	25.429	2	1013.5618	1013.5618	R	L	50	60
PSM	NDQDTWDYTNPNLSGQGDPGSNPNKR	2983	sp|P14866-2|HNRPL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11996	30.56	3	2889.255	2889.2550	K	Q	145	171
PSM	NFAFLEFR	2984	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22077	50.349	2	1042.5236	1042.5236	K	S	196	204
PSM	NKEDFEK	2985	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2733	10.027	2	908.42396	908.4240	K	T	404	411
PSM	NQVDSETHCHAER	2986	sp|Q9NRW3|ABC3C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=2783	10.123	4	1581.659	1581.6590	R	C	57	70
PSM	NSMPASSFQQQK	2987	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:35	ms_run[2]:scan=7318	20.279	2	1367.614	1367.6140	R	L	175	187
PSM	NYYEQWGK	2988	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10813	28.398	2	1086.4771	1086.4771	R	L	39	47
PSM	PGFSIADKK	2989	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6689	18.903	3	961.52328	961.5233	R	R	137	146
PSM	QAELAAQK	2990	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3447	11.447	2	857.46068	857.4607	R	A	181	189
PSM	QAILAAQR	2991	sp|O60869-2|EDF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6196	17.802	2	869.5083	869.5083	K	R	26	34
PSM	QCEINYVKK	2992	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=5346	15.773	3	1180.591	1180.5910	K	F	204	213
PSM	QGGLGPMNIPLVSDPKR	2993	sp|Q06830|PRDX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17009	40.277	3	1777.9509	1777.9509	K	T	94	111
PSM	QGVLTHGR	2994	sp|P62753|RS6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2982	10.524	2	866.47225	866.4722	K	V	65	73
PSM	QLAEDFLR	2995	sp|Q92841|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14400	35.534	2	990.51345	990.5134	R	D	365	373
PSM	QLIVGVNK	2996	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8550	23.382	2	869.53345	869.5335	K	M	147	155
PSM	QLLEELER	2997	sp|Q9NWB6|ARGL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13524	33.849	2	1028.5502	1028.5502	K	Q	171	179
PSM	QLLEELER	2998	sp|Q9NWB6|ARGL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13529	33.859	2	1028.5502	1028.5502	K	Q	171	179
PSM	QLNENKQER	2999	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2185	8.9388	3	1157.5789	1157.5789	R	D	10	19
PSM	QMVIDVLHPGK	3000	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13165	33.09	3	1235.6696	1235.6696	K	A	22	33
PSM	QPTIFQNK	3001	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8056	22.267	2	974.51853	974.5185	K	K	13	21
PSM	QRHDGAFLIR	3002	sp|P62993|GRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7242	20.124	3	1211.6523	1211.6523	K	E	77	87
PSM	QVSDDLTER	3003	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6707	18.938	2	1061.4989	1061.4989	R	A	149	158
PSM	RELHGQNPVVTPCNK	3004	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:4	ms_run[2]:scan=4766	14.439	3	1747.8788	1747.8788	K	Q	147	162
PSM	RLDQLER	3005	sp|Q96CT7|CC124_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5294	15.67	2	928.50903	928.5090	R	K	60	67
PSM	RPDQQLQGEGK	3006	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3522	11.586	3	1254.6317	1254.6317	R	I	112	123
PSM	RYDDPEVQK	3007	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4215	13.217	3	1148.5462	1148.5462	R	D	127	136
PSM	SAINEVVTR	3008	sp|P62899|RL31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7925	21.842	2	987.53491	987.5349	R	E	15	24
PSM	SAQAQMR	3009	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:1	ms_run[2]:scan=5293	15.669	2	832.38614	832.3861	M	A	2	9
PSM	SAWYMGPVSR	3010	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15138	36.846	2	1152.5386	1152.5386	R	Q	12	22
PSM	SDFDEFER	3011	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:1	ms_run[2]:scan=16925	40.126	2	1085.4302	1085.4302	M	Q	2	10
PSM	SFAGAVSPQEEEEFRR	3012	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11504	29.676	3	1837.8595	1837.8595	R	L	309	325
PSM	SFDLLVK	3013	sp|Q9HB71|CYBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15540	37.551	2	820.46945	820.4695	R	N	112	119
PSM	SKDTVSEDTIR	3014	sp|Q96E11-8|RRFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4939	14.906	3	1249.615	1249.6150	K	L	170	181
PSM	SLEEDQEPIVSHQKPGK	3015	sp|Q14241|ELOA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6465	18.37	3	1919.9589	1919.9589	R	G	222	239
PSM	SLQSVAEER	3016	sp|P61313|RL15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7445	20.5	2	1017.5091	1017.5091	R	A	97	106
PSM	SMLALLLGR	3017	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24498	54.877	2	972.57902	972.5790	K	T	164	173
PSM	TAATLATHELR	3018	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7000	19.606	3	1182.6357	1182.6357	R	A	371	382
PSM	TAHNSEAADLEESFNEHELEPSSPK	3019	sp|Q8IWS0-2|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14165	35.105	4	2767.2209	2767.2209	K	S	134	159
PSM	TALIHDGLAR	3020	sp|P25398|RS12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7625	20.947	3	1065.5931	1065.5931	K	G	24	34
PSM	TAVCDIPPR	3021	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=7417	20.452	2	1027.5121	1027.5121	K	G	351	360
PSM	TEIIILATR	3022	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15066	36.714	2	1028.623	1028.6230	R	T	46	55
PSM	TGQPMINLYTDR	3023	sp|P35637-2|FUS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14361	35.461	2	1407.6816	1407.6816	K	E	316	328
PSM	TGTITTFEHAHNMR	3024	sp|P13639|EF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7845	21.67	4	1614.7573	1614.7573	K	V	482	496
PSM	TIAECLADELINAAK	3025	sp|P46782|RS5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:4	ms_run[2]:scan=26304	58.106	2	1630.8236	1630.8236	K	G	168	183
PSM	TILGSALLEDEFTPFDVVR	3026	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=32164	70.932	3	2121.0994	2121.0994	R	Q	3543	3562
PSM	TILGSALLEDEFTPFDVVRR	3027	cov|corona08186|ORF1a_SouthAfrica/KRISP-107/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25532	56.722	3	2277.2005	2277.2005	R	C	3543	3563
PSM	TIVFVETK	3028	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11190	29.087	2	935.53278	935.5328	K	R	344	352
PSM	TLETVPLER	3029	sp|P22626|ROA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10647	27.902	2	1056.5815	1056.5815	K	K	4	13
PSM	TSPSGKPATLK	3030	sp|P27695|APEX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2971	10.493	2	1085.6081	1085.6081	K	I	53	64
PSM	TVLQEIKR	3031	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7487	20.571	3	985.59203	985.5920	K	G	266	274
PSM	TVLQEIKR	3032	sp|Q8IWS0-3|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7490	20.575	2	985.59203	985.5920	K	G	266	274
PSM	TVTAMDVVYALKR	3033	sp|P62805|H4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35	ms_run[2]:scan=15383	37.283	3	1481.7912	1481.7912	K	Q	81	94
PSM	VALLDVFR	3034	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21299	48.614	2	931.5491	931.5491	K	E	749	757
PSM	VCEVCSAYLGLHDNDRR	3035	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=10254	27.087	4	2062.9313	2062.9313	R	L	189	206
PSM	VCIESEHSMDTLLATLKK	3036	sp|O00244|ATOX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=17996	42.222	3	2074.0439	2074.0439	K	T	40	58
PSM	VFLENVIR	3037	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16330	39.063	2	988.57057	988.5706	K	D	61	69
PSM	VFQFLNAK	3038	sp|P83731|RL24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15486	37.461	2	965.53345	965.5335	K	C	28	36
PSM	VGEVIVTKDDAMLLK	3039	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14626	35.943	3	1629.9011	1629.9011	K	G	345	360
PSM	VHILGSFQNIK	3040	sp|Q9NRX1|PNO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12768	31.952	3	1254.7085	1254.7085	K	M	209	220
PSM	VHVGDEDFVHLR	3041	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11146	29.007	4	1421.7052	1421.7052	K	V	57	69
PSM	VIGHSMQNCVLK	3042	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=10524	27.679	3	1400.6904	1400.6904	R	L	3340	3352
PSM	VIGHSMQNCVLKLK	3043	cov|corona00203|ORF1a_Pakistan/Gilgit1/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=8771	23.929	3	1625.8746	1625.8746	R	V	3340	3354
PSM	VIGIDHIK	3044	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7944	21.872	2	893.53345	893.5335	K	E	106	114
PSM	VKDEPQR	3045	sp|O00479|HMGN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2130	8.8524	2	870.45593	870.4559	K	R	17	24
PSM	VLLGETGK	3046	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6911	19.436	2	815.47527	815.4753	R	E	23	31
PSM	VNTLIRPDGEK	3047	sp|P62750|RL23A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6475	18.387	3	1240.6776	1240.6776	K	K	124	135
PSM	VQLVVGDGR	3048	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8803	23.993	2	941.52943	941.5294	R	M	136	145
PSM	VQTAVTMK	3049	sp|Q9HD42|CHM1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5509	16.088	2	876.47389	876.4739	K	G	76	84
PSM	VSLEDLYNGK	3050	sp|O60884|DNJA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15790	38.029	2	1136.5714	1136.5714	K	T	122	132
PSM	VTAEDKGTGNK	3051	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2046	8.6795	3	1118.5568	1118.5568	R	N	511	522
PSM	VTNLLMLK	3052	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15494	37.473	2	930.55722	930.5572	K	G	85	93
PSM	VVEEAPSIFLDAETRR	3053	sp|P05165-3|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16745	39.811	3	1830.9476	1830.9476	K	A	299	315
PSM	WNLDELPK	3054	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17346	40.959	2	1013.5182	1013.5182	K	F	46	54
PSM	WQVVDTPGILDHPLEDR	3055	sp|Q9BZE4-3|NOG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19412	44.917	3	1988.9956	1988.9956	R	N	101	118
PSM	YASINTHLGIEQSR	3056	sp|P49674|KC1E_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10514	27.653	3	1587.8005	1587.8005	R	R	179	193
PSM	YCDPDSYHR	3057	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=5230	15.554	3	1211.4666	1211.4666	K	R	459	468
PSM	YFDPANGK	3058	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7409	20.44	2	910.41848	910.4185	R	F	265	273
PSM	YFIRDEFLR	3059	sp|P63092-3|GNAS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15177	36.919	3	1257.6506	1257.6506	K	I	324	333
PSM	YIFDLFYK	3060	sp|P41223|BUD31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24325	54.571	2	1107.5641	1107.5641	R	R	59	67
PSM	YPDPLIK	3061	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11795	30.198	2	844.46945	844.4695	R	V	149	156
PSM	YVDEASKK	3062	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2273	9.067	2	938.47091	938.4709	K	E	99	107
PSM	DVDDGLQAAEEVGYPVMIK	3063	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=22086	50.361905	3	2048.979280	2047.977223	K	A	293	312
PSM	TIQVENSHLILTGAGALNK	3064	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15221	36.997097	3	1979.089038	1978.084740	R	V	1838	1857
PSM	HVICTSEDMLNPNYEDLLIRK	3065	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=19522	45.126036	3	2575.239483	2575.241060	R	S	3304	3325
PSM	KSNHNFLVQAGNVQLR	3066	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16630	39.607773	4	1826.989738	1823.975464	R	V	3324	3340
PSM	VIGHSMQNCVLK	3067	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:35,9-UNIMOD:4	ms_run[1]:scan=6167	17.74342	2	1400.690361	1400.690441	R	L	3340	3352
PSM	LKVDTANPK	3068	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6224	17.857815	2	984.560902	984.560395	K	T	3352	3361
PSM	LKVDTANPK	3069	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5107	15.331633	2	984.560683	984.560395	K	T	3352	3361
PSM	LKVDTANPK	3070	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4290	13.375259	2	984.559915	984.560395	K	T	3352	3361
PSM	LKVDTANPK	3071	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6563	18.538108	3	984.560352	984.560395	K	T	3352	3361
PSM	LKVDTANPK	3072	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12068	30.685121	2	984.561285	984.560395	K	T	3352	3361
PSM	ELLQNGMNGR	3073	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12451	31.338448	2	1130.551438	1130.550242	K	T	3533	3543
PSM	ELLQNGMNGR	3074	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9092	24.730025	2	1130.556170	1130.550242	K	T	3533	3543
PSM	TILGSALLEDEFTPFDVVR	3075	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=32381	71.742294	3	2122.100251	2121.099387	R	Q	3543	3562
PSM	YNYEPLTQDHVDILGPLSAQTGVAVLDMCASLK	3076	cov|corona05086|ORF1a_mink/Netherlands/NB02_index/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	29-UNIMOD:4	ms_run[1]:scan=29711	64.190122	3	3618.776854	3617.774571	K	E	3500	3533
PSM	ELLQDGMNGR	3077	cov|corona05915|ORF1a_Argentina/Heritas_HG001/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	7-UNIMOD:35	ms_run[1]:scan=7741	21.39099	2	1148.5432	1147.5282	K	T	3533	3543
PSM	ELLQDGMNGR	3078	cov|corona05915|ORF1a_Argentina/Heritas_HG001/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=13915	34.655464	2	1113.5257	1113.5232	K	T	3533	3543
PSM	GSFLNGSCGSVGFNIDYDFVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDR	3079	cov|corona11219|ORF1a_USA/WA-UW-5617/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	8-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35,28-UNIMOD:35	ms_run[1]:scan=31521	68.565333	5	5751.4672	5751.4902	K	Q	3401	3452
PSM	IQPGQTFSVLACYNGSPSGVYQCAMRLNFTIK	3080	cov|corona06418|ORF1a_Russia/Krasnodar-80902/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=19733	45.503008	3	3622.703239	3622.737081	R	G	3369	3401
PSM	TGNAWHSK	3081	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2514	9.4987159	2	899.423788	899.424965	K	N	622	630
PSM	IAPPEAPVTGYMFGK	3082	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:35	ms_run[1]:scan=15074	36.725657	2	1592.790994	1592.790866	R	G	879	894
PSM	HWPFMVVNDAGRPK	3083	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13934	34.694334	3	1652.826054	1652.824566	K	V	89	103
PSM	KFGDPVVQSDMK	3084	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:35	ms_run[1]:scan=6748	19.006316	3	1365.660090	1365.659852	R	H	77	89
PSM	QTVAVGVIK	3085	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8768	23.924693	2	913.559306	913.559667	R	A	431	440
PSM	TIQFVDWCPTGFK	3086	sp|Q71U36|TBA1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=22085	50.360409	2	1597.767267	1597.759900	R	V	340	353
PSM	APLVLKD	3087	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8206	22.701083	2	754.458689	754.458890	K	-	183	190
PSM	VQLVVGDGR	3088	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8860	24.102475	2	941.529255	941.529430	R	M	136	145
PSM	CGFCHVGEEENEAR	3089	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=6832	19.183579	3	1692.663590	1692.662054	K	G	212	226
PSM	TVLQEIKR	3090	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7524	20.646129	3	985.591769	985.592030	K	G	267	275
PSM	DVDDDGEEKELMER	3091	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10086	26.788596	3	1679.699699	1678.699210	K	L	87	101
PSM	GGAGVGSMTK	3092	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4202	13.189944	2	863.416793	863.417102	R	I	68	78
PSM	QMKALVNQLHER	3093	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,2-UNIMOD:35	ms_run[1]:scan=22528	51.144143	2	1464.7622	1464.7502	K	V	48	60
PSM	AAYFGIYDTAK	3094	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15157	36.884388	2	1218.592911	1218.592090	R	G	189	200
PSM	LGEMWSEQSAK	3095	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:35	ms_run[1]:scan=8543	23.369141	2	1280.562751	1280.570703	K	D	129	140
PSM	EINNPMFR	3096	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11481	29.632043	2	1019.485640	1019.485850	R	F	453	461
PSM	PLEMIEPR	3097	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11735	30.092485	2	983.511497	983.511002	R	T	38	46
PSM	EIKDILIQYDR	3098	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15495	37.474042	2	1404.761121	1404.761280	K	T	107	118
PSM	LEEDISSSMTNSTAASRPPVTLR	3099	sp|Q15366|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13512	33.828399	3	2462.217001	2461.211867	K	L	79	102
PSM	MTDQEAIQDLWQWR	3100	sp|P06748|NPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=25276	56.274855	3	1818.836734	1818.835919	R	K	278	292
PSM	EREEIEK	3101	sp|Q13442|HAP28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2460	9.3927437	2	931.460423	931.461075	R	Q	111	118
PSM	ALEAVFGK	3102	sp|P38159|RBMX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11821	30.242003	2	833.465046	833.464704	K	Y	23	31
PSM	DIIGLAETGSGK	3103	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14072	34.94161	2	1160.619483	1159.608468	R	T	63	75
PSM	TAIHEVMEQGR	3104	sp|P25205|MCM3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6945	19.506649	3	1269.613611	1269.613570	R	V	420	431
PSM	LIEVDDER	3105	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7925	21.842341	2	987.487955	987.487290	K	K	15	23
PSM	IEDVTPIPSDSTR	3106	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10268	27.109715	2	1429.711376	1428.709639	R	R	129	142
PSM	IGFDVVTLSGTR	3107	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18728	43.623525	2	1263.686103	1263.682302	R	G	48	60
PSM	VCVIDEIGK	3108	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=12432	31.30261	2	1031.532846	1031.532132	R	M	109	118
PSM	VCVIDEIGK	3109	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=12279	31.039697	2	1031.532846	1031.532132	R	M	109	118
PSM	ITLDNAYMEK	3110	sp|P14618|KPYM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12301	31.079991	2	1196.579214	1196.574725	K	C	142	152
PSM	PQYQTWEEFSR	3111	sp|P49458|SRP09_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=15523	37.523346	2	1469.6600	1469.6570	M	A	2	13
PSM	EAPPMEKPEVVK	3112	sp|P62841|RS15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6964	19.542126	3	1352.701108	1352.700988	K	T	66	78
PSM	FDVQLKDLEK	3113	sp|P62244|RS15A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13803	34.456786	3	1233.662631	1233.660504	R	W	79	89
PSM	LVIPSELGYGER	3114	sp|P26885|FKBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16726	39.775175	2	1331.708873	1331.708516	K	G	104	116
PSM	QAVDFLSNEGHIYSTVDDDHFK	3115	sp|P15927|RFA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17217	40.739042	4	2537.151958	2536.150647	K	S	244	266
PSM	LRGEDTWMLPDVNER	3116	sp|Q2TBE0|C19L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16745	39.810679	3	1829.873507	1829.873032	R	I	52	67
PSM	QIWETSQGVGRGGSGFASYFCLNSPALDTAAAAGAAGR	3117	sp|Q5XG87|PAPD7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,21-UNIMOD:4	ms_run[1]:scan=28450	61.929128	3	3783.7892	3783.7692	M	G	2	40
PSM	IAVHCTVR	3118	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=4213	13.211173	2	955.518507	954.506920	K	G	68	76
PSM	KESYSIYVYK	3119	sp|P33778|H2B1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10263	27.103177	3	1278.650668	1278.649604	R	V	35	45
PSM	MGANSLER	3120	sp|P52272|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5721	16.617518	2	877.414139	876.412351	R	M	571	579
PSM	ANGMELDGR	3121	sp|Q13595|TRA2A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6795	19.082044	2	963.438945	961.428729	R	R	180	189
PSM	ELLQNGMNGR	3122	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10934	28.635158	2	1131.558346	1130.550242	K	T	3533	3543
PSM	ELLQNGMNGR	3123	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11021	28.792065	2	1132.554051	1130.550242	K	T	3533	3543
PSM	ILATAGWDHR	3124	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9252	25.120693	3	1141.599349	1138.588342	K	I	267	277
PSM	AGNLGGGVVTIER	3125	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11251	29.210246	2	1242.667270	1241.672800	K	S	53	66
PSM	LLDFGSLSNLQVTQPTVGMNFK	3126	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=25414	56.511322	3	2408.241373	2408.240983	K	T	108	130
PSM	DFMVQGGDFSEGNGR	3127	sp|Q13427|PPIG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14515	35.74001	2	1615.663792	1614.673270	K	G	71	86
PSM	EENKSDMNTVLNYIFSHAQVTK	3128	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=24410	54.721722	3	2568.226773	2567.232603	R	K	1015	1037
PSM	IPSTPDSFMDPASALYR	3129	sp|P28070|PSB4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=21199	48.443717	2	1867.871746	1866.882200	R	G	24	41
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	3130	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4,23-UNIMOD:4	ms_run[1]:scan=22524	51.138427	3	3564.688958	3564.658830	R	G	3369	3401
PSM	HVICTSEDMLNPNYEDLLICK	3131	cov|corona02961|ORF1a_Vietnam/19-01S/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=17867	41.913825	2	2566.205295	2563.175682	R	S	3304	3325
PSM	VCIESEHSMDTLLATLKK	3132	sp|O00244|ATOX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=18108	42.421073	3	2074.044860	2074.043863	K	T	40	58
PSM	SQPGQTFSVLACYNGSPSGVYQCAMRPNFTIK	3133	cov|corona09854|ORF1a_Bangladesh/BCSIR-NILMRC_198/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	12-UNIMOD:4,23-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=22220	50.612732	3	3581.674845	3580.653745	R	G	3369	3401
PSM	YNYEPLTQDHVDTLGPLSAQTGIAVLDMCASLK	3134	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	29-UNIMOD:4	ms_run[1]:scan=26907	59.33335	3	3622.750907	3619.753836	K	E	3500	3533
PSM	YNYEPLTQDHVDTLGPLSAQTGIAVLDMCASLK	3135	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	29-UNIMOD:4	ms_run[1]:scan=26270	58.048011	3	3622.754444	3619.753836	K	E	3500	3533
PSM	YNYEPLTQDHVDTLGPLSAQTGIAVLDMCASLK	3136	cov|corona09762|ORF1a_Spain/Madrid_COV004962/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	28-UNIMOD:35,29-UNIMOD:4	ms_run[1]:scan=26598	58.683992	3	3638.747692	3635.748751	K	E	3500	3533