MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	PXD018117 -- new
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20220821\20220821021939579274^10.242.132.110^jpost@jpost.jpost\PeakList.MaxQuantPlist1\qx017210.maxq.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20220821\20220821021939579274^10.242.132.110^jpost@jpost.jpost\Psearch.MaxQuantExec1\qx017210.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.17.0]
MTD	software[1]-setting	Taxon=userFasta.corona-human-egfp-20220819
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.corona-human-egfp-20220819
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=10
MTD	software[2]-setting	TOL(+)=10
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=50
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2019.01 rev. 5]
MTD	software[3]-setting	Taxon=userFasta.corona-human-egfp-20220819
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=10
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	S1201F	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	70.0	null	1479-UNIMOD:4,1156-UNIMOD:35,1232-UNIMOD:4,1241-UNIMOD:4,1007-UNIMOD:4,1367-UNIMOD:4,952-UNIMOD:4,953-UNIMOD:4,1364-UNIMOD:4,1349-UNIMOD:4,1359-UNIMOD:35,1394-UNIMOD:4,1265-UNIMOD:4	0.15	70.0	337	39	8
PRT	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	A434D,F2500X,*2696X	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	67.0	null	1479-UNIMOD:4,1232-UNIMOD:4,1241-UNIMOD:4,1156-UNIMOD:35,1367-UNIMOD:4,1497-UNIMOD:4,1499-UNIMOD:35,1007-UNIMOD:4,952-UNIMOD:4,953-UNIMOD:4,1020-UNIMOD:4,1035-UNIMOD:4,1049-UNIMOD:4,1359-UNIMOD:35,1364-UNIMOD:4,1349-UNIMOD:4	0.14	67.0	175	28	3
PRT	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	P4211S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	null	433-UNIMOD:4,357-UNIMOD:4,800-UNIMOD:4,213-UNIMOD:4,370-UNIMOD:4,373-UNIMOD:4,323-UNIMOD:4,326-UNIMOD:4,409-UNIMOD:4,416-UNIMOD:4,689-UNIMOD:4,3921-UNIMOD:35,191-UNIMOD:4,200-UNIMOD:4,312-UNIMOD:4,316-UNIMOD:4,321-UNIMOD:35,315-UNIMOD:35,341-UNIMOD:4,344-UNIMOD:4,3498-UNIMOD:35,506-UNIMOD:4,270-UNIMOD:4,655-UNIMOD:4,657-UNIMOD:4,667-UNIMOD:4,731-UNIMOD:35,230-UNIMOD:4,231-UNIMOD:4,420-UNIMOD:4	0.10	50.0	48	32	17
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	null	127-UNIMOD:4,129-UNIMOD:4	0.08	50.0	3	2	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	49.0	null	267-UNIMOD:35,388-UNIMOD:35,354-UNIMOD:4,1-UNIMOD:35,12-UNIMOD:4,330-UNIMOD:35	0.29	49.0	13	8	2
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	48.0	null	584-UNIMOD:35,596-UNIMOD:35,608-UNIMOD:4,561-UNIMOD:35,303-UNIMOD:35,172-UNIMOD:35,389-UNIMOD:35,108-UNIMOD:28,174-UNIMOD:35,366-UNIMOD:4,370-UNIMOD:35	0.52	48.0	85	34	11
PRT	sp|Q9BV73|CP250_HUMAN	Centrosome-associated protein CEP250 OS=Homo sapiens OX=9606 GN=CEP250 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	47.0	null	2008-UNIMOD:4,1316-UNIMOD:35,2195-UNIMOD:35,630-UNIMOD:4,412-UNIMOD:4,917-UNIMOD:4,110-UNIMOD:4,986-UNIMOD:28,898-UNIMOD:35,1551-UNIMOD:28,1557-UNIMOD:4,1852-UNIMOD:35,110-UNIMOD:385,477-UNIMOD:28,2073-UNIMOD:35,1645-UNIMOD:28,1087-UNIMOD:28,70-UNIMOD:4	0.58	47.0	172	120	77
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	47.0	null	500-UNIMOD:4,1-UNIMOD:1,1769-UNIMOD:4,2247-UNIMOD:35,1470-UNIMOD:4,407-UNIMOD:4,1176-UNIMOD:4,743-UNIMOD:4,754-UNIMOD:35,813-UNIMOD:4,1-UNIMOD:35,2277-UNIMOD:28,634-UNIMOD:4,309-UNIMOD:35,2074-UNIMOD:4,2075-UNIMOD:4,1297-UNIMOD:4,336-UNIMOD:28,156-UNIMOD:35,1236-UNIMOD:35,1230-UNIMOD:4,349-UNIMOD:35	0.51	47.0	139	87	47
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	47.0	null	85-UNIMOD:28,295-UNIMOD:4,302-UNIMOD:35,376-UNIMOD:4,398-UNIMOD:35,347-UNIMOD:4,313-UNIMOD:35,315-UNIMOD:4,316-UNIMOD:4,425-UNIMOD:35	0.55	47.0	39	19	5
PRT	sp|Q08379|GOGA2_HUMAN	Golgin subfamily A member 2 OS=Homo sapiens OX=9606 GN=GOLGA2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	46.0	null	139-UNIMOD:4,144-UNIMOD:4,794-UNIMOD:4,446-UNIMOD:35,356-UNIMOD:4,564-UNIMOD:35,934-UNIMOD:4,356-UNIMOD:385,984-UNIMOD:4,383-UNIMOD:35,414-UNIMOD:35,331-UNIMOD:35,528-UNIMOD:35,813-UNIMOD:35,523-UNIMOD:28,666-UNIMOD:28,816-UNIMOD:35	0.66	46.0	91	52	26
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	45.0	null	322-UNIMOD:28,328-UNIMOD:4,347-UNIMOD:35,193-UNIMOD:35,372-UNIMOD:35,376-UNIMOD:35,183-UNIMOD:35,154-UNIMOD:35,160-UNIMOD:28,208-UNIMOD:28,274-UNIMOD:28	0.70	45.0	86	43	21
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	55-UNIMOD:35,442-UNIMOD:4,356-UNIMOD:35,495-UNIMOD:35,237-UNIMOD:4,237-UNIMOD:385,40-UNIMOD:35	0.46	45.0	36	23	14
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	45.0	null	411-UNIMOD:4,276-UNIMOD:35,404-UNIMOD:35,410-UNIMOD:35,363-UNIMOD:4,370-UNIMOD:4,431-UNIMOD:28	0.61	45.0	44	18	10
PRT	sp|Q5T440|CAF17_HUMAN	Putative transferase CAF17, mitochondrial OS=Homo sapiens OX=9606 GN=IBA57 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	170-UNIMOD:4,259-UNIMOD:4	0.37	45.0	9	7	5
PRT	sp|Q96SN8|CK5P2_HUMAN	CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	1139-UNIMOD:4,1148-UNIMOD:4,1697-UNIMOD:4,1708-UNIMOD:4,1811-UNIMOD:4,1815-UNIMOD:4,249-UNIMOD:4,528-UNIMOD:4,683-UNIMOD:4,853-UNIMOD:4,1528-UNIMOD:4	0.40	44.0	65	50	38
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	95-UNIMOD:4,145-UNIMOD:35,191-UNIMOD:35	0.67	44.0	21	12	5
PRT	sp|O75506|HSBP1_HUMAN	Heat shock factor-binding protein 1 OS=Homo sapiens OX=9606 GN=HSBP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	44.0	null	56-UNIMOD:35	0.75	44.0	8	4	1
PRT	sp|P0DMV9|HS71B_HUMAN	Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	null	17-UNIMOD:4,574-UNIMOD:4,603-UNIMOD:4,306-UNIMOD:4,87-UNIMOD:35,549-UNIMOD:35	0.52	43.0	38	25	12
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	974-UNIMOD:4,613-UNIMOD:4,836-UNIMOD:4,839-UNIMOD:4,1625-UNIMOD:4,2150-UNIMOD:4,1386-UNIMOD:4,2185-UNIMOD:4,563-UNIMOD:4,624-UNIMOD:4,625-UNIMOD:4,215-UNIMOD:4,219-UNIMOD:4,798-UNIMOD:28,1777-UNIMOD:4,482-UNIMOD:28,2628-UNIMOD:4,1119-UNIMOD:4,64-UNIMOD:4,70-UNIMOD:4,1315-UNIMOD:4,2026-UNIMOD:4,1225-UNIMOD:4,321-UNIMOD:4,860-UNIMOD:4,1228-UNIMOD:35,321-UNIMOD:385,1456-UNIMOD:28,2576-UNIMOD:4,171-UNIMOD:35,299-UNIMOD:28,257-UNIMOD:35,1-UNIMOD:1,1481-UNIMOD:35,2729-UNIMOD:4,430-UNIMOD:4,184-UNIMOD:35,1932-UNIMOD:28	0.55	43.0	207	148	101
PRT	tr|C5MKY7|C5MKY7_HCMV	Enhanced green fluorescent protein OS=Human cytomegalovirus OX=10359 GN=egfp PE=4 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	null	219-UNIMOD:35,234-UNIMOD:35	0.10	42.0	1	1	1
PRT	sp|P63167|DYL1_HUMAN	Dynein light chain 1, cytoplasmic OS=Homo sapiens OX=9606 GN=DYNLL1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	24-UNIMOD:4,13-UNIMOD:35	0.36	42.0	5	2	1
PRT	sp|O00571-2|DDX3X_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	null	282-UNIMOD:4,207-UNIMOD:4	0.28	42.0	14	12	10
PRT	sp|Q9H3K6|BOLA2_HUMAN	BolA-like protein 2 OS=Homo sapiens OX=9606 GN=BOLA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	1-UNIMOD:1	0.31	41.0	4	2	1
PRT	sp|Q8N4C6-7|NIN_HUMAN	Isoform 7 of Ninein OS=Homo sapiens OX=9606 GN=NIN	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	null	90-UNIMOD:4,956-UNIMOD:4,869-UNIMOD:4,822-UNIMOD:4,297-UNIMOD:4,1502-UNIMOD:4,1986-UNIMOD:4,829-UNIMOD:4,1692-UNIMOD:4,1726-UNIMOD:4,1261-UNIMOD:4,1619-UNIMOD:4,1387-UNIMOD:4,998-UNIMOD:4,647-UNIMOD:4	0.39	41.0	67	59	44
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.50	41.0	9	8	7
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	917-UNIMOD:4,172-UNIMOD:4,988-UNIMOD:4,694-UNIMOD:4,569-UNIMOD:4,816-UNIMOD:4	0.39	41.0	71	56	41
PRT	sp|Q14789-2|GOGB1_HUMAN	Isoform 2 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	null	400-UNIMOD:4,686-UNIMOD:4,2669-UNIMOD:4,1969-UNIMOD:4,3207-UNIMOD:4,3223-UNIMOD:4,1290-UNIMOD:4,3095-UNIMOD:4,1156-UNIMOD:4,1574-UNIMOD:4,2284-UNIMOD:4,3154-UNIMOD:4,1262-UNIMOD:4,1060-UNIMOD:4	0.41	41.0	100	92	74
PRT	sp|Q99497|PARK7_HUMAN	Parkinson disease protein 7 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	106-UNIMOD:4,46-UNIMOD:4,53-UNIMOD:4,26-UNIMOD:35,17-UNIMOD:35,134-UNIMOD:35,133-UNIMOD:35,90-UNIMOD:27	0.78	41.0	39	15	5
PRT	sp|O15235|RT12_HUMAN	28S ribosomal protein S12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS12 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	93-UNIMOD:4,64-UNIMOD:4	0.34	40.0	5	3	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	73-UNIMOD:35,330-UNIMOD:35,363-UNIMOD:35	0.28	40.0	21	9	4
PRT	sp|Q16527|CSRP2_HUMAN	Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	58-UNIMOD:4,167-UNIMOD:4,122-UNIMOD:4,25-UNIMOD:4	0.59	40.0	12	10	9
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	95-UNIMOD:4,1011-UNIMOD:4,164-UNIMOD:4,176-UNIMOD:4,701-UNIMOD:4	0.20	40.0	28	26	23
PRT	cov|corona00371|ORF1b_USA/WA-UW228/2020	P1427L,Y1464C	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	1464-UNIMOD:4,1479-UNIMOD:4	0.01	40.0	7	1	0
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	132-UNIMOD:35	0.32	40.0	10	6	2
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	101-UNIMOD:4,134-UNIMOD:4,212-UNIMOD:35,374-UNIMOD:4,251-UNIMOD:35,359-UNIMOD:385,359-UNIMOD:4	0.67	39.0	33	21	14
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q9BQE3|TBA1C_HUMAN	Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	295-UNIMOD:4,376-UNIMOD:4,302-UNIMOD:35	0.16	39.0	6	3	1
PRT	sp|P11498|PYC_HUMAN	Pyruvate carboxylase, mitochondrial OS=Homo sapiens OX=9606 GN=PC PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	752-UNIMOD:4,1012-UNIMOD:35,881-UNIMOD:35,743-UNIMOD:35,850-UNIMOD:4,75-UNIMOD:35,131-UNIMOD:4,754-UNIMOD:35,301-UNIMOD:28,372-UNIMOD:4,376-UNIMOD:4,828-UNIMOD:35,566-UNIMOD:35,56-UNIMOD:4,739-UNIMOD:4	0.54	39.0	88	48	23
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	245-UNIMOD:35,269-UNIMOD:35,326-UNIMOD:35,276-UNIMOD:35,286-UNIMOD:35	0.33	39.0	18	15	12
PRT	sp|Q9P258|RCC2_HUMAN	Protein RCC2 OS=Homo sapiens OX=9606 GN=RCC2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	280-UNIMOD:4,144-UNIMOD:4	0.34	39.0	18	13	9
PRT	sp|Q8TD10|MIPO1_HUMAN	Mirror-image polydactyly gene 1 protein OS=Homo sapiens OX=9606 GN=MIPOL1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	97-UNIMOD:4,101-UNIMOD:4,78-UNIMOD:4,51-UNIMOD:4,32-UNIMOD:35	0.60	39.0	31	20	12
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	101-UNIMOD:35,176-UNIMOD:35	0.51	39.0	25	12	5
PRT	sp|Q96I24|FUBP3_HUMAN	Far upstream element-binding protein 3 OS=Homo sapiens OX=9606 GN=FUBP3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	310-UNIMOD:4,2-UNIMOD:1,310-UNIMOD:385,125-UNIMOD:4,460-UNIMOD:4,366-UNIMOD:4	0.65	39.0	33	22	14
PRT	sp|Q96RQ3|MCCA_HUMAN	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	129-UNIMOD:4,142-UNIMOD:4,522-UNIMOD:35,422-UNIMOD:28,595-UNIMOD:4,509-UNIMOD:4,190-UNIMOD:4,332-UNIMOD:4,600-UNIMOD:4	0.51	39.0	32	24	17
PRT	sp|P04080|CYTB_HUMAN	Cystatin-B OS=Homo sapiens OX=9606 GN=CSTB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	null	1-UNIMOD:1,3-UNIMOD:4,1-UNIMOD:35	0.72	39.0	6	4	2
PRT	sp|Q04724|TLE1_HUMAN	Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	89-UNIMOD:4,526-UNIMOD:4,621-UNIMOD:4	0.14	38.0	7	6	5
PRT	sp|Q15154|PCM1_HUMAN	Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	770-UNIMOD:4,783-UNIMOD:4,1585-UNIMOD:4,582-UNIMOD:4,187-UNIMOD:4	0.16	38.0	24	21	19
PRT	sp|Q9HCC0|MCCB_HUMAN	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	38.0	null	473-UNIMOD:35,167-UNIMOD:4,131-UNIMOD:4,496-UNIMOD:28,391-UNIMOD:4,392-UNIMOD:4,431-UNIMOD:4,161-UNIMOD:35	0.44	38.0	33	20	10
PRT	sp|P07477|TRY1_HUMAN	Trypsin-1 OS=Homo sapiens OX=9606 GN=PRSS1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.09	38.0	1	1	1
PRT	sp|Q5VU43-13|MYOME_HUMAN	Isoform 13 of Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	780-UNIMOD:4,718-UNIMOD:4,766-UNIMOD:4,184-UNIMOD:4	0.33	38.0	30	28	22
PRT	sp|Q99996-3|AKAP9_HUMAN	Isoform 3 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	null	3573-UNIMOD:4,2325-UNIMOD:4,2332-UNIMOD:4,3500-UNIMOD:4,3856-UNIMOD:4,2563-UNIMOD:4,3073-UNIMOD:4,1782-UNIMOD:4,2125-UNIMOD:4,1367-UNIMOD:4,1954-UNIMOD:4,2510-UNIMOD:4,2010-UNIMOD:4	0.33	38.0	97	92	79
PRT	sp|Q08378|GOGA3_HUMAN	Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	769-UNIMOD:4,1-UNIMOD:1,913-UNIMOD:28,136-UNIMOD:4,1334-UNIMOD:35,455-UNIMOD:4,723-UNIMOD:35,192-UNIMOD:35,1431-UNIMOD:4,477-UNIMOD:4,665-UNIMOD:35	0.56	38.0	96	63	38
PRT	sp|Q8WVK2|SNR27_HUMAN	U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP27 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	107-UNIMOD:35,87-UNIMOD:28,103-UNIMOD:35	0.31	38.0	10	4	1
PRT	cov|corona00001|ORF1a_Wuhan/WH01/2019	L2235I,N3833K	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	3911-UNIMOD:35,323-UNIMOD:385,323-UNIMOD:4,326-UNIMOD:4,800-UNIMOD:4,807-UNIMOD:35,3921-UNIMOD:35,409-UNIMOD:4,416-UNIMOD:4,655-UNIMOD:4,657-UNIMOD:4,667-UNIMOD:4,270-UNIMOD:4	0.04	38.0	11	9	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	194-UNIMOD:4,201-UNIMOD:4,244-UNIMOD:28,179-UNIMOD:35,158-UNIMOD:4,54-UNIMOD:4,186-UNIMOD:35,109-UNIMOD:4,308-UNIMOD:35,201-UNIMOD:385	0.62	38.0	24	13	6
PRT	sp|P05165|PCCA_HUMAN	Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	155-UNIMOD:4,363-UNIMOD:4,111-UNIMOD:4,398-UNIMOD:4,616-UNIMOD:4	0.45	37.0	31	24	18
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.32	37.0	4	3	2
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.31	37.0	10	6	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	311-UNIMOD:4,295-UNIMOD:4,298-UNIMOD:4,2-UNIMOD:1,429-UNIMOD:4,24-UNIMOD:4	0.41	37.0	33	30	27
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.27	37.0	4	4	4
PRT	sp|Q9Y383|LC7L2_HUMAN	Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	43-UNIMOD:4,44-UNIMOD:4,15-UNIMOD:35,190-UNIMOD:4,193-UNIMOD:4,10-UNIMOD:35,177-UNIMOD:35,54-UNIMOD:35,59-UNIMOD:4,348-UNIMOD:4	0.39	37.0	32	13	5
PRT	sp|Q4V328|GRAP1_HUMAN	GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	104-UNIMOD:4,2-UNIMOD:1	0.43	37.0	37	28	21
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	17-UNIMOD:4,61-UNIMOD:35,237-UNIMOD:35,549-UNIMOD:35,603-UNIMOD:4,87-UNIMOD:35	0.54	37.0	58	29	13
PRT	sp|P05204|HMGN2_HUMAN	Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.47	37.0	5	4	3
PRT	sp|Q8IUD2|RB6I2_HUMAN	ELKS/Rab6-interacting/CAST family member 1 OS=Homo sapiens OX=9606 GN=ERC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	258-UNIMOD:4	0.32	37.0	31	27	24
PRT	sp|Q8IWX8|CHERP_HUMAN	Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens OX=9606 GN=CHERP PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	246-UNIMOD:4,69-UNIMOD:4,190-UNIMOD:4,128-UNIMOD:28,1-UNIMOD:1	0.22	37.0	14	11	8
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	null	2664-UNIMOD:4,1055-UNIMOD:4,395-UNIMOD:4,1713-UNIMOD:4	0.10	37.0	20	20	9
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	257-UNIMOD:4,272-UNIMOD:4,2-UNIMOD:1,17-UNIMOD:4,360-UNIMOD:28,325-UNIMOD:35,153-UNIMOD:35,217-UNIMOD:4,305-UNIMOD:35	0.64	37.0	27	15	6
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	null		0.13	37.0	1	1	1
PRT	sp|P62633-2|CNBP_HUMAN	Isoform 2 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null	133-UNIMOD:4,143-UNIMOD:4,60-UNIMOD:4,67-UNIMOD:4,70-UNIMOD:4,112-UNIMOD:4,115-UNIMOD:4,47-UNIMOD:4,90-UNIMOD:4,91-UNIMOD:4,94-UNIMOD:4,104-UNIMOD:4,50-UNIMOD:4,154-UNIMOD:4,151-UNIMOD:4	0.63	36.0	14	9	3
PRT	sp|P32121|ARRB2_HUMAN	Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	252-UNIMOD:4,270-UNIMOD:4,409-UNIMOD:4,141-UNIMOD:4,126-UNIMOD:4	0.34	36.0	13	8	4
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	373-UNIMOD:4,211-UNIMOD:4	0.23	36.0	9	7	5
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null	2-UNIMOD:1	0.17	36.0	8	8	7
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.24	36.0	5	5	5
PRT	sp|Q7Z7A1-2|CNTRL_HUMAN	Isoform 2 of Centriolin OS=Homo sapiens OX=9606 GN=CNTRL	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|Q14061|COX17_HUMAN	Cytochrome c oxidase copper chaperone OS=Homo sapiens OX=9606 GN=COX17 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null	36-UNIMOD:4,45-UNIMOD:4	0.60	36.0	3	2	1
PRT	sp|Q8NC51-3|PAIRB_HUMAN	Isoform 3 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.31	36.0	9	8	5
PRT	sp|P61513|RL37A_HUMAN	60S ribosomal protein L37a OS=Homo sapiens OX=9606 GN=RPL37A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	57-UNIMOD:4,60-UNIMOD:4,39-UNIMOD:4,42-UNIMOD:4	0.62	36.0	8	5	2
PRT	sp|Q01081|U2AF1_HUMAN	Splicing factor U2AF 35 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	2-UNIMOD:1,169-UNIMOD:4	0.26	36.0	7	5	4
PRT	cov|corona12378|ORF1b_Latvia/023/2020	V466I	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	36.0	null	1232-UNIMOD:4,1241-UNIMOD:4,1367-UNIMOD:385,1367-UNIMOD:4,459-UNIMOD:28,473-UNIMOD:4,478-UNIMOD:4,952-UNIMOD:385,952-UNIMOD:4,953-UNIMOD:4,1079-UNIMOD:27,1085-UNIMOD:27	0.05	36.0	21	9	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	60-UNIMOD:35,28-UNIMOD:4,62-UNIMOD:35,125-UNIMOD:4	0.42	36.0	17	5	0
PRT	sp|P08865|RSSA_HUMAN	40S ribosomal protein SA OS=Homo sapiens OX=9606 GN=RPSA PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	148-UNIMOD:4,2-UNIMOD:1	0.30	36.0	10	7	4
PRT	sp|Q8NBS9|TXND5_HUMAN	Thioredoxin domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	121-UNIMOD:4,128-UNIMOD:4	0.21	35.0	7	6	5
PRT	sp|Q01130-2|SRSF2_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 2 OS=Homo sapiens OX=9606 GN=SRSF2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	null	2-UNIMOD:1	0.21	35.0	4	3	2
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	256-UNIMOD:4	0.18	35.0	5	3	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	157-UNIMOD:35,97-UNIMOD:4,134-UNIMOD:4,236-UNIMOD:35	0.72	35.0	20	15	11
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	1105-UNIMOD:4	0.23	35.0	23	21	19
PRT	sp|P25398|RS12_HUMAN	40S ribosomal protein S12 OS=Homo sapiens OX=9606 GN=RPS12 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	69-UNIMOD:4,50-UNIMOD:4,56-UNIMOD:4,2-UNIMOD:1,12-UNIMOD:35,60-UNIMOD:35,106-UNIMOD:4,108-UNIMOD:4	0.70	35.0	13	6	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	126-UNIMOD:35,35-UNIMOD:4	0.68	35.0	12	8	5
PRT	sp|Q9Y2I6|NINL_HUMAN	Ninein-like protein OS=Homo sapiens OX=9606 GN=NINL PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	714-UNIMOD:4,715-UNIMOD:4,720-UNIMOD:4,1-UNIMOD:1,19-UNIMOD:4,1132-UNIMOD:4,424-UNIMOD:4,118-UNIMOD:4,36-UNIMOD:4,294-UNIMOD:4,306-UNIMOD:4,1009-UNIMOD:4	0.39	35.0	47	38	30
PRT	sp|Q66PJ3-7|AR6P4_HUMAN	Isoform 7 of ADP-ribosylation factor-like protein 6-interacting protein 4 OS=Homo sapiens OX=9606 GN=ARL6IP4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.16	35.0	2	2	2
PRT	sp|Q5VU43|MYOME_HUMAN	Myomegalin OS=Homo sapiens OX=9606 GN=PDE4DIP PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	null	311-UNIMOD:35	0.05	35.0	8	7	3
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.45	34.0	13	9	5
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	246-UNIMOD:4,249-UNIMOD:4,258-UNIMOD:4,28-UNIMOD:4,73-UNIMOD:4,178-UNIMOD:4,181-UNIMOD:4,208-UNIMOD:4,271-UNIMOD:4	0.46	34.0	13	11	6
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	2-UNIMOD:1	0.54	34.0	5	5	3
PRT	sp|P04350|TBB4A_HUMAN	Tubulin beta-4A chain OS=Homo sapiens OX=9606 GN=TUBB4A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	12-UNIMOD:4,233-UNIMOD:35,239-UNIMOD:4,164-UNIMOD:35,257-UNIMOD:35,354-UNIMOD:4,127-UNIMOD:4,129-UNIMOD:4,147-UNIMOD:35,73-UNIMOD:35,299-UNIMOD:35,303-UNIMOD:4,300-UNIMOD:35	0.57	34.0	38	18	5
PRT	sp|P16152|CBR1_HUMAN	Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	122-UNIMOD:4,2-UNIMOD:1,150-UNIMOD:4	0.38	34.0	7	7	7
PRT	sp|Q9GZP4-2|PITH1_HUMAN	Isoform 2 of PITH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PITHD1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	186-UNIMOD:4	0.15	34.0	3	2	1
PRT	sp|O95684-3|CEP43_HUMAN	Isoform 3 of Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.17	34.0	1	1	0
PRT	sp|P62888|RL30_HUMAN	60S ribosomal protein L30 OS=Homo sapiens OX=9606 GN=RPL30 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	92-UNIMOD:4,52-UNIMOD:4,85-UNIMOD:4	0.62	34.0	12	7	3
PRT	sp|A1KXE4-2|F168B_HUMAN	Isoform 2 of Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	1-UNIMOD:1	0.15	34.0	1	1	1
PRT	cov|corona13076|ORF1b_SouthAfrica/KRISP-0113/2020	I1032L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	1020-UNIMOD:4,1035-UNIMOD:4,1049-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|P51970|NDUA8_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 OS=Homo sapiens OX=9606 GN=NDUFA8 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.27	34.0	3	3	3
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	516-UNIMOD:4,517-UNIMOD:4,90-UNIMOD:4	0.45	34.0	21	18	15
PRT	sp|Q96CT7|CC124_HUMAN	Coiled-coil domain-containing protein 124 OS=Homo sapiens OX=9606 GN=CCDC124 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.31	34.0	9	5	3
PRT	sp|P17844|DDX5_HUMAN	Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	221-UNIMOD:4,191-UNIMOD:4,234-UNIMOD:4	0.30	34.0	17	15	13
PRT	sp|O00244|ATOX1_HUMAN	Copper transport protein ATOX1 OS=Homo sapiens OX=9606 GN=ATOX1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	41-UNIMOD:4,48-UNIMOD:35	0.41	34.0	3	2	1
PRT	cov|corona06480|ORF1b_Norway/2505/2020	N713T,T1289M,I1495L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null	1497-UNIMOD:4	0.01	34.0	5	2	1
PRT	sp|P84103-2|SRSF3_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 3 OS=Homo sapiens OX=9606 GN=SRSF3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.48	34.0	7	5	3
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	null		0.08	34.0	2	2	0
PRT	sp|Q9HB71|CYBP_HUMAN	Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	2-UNIMOD:1	0.15	33.0	3	3	3
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.10	33.0	5	5	5
PRT	sp|P47813|IF1AX_HUMAN	Eukaryotic translation initiation factor 1A, X-chromosomal OS=Homo sapiens OX=9606 GN=EIF1AX PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	51-UNIMOD:4	0.29	33.0	5	3	1
PRT	sp|P62979|RS27A_HUMAN	Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	121-UNIMOD:4,126-UNIMOD:4,144-UNIMOD:4,145-UNIMOD:4,149-UNIMOD:4,144-UNIMOD:385	0.28	33.0	6	3	1
PRT	sp|P63244|RACK1_HUMAN	Receptor of activated protein C kinase 1 OS=Homo sapiens OX=9606 GN=RACK1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	240-UNIMOD:4,207-UNIMOD:4,168-UNIMOD:4,249-UNIMOD:4	0.30	33.0	7	5	3
PRT	sp|Q96N16|JKIP1_HUMAN	Janus kinase and microtubule-interacting protein 1 OS=Homo sapiens OX=9606 GN=JAKMIP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	172-UNIMOD:4	0.29	33.0	16	14	12
PRT	sp|P68371|TBB4B_HUMAN	Tubulin beta-4B chain OS=Homo sapiens OX=9606 GN=TUBB4B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	3	2	1
PRT	sp|P22102-2|PUR2_HUMAN	Isoform Short of Trifunctional purine biosynthetic protein adenosine-3 OS=Homo sapiens OX=9606 GN=GART	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	null	93-UNIMOD:4,62-UNIMOD:4,298-UNIMOD:4,41-UNIMOD:4	0.17	33.0	4	4	4
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	2-UNIMOD:1	0.12	33.0	9	7	5
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.21	33.0	12	10	8
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	3	1	0
PRT	sp|Q01844-6|EWS_HUMAN	Isoform 6 of RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	2	1
PRT	sp|Q9BV19|CA050_HUMAN	Uncharacterized protein C1orf50 OS=Homo sapiens OX=9606 GN=C1orf50 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	110-UNIMOD:4	0.41	32.0	6	4	2
PRT	sp|Q96EY4|TMA16_HUMAN	Translation machinery-associated protein 16 OS=Homo sapiens OX=9606 GN=TMA16 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null	162-UNIMOD:4	0.35	32.0	11	7	3
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.32	32.0	7	3	0
PRT	sp|P78549-3|NTH_HUMAN	Isoform 3 of Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.20	32.0	3	3	2
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.34	32.0	19	16	13
PRT	sp|P29372-5|3MG_HUMAN	Isoform 4 of DNA-3-methyladenine glycosylase OS=Homo sapiens OX=9606 GN=MPG	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null	44-UNIMOD:4,205-UNIMOD:4	0.43	32.0	9	9	9
PRT	sp|Q9H1K1-2|ISCU_HUMAN	Isoform 2 of Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens OX=9606 GN=ISCU	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null	44-UNIMOD:4	0.13	32.0	1	1	1
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	99-UNIMOD:4,102-UNIMOD:4,108-UNIMOD:4,2-UNIMOD:1,7-UNIMOD:4,182-UNIMOD:4	0.39	32.0	11	8	5
PRT	sp|Q9Y2V2|CHSP1_HUMAN	Calcium-regulated heat-stable protein 1 OS=Homo sapiens OX=9606 GN=CARHSP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	2-UNIMOD:1	0.36	32.0	3	3	3
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.27	32.0	7	6	4
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	147-UNIMOD:4,127-UNIMOD:4	0.44	32.0	18	14	10
PRT	sp|P62847-2|RS24_HUMAN	Isoform 2 of 40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null	74-UNIMOD:35,1-UNIMOD:1	0.40	32.0	8	6	4
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	247-UNIMOD:4,152-UNIMOD:4,156-UNIMOD:4	0.28	32.0	6	6	6
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	181-UNIMOD:4,41-UNIMOD:4	0.62	32.0	24	16	9
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	290-UNIMOD:4,267-UNIMOD:4,22-UNIMOD:4	0.14	32.0	5	4	3
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	44-UNIMOD:4,172-UNIMOD:35,249-UNIMOD:4	0.57	32.0	21	16	12
PRT	sp|P54886|P5CS_HUMAN	Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	2	1	0
PRT	sp|Q14807|KIF22_HUMAN	Kinesin-like protein KIF22 OS=Homo sapiens OX=9606 GN=KIF22 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	null		0.05	32.0	2	2	1
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	650-UNIMOD:4,656-UNIMOD:4,610-UNIMOD:4,233-UNIMOD:4	0.30	31.0	19	17	11
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	2-UNIMOD:1	0.01	31.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	6	4	2
PRT	sp|P63173|RL38_HUMAN	60S ribosomal protein L38 OS=Homo sapiens OX=9606 GN=RPL38 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.56	31.0	21	5	0
PRT	sp|O60869-2|EDF1_HUMAN	Isoform 2 of Endothelial differentiation-related factor 1 OS=Homo sapiens OX=9606 GN=EDF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	1	1	1
PRT	sp|Q8WUA2|PPIL4_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens OX=9606 GN=PPIL4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.11	31.0	4	4	4
PRT	sp|Q8NEZ5|FBX22_HUMAN	F-box only protein 22 OS=Homo sapiens OX=9606 GN=FBXO22 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.16	31.0	5	4	3
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	23-UNIMOD:4,13-UNIMOD:35	0.30	31.0	12	6	0
PRT	sp|O75694|NU155_HUMAN	Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	6	6	6
PRT	sp|Q5SW79|CE170_HUMAN	Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	235-UNIMOD:4	0.15	31.0	18	15	13
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	720-UNIMOD:4	0.12	31.0	7	7	7
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	129-UNIMOD:4	0.14	31.0	3	3	3
PRT	sp|O95232|LC7L3_HUMAN	Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35,40-UNIMOD:4,43-UNIMOD:4,35-UNIMOD:4	0.37	31.0	19	13	8
PRT	sp|P60660|MYL6_HUMAN	Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.26	31.0	5	4	3
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	15-UNIMOD:4	0.17	31.0	10	7	4
PRT	sp|Q92995-2|UBP13_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.18	31.0	9	8	6
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	7	5	2
PRT	sp|Q7L4I2-2|RSRC2_HUMAN	Isoform 2 of Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null	334-UNIMOD:4	0.22	31.0	6	6	5
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=H1-2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	2-UNIMOD:1	0.34	31.0	8	7	6
PRT	sp|P04264|K2C1_HUMAN	Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.24	31.0	18	15	12
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	647-UNIMOD:4	0.13	31.0	12	10	8
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	3	3	3
PRT	sp|P49454|CENPF_HUMAN	Centromere protein F OS=Homo sapiens OX=9606 GN=CENPF PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	142-UNIMOD:4,1694-UNIMOD:4,2052-UNIMOD:4,2477-UNIMOD:4,1166-UNIMOD:4,503-UNIMOD:4,1307-UNIMOD:4	0.13	31.0	32	29	26
PRT	sp|Q9HA64|KT3K_HUMAN	Ketosamine-3-kinase OS=Homo sapiens OX=9606 GN=FN3KRP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.14	31.0	3	3	3
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.26	31.0	10	5	2
PRT	sp|Q9Y237|PIN4_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Homo sapiens OX=9606 GN=PIN4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null		0.28	31.0	4	4	4
PRT	sp|P82912|RT11_HUMAN	28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	222-UNIMOD:4,229-UNIMOD:4	0.38	30.0	10	9	8
PRT	sp|Q8N3C7-3|CLIP4_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 4 OS=Homo sapiens OX=9606 GN=CLIP4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	538-UNIMOD:4,259-UNIMOD:4	0.13	30.0	5	5	5
PRT	sp|Q15637-6|SF01_HUMAN	Isoform 6 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	2-UNIMOD:1,282-UNIMOD:4,292-UNIMOD:4,279-UNIMOD:4	0.20	30.0	8	8	7
PRT	sp|P62851|RS25_HUMAN	40S ribosomal protein S25 OS=Homo sapiens OX=9606 GN=RPS25 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	59-UNIMOD:4	0.40	30.0	7	6	5
PRT	sp|P30050|RL12_HUMAN	60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	141-UNIMOD:4,17-UNIMOD:4	0.30	30.0	4	3	2
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.20	30.0	9	9	6
PRT	sp|Q96J01-2|THOC3_HUMAN	Isoform 2 of THO complex subunit 3 OS=Homo sapiens OX=9606 GN=THOC3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	106-UNIMOD:4	0.17	30.0	4	4	4
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	63-UNIMOD:35,90-UNIMOD:35	0.39	30.0	12	6	2
PRT	sp|P18621-3|RL17_HUMAN	Isoform 3 of 60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.22	30.0	4	4	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.03	30.0	3	2	0
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	67-UNIMOD:35	0.27	30.0	4	2	1
PRT	sp|Q9Y421|FA32A_HUMAN	Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1	0.39	30.0	4	4	4
PRT	sp|Q8TA86|RP9_HUMAN	Retinitis pigmentosa 9 protein OS=Homo sapiens OX=9606 GN=RP9 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	120-UNIMOD:4	0.37	30.0	11	8	6
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.72	30.0	6	4	3
PRT	sp|Q99832|TCPH_HUMAN	T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	511-UNIMOD:4	0.11	30.0	4	4	4
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	2433-UNIMOD:4,2442-UNIMOD:4,78-UNIMOD:4,81-UNIMOD:4,2656-UNIMOD:4,2259-UNIMOD:4,1805-UNIMOD:4,174-UNIMOD:4,984-UNIMOD:35,1280-UNIMOD:4,899-UNIMOD:4	0.22	30.0	57	45	34
PRT	sp|Q8IZQ5|SELH_HUMAN	Selenoprotein H OS=Homo sapiens OX=9606 GN=SELENOH PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.27	30.0	3	3	3
PRT	sp|Q8N9Q2|SR1IP_HUMAN	Protein SREK1IP1 OS=Homo sapiens OX=9606 GN=SREK1IP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	18-UNIMOD:4,28-UNIMOD:4,18-UNIMOD:385,2-UNIMOD:1,6-UNIMOD:4	0.31	30.0	9	5	3
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.26	30.0	15	12	10
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	39-UNIMOD:4	0.31	30.0	4	3	2
PRT	sp|A7MCY6|TBKB1_HUMAN	TANK-binding kinase 1-binding protein 1 OS=Homo sapiens OX=9606 GN=TBKBP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	163-UNIMOD:4,254-UNIMOD:4	0.16	30.0	8	7	6
PRT	sp|P07197|NFM_HUMAN	Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.16	30.0	12	12	12
PRT	sp|Q9UI43|MRM2_HUMAN	rRNA methyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=MRM2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	79-UNIMOD:4	0.26	30.0	7	4	1
PRT	sp|Q9H857-2|NT5D2_HUMAN	Isoform 2 of 5'-nucleotidase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NT5DC2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.19	30.0	7	7	7
PRT	sp|Q9BYB4|GNB1L_HUMAN	Guanine nucleotide-binding protein subunit beta-like protein 1 OS=Homo sapiens OX=9606 GN=GNB1L PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	109-UNIMOD:4,116-UNIMOD:4,206-UNIMOD:4,70-UNIMOD:4,93-UNIMOD:4	0.31	30.0	9	7	5
PRT	sp|Q12834|CDC20_HUMAN	Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	313-UNIMOD:4	0.06	30.0	2	2	2
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	49-UNIMOD:4,52-UNIMOD:35	0.41	30.0	10	8	5
PRT	sp|Q14498-2|RBM39_HUMAN	Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	null	303-UNIMOD:4,282-UNIMOD:35,2-UNIMOD:1	0.32	30.0	15	13	10
PRT	sp|Q8N4C6|NIN_HUMAN	Ninein OS=Homo sapiens OX=9606 GN=NIN PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	null	1-UNIMOD:1,297-UNIMOD:4,143-UNIMOD:4,1692-UNIMOD:4	0.08	30.0	11	10	4
PRT	sp|Q71U36|TBA1A_HUMAN	Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	null	376-UNIMOD:4,398-UNIMOD:35,295-UNIMOD:4	0.25	30.0	9	6	0
PRT	sp|P26368|U2AF2_HUMAN	Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	10-UNIMOD:28,2-UNIMOD:1	0.17	30.0	4	4	2
PRT	sp|P0DP23|CALM1_HUMAN	Calmodulin-1 OS=Homo sapiens OX=9606 GN=CALM1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	null		0.27	30.0	2	2	0
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	83-UNIMOD:4	0.52	30.0	3	3	3
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	281-UNIMOD:4,369-UNIMOD:4	0.12	29.0	4	4	4
PRT	sp|Q9BYC8|RM32_HUMAN	39S ribosomal protein L32, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL32 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	2	1	0
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.53	29.0	10	7	4
PRT	sp|Q9NP64-2|NO40_HUMAN	Isoform 2 of Nucleolar protein of 40 kDa OS=Homo sapiens OX=9606 GN=ZCCHC17	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	109-UNIMOD:4	0.20	29.0	4	4	3
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	4	4	4
PRT	sp|Q8IXB1|DJC10_HUMAN	DnaJ homolog subfamily C member 10 OS=Homo sapiens OX=9606 GN=DNAJC10 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	728-UNIMOD:4,735-UNIMOD:4,186-UNIMOD:4	0.22	29.0	16	14	12
PRT	sp|O60343|TBCD4_HUMAN	TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9UII2|ATIF1_HUMAN	ATPase inhibitor, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5IF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.11	29.0	2	1	0
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	337-UNIMOD:4,339-UNIMOD:4	0.25	29.0	10	7	4
PRT	sp|P39019|RS19_HUMAN	40S ribosomal protein S19 OS=Homo sapiens OX=9606 GN=RPS19 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.70	29.0	16	13	10
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	135-UNIMOD:4,137-UNIMOD:4,149-UNIMOD:4	0.31	29.0	6	5	4
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	54-UNIMOD:4	0.47	29.0	3	3	3
PRT	sp|P60891|PRPS1_HUMAN	Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	165-UNIMOD:4	0.18	29.0	5	4	3
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	1306-UNIMOD:4	0.08	29.0	10	10	10
PRT	sp|Q16587-5|ZNF74_HUMAN	Isoform 5 of Zinc finger protein 74 OS=Homo sapiens OX=9606 GN=ZNF74	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.17	29.0	2	2	2
PRT	sp|Q96CN9|GCC1_HUMAN	GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	87-UNIMOD:4,460-UNIMOD:4	0.19	29.0	10	9	8
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	2-UNIMOD:1,172-UNIMOD:4,66-UNIMOD:4	0.26	29.0	4	4	4
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.22	29.0	4	3	2
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	2	2	2
PRT	sp|O75940|SPF30_HUMAN	Survival of motor neuron-related-splicing factor 30 OS=Homo sapiens OX=9606 GN=SMNDC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null	214-UNIMOD:4	0.26	29.0	3	3	3
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q9UJC3|HOOK1_HUMAN	Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	432-UNIMOD:385,432-UNIMOD:4,652-UNIMOD:4	0.16	29.0	9	9	5
PRT	sp|Q6DCA0|AMERL_HUMAN	AMMECR1-like protein OS=Homo sapiens OX=9606 GN=AMMECR1L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	153-UNIMOD:4	0.18	29.0	4	4	4
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null		0.27	29.0	6	4	2
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	439-UNIMOD:4	0.08	29.0	3	3	3
PRT	sp|P51610|HCFC1_HUMAN	Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|O95684|CEP43_HUMAN	Centrosomal protein 43 OS=Homo sapiens OX=9606 GN=CEP43 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	null		0.06	29.0	1	1	0
PRT	sp|Q9BQS8|FYCO1_HUMAN	FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.32	28.0	4	4	4
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	127-UNIMOD:4	0.19	28.0	4	4	2
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	296-UNIMOD:4	0.28	28.0	16	16	16
PRT	sp|P17812|PYRG1_HUMAN	CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	216-UNIMOD:4,299-UNIMOD:4,176-UNIMOD:4,362-UNIMOD:4	0.28	28.0	14	11	8
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P42677|RS27_HUMAN	40S ribosomal protein S27 OS=Homo sapiens OX=9606 GN=RPS27 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	33-UNIMOD:35,77-UNIMOD:4	0.43	28.0	7	4	2
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9Y3D2|MSRB2_HUMAN	Methionine-R-sulfoxide reductase B2, mitochondrial OS=Homo sapiens OX=9606 GN=MSRB2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	45-UNIMOD:4	0.38	28.0	4	4	4
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	326-UNIMOD:4	0.11	28.0	3	3	3
PRT	sp|Q13526|PIN1_HUMAN	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 OS=Homo sapiens OX=9606 GN=PIN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.31	28.0	4	3	2
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.21	28.0	9	6	3
PRT	sp|P49674|KC1E_HUMAN	Casein kinase I isoform epsilon OS=Homo sapiens OX=9606 GN=CSNK1E PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	3	2	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|Q70Z53-2|F10C1_HUMAN	Isoform 2 of Protein FRA10AC1 OS=Homo sapiens OX=9606 GN=FRA10AC1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	211-UNIMOD:4,214-UNIMOD:4	0.14	28.0	3	3	3
PRT	sp|Q15366-4|PCBP2_HUMAN	Isoform 4 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null	109-UNIMOD:4	0.22	28.0	5	4	3
PRT	sp|P56270-2|MAZ_HUMAN	Isoform 2 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	309-UNIMOD:4,312-UNIMOD:4,421-UNIMOD:4,424-UNIMOD:4,281-UNIMOD:4,284-UNIMOD:4,394-UNIMOD:4,397-UNIMOD:4,371-UNIMOD:4	0.20	28.0	13	9	5
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.34	28.0	6	4	2
PRT	sp|Q14247-3|SRC8_HUMAN	Isoform 3 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	4	4	3
PRT	sp|P31689-2|DNJA1_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.18	28.0	4	4	3
PRT	sp|P28070|PSB4_HUMAN	Proteasome subunit beta type-4 OS=Homo sapiens OX=9606 GN=PSMB4 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.19	28.0	3	3	3
PRT	sp|Q04837|SSBP_HUMAN	Single-stranded DNA-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=SSBP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.11	28.0	1	1	1
PRT	sp|Q04726-3|TLE3_HUMAN	Isoform 3 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P35080-2|PROF2_HUMAN	Isoform IIb of Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.11	28.0	1	1	0
PRT	sp|O94903|PLPHP_HUMAN	Pyridoxal phosphate homeostasis protein OS=Homo sapiens OX=9606 GN=PLPBP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	86-UNIMOD:4	0.29	28.0	9	7	5
PRT	sp|O15042|SR140_HUMAN	U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	65-UNIMOD:4,624-UNIMOD:4,2-UNIMOD:1,320-UNIMOD:4	0.29	28.0	27	22	17
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) endonuclease OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|Q14331|FRG1_HUMAN	Protein FRG1 OS=Homo sapiens OX=9606 GN=FRG1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	159-UNIMOD:4,205-UNIMOD:4	0.30	28.0	10	8	6
PRT	sp|Q14498|RBM39_HUMAN	RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	null	282-UNIMOD:35	0.05	28.0	3	2	0
PRT	sp|P62633-4|CNBP_HUMAN	Isoform 4 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	null	120-UNIMOD:385,120-UNIMOD:4,123-UNIMOD:4,141-UNIMOD:385,141-UNIMOD:4,151-UNIMOD:4,57-UNIMOD:385,57-UNIMOD:4,162-UNIMOD:385,162-UNIMOD:4	0.26	28.0	4	4	0
PRT	sp|Q96HS1|PGAM5_HUMAN	Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q9NPA8|ENY2_HUMAN	Transcription and mRNA export factor ENY2 OS=Homo sapiens OX=9606 GN=ENY2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	null		0.18	28.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	505-UNIMOD:4,533-UNIMOD:4,2-UNIMOD:1	0.21	27.0	9	7	5
PRT	sp|Q9BY42|RTF2_HUMAN	Replication termination factor 2 OS=Homo sapiens OX=9606 GN=RTF2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.11	27.0	3	2	1
PRT	sp|Q9NQ29-2|LUC7L_HUMAN	Isoform 2 of Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P83731|RL24_HUMAN	60S ribosomal protein L24 OS=Homo sapiens OX=9606 GN=RPL24 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P62913|RL11_HUMAN	60S ribosomal protein L11 OS=Homo sapiens OX=9606 GN=RPL11 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,72-UNIMOD:4,21-UNIMOD:4,25-UNIMOD:4	0.49	27.0	12	8	4
PRT	sp|Q6P087|RUSD3_HUMAN	Mitochondrial mRNA pseudouridine synthase RPUSD3 OS=Homo sapiens OX=9606 GN=RPUSD3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	172-UNIMOD:4,147-UNIMOD:4	0.25	27.0	6	5	4
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	115-UNIMOD:4,115-UNIMOD:385	0.41	27.0	8	4	3
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,7-UNIMOD:4	0.34	27.0	2	2	2
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	131-UNIMOD:4,116-UNIMOD:4,60-UNIMOD:385,60-UNIMOD:4,109-UNIMOD:35,2-UNIMOD:1	0.56	27.0	14	9	5
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,17-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.19	27.0	2	2	2
PRT	sp|O43482|MS18B_HUMAN	Protein Mis18-beta OS=Homo sapiens OX=9606 GN=OIP5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	2-UNIMOD:1,8-UNIMOD:4	0.11	27.0	2	2	2
PRT	sp|P35659|DEK_HUMAN	Protein DEK OS=Homo sapiens OX=9606 GN=DEK PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	161-UNIMOD:4	0.26	27.0	10	8	6
PRT	sp|P80297|MT1X_HUMAN	Metallothionein-1X OS=Homo sapiens OX=9606 GN=MT1X PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:1,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:4,36-UNIMOD:4,37-UNIMOD:4,41-UNIMOD:4,44-UNIMOD:4,48-UNIMOD:4,50-UNIMOD:4	0.69	27.0	3	3	3
PRT	sp|Q69YN2-3|C19L1_HUMAN	Isoform 3 of CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	0
PRT	sp|Q04726|TLE3_HUMAN	Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	623-UNIMOD:4,528-UNIMOD:4,26-UNIMOD:4	0.22	27.0	18	12	7
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	4	3	2
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.11	27.0	4	3	2
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	74-UNIMOD:4	0.23	27.0	9	4	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	312-UNIMOD:4	0.03	27.0	2	1	0
PRT	sp|Q9UHD2|TBK1_HUMAN	Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.11	27.0	7	5	4
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	85-UNIMOD:4,92-UNIMOD:4	0.27	27.0	11	10	9
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.18	27.0	2	2	2
PRT	sp|P49458|SRP09_HUMAN	Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	null	48-UNIMOD:4,39-UNIMOD:4	0.49	27.0	4	4	4
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	567-UNIMOD:4,781-UNIMOD:35	0.14	27.0	10	9	8
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	null		0.15	27.0	4	4	1
PRT	sp|P40227|TCPZ_HUMAN	T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	406-UNIMOD:4	0.11	27.0	4	4	4
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	47-UNIMOD:4	0.20	27.0	5	3	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.29	26.0	6	6	6
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	540-UNIMOD:4	0.09	26.0	5	4	3
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	2-UNIMOD:1,360-UNIMOD:4	0.05	26.0	4	4	4
PRT	sp|Q86YT6|MIB1_HUMAN	E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	834-UNIMOD:4,840-UNIMOD:4,843-UNIMOD:4,780-UNIMOD:4,786-UNIMOD:4,963-UNIMOD:4,966-UNIMOD:4	0.09	26.0	6	6	6
PRT	sp|P04183|KITH_HUMAN	Thymidine kinase, cytosolic OS=Homo sapiens OX=9606 GN=TK1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	185-UNIMOD:4,66-UNIMOD:4	0.12	26.0	2	2	2
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	81-UNIMOD:4,162-UNIMOD:4,135-UNIMOD:4	0.32	26.0	6	5	4
PRT	sp|O14654|IRS4_HUMAN	Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	6	5	4
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.18	26.0	2	2	2
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	58-UNIMOD:4	0.22	26.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	2	2	2
PRT	sp|Q9NSV4-1|DIAP3_HUMAN	Isoform 1 of Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	417-UNIMOD:4	0.05	26.0	3	3	3
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.23	26.0	7	7	4
PRT	sp|P63092|GNAS2_HUMAN	Guanine nucleotide-binding protein G(s) subunit alpha isoforms short OS=Homo sapiens OX=9606 GN=GNAS PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.12	26.0	3	3	3
PRT	sp|P61247|RS3A_HUMAN	40S ribosomal protein S3a OS=Homo sapiens OX=9606 GN=RPS3A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	96-UNIMOD:4,201-UNIMOD:4,139-UNIMOD:4	0.48	26.0	12	11	10
PRT	sp|Q9NVI7-2|ATD3A_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.22	26.0	9	9	8
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	37-UNIMOD:35,73-UNIMOD:4	0.54	26.0	13	6	3
PRT	sp|Q9Y314|NOSIP_HUMAN	Nitric oxide synthase-interacting protein OS=Homo sapiens OX=9606 GN=NOSIP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	185-UNIMOD:4	0.10	26.0	2	2	2
PRT	sp|O14578-4|CTRO_HUMAN	Isoform 4 of Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	8	8	8
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P36969-2|GPX4_HUMAN	Isoform Cytoplasmic of Phospholipid hydroperoxide glutathione peroxidase OS=Homo sapiens OX=9606 GN=GPX4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	75-UNIMOD:4	0.35	26.0	4	4	4
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	181-UNIMOD:4	0.05	26.0	4	4	3
PRT	sp|P55769|NH2L1_HUMAN	NHP2-like protein 1 OS=Homo sapiens OX=9606 GN=SNU13 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	30-UNIMOD:4,2-UNIMOD:1	0.27	26.0	3	3	3
PRT	sp|P42167-2|LAP2B_HUMAN	Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.09	26.0	2	2	2
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	3	3	3
PRT	sp|Q8N5F7|NKAP_HUMAN	NF-kappa-B-activating protein OS=Homo sapiens OX=9606 GN=NKAP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.14	26.0	3	3	3
PRT	sp|Q9BU76-4|MMTA2_HUMAN	Isoform 4 of Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	58-UNIMOD:4	0.45	26.0	6	6	5
PRT	sp|Q96GJ1-3|TRM2_HUMAN	Isoform 3 of tRNA (uracil(54)-C(5))-methyltransferase homolog OS=Homo sapiens OX=9606 GN=TRMT2B	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9HC38-2|GLOD4_HUMAN	Isoform 2 of Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	41-UNIMOD:4,45-UNIMOD:4	0.27	26.0	6	6	4
PRT	sp|P22392|NDKB_HUMAN	Nucleoside diphosphate kinase B OS=Homo sapiens OX=9606 GN=NME2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null	90-UNIMOD:35	0.20	26.0	3	2	1
PRT	sp|Q8N8E3|CE112_HUMAN	Centrosomal protein of 112 kDa OS=Homo sapiens OX=9606 GN=CEP112 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	3	2	1
PRT	sp|P46778|RL21_HUMAN	60S ribosomal protein L21 OS=Homo sapiens OX=9606 GN=RPL21 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.16	26.0	2	2	2
PRT	cov|corona03981|ORF1b_Kazakhstan/26548/2020	A1225D	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	2	1	0
PRT	sp|Q99996|AKAP9_HUMAN	A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	1597-UNIMOD:28	0.04	26.0	11	10	2
PRT	cov|corona04460|ORF1b_Brazil/L15_CD282/2020	T1404M	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|Q13509|TBB3_HUMAN	Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	164-UNIMOD:35,354-UNIMOD:4	0.05	26.0	2	2	1
PRT	sp|O00571|DDX3X_HUMAN	ATP-dependent RNA helicase DDX3X OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|Q12923|PTN13_HUMAN	Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.01	26.0	1	1	0
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9BRP1|PDD2L_HUMAN	Programmed cell death protein 2-like OS=Homo sapiens OX=9606 GN=PDCD2L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	49-UNIMOD:4	0.13	26.0	2	2	2
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	3	3	3
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.35	25.0	7	5	4
PRT	sp|P23526|SAHH_HUMAN	Adenosylhomocysteinase OS=Homo sapiens OX=9606 GN=AHCY PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	127-UNIMOD:35,195-UNIMOD:4	0.23	25.0	10	8	6
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	226-UNIMOD:4,233-UNIMOD:4,2-UNIMOD:1	0.31	25.0	8	8	8
PRT	sp|Q86SX6|GLRX5_HUMAN	Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	67-UNIMOD:4	0.22	25.0	2	2	2
PRT	sp|P62249|RS16_HUMAN	40S ribosomal protein S16 OS=Homo sapiens OX=9606 GN=RPS16 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	25-UNIMOD:4,41-UNIMOD:35	0.56	25.0	17	10	4
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	8	6	4
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	2	2
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	3	3	3
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	3	1	0
PRT	sp|Q9UKT4-2|FBX5_HUMAN	Isoform 2 of F-box only protein 5 OS=Homo sapiens OX=9606 GN=FBXO5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	37-UNIMOD:4	0.07	25.0	2	2	2
PRT	sp|Q5VT06|CE350_HUMAN	Centrosome-associated protein 350 OS=Homo sapiens OX=9606 GN=CEP350 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	5	4	3
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.35	25.0	8	7	6
PRT	sp|Q16352|AINX_HUMAN	Alpha-internexin OS=Homo sapiens OX=9606 GN=INA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.12	25.0	6	6	6
PRT	sp|Q8IYB5-3|SMAP1_HUMAN	Isoform 3 of Stromal membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SMAP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9UMS0-2|NFU1_HUMAN	Isoform 2 of NFU1 iron-sulfur cluster scaffold homolog, mitochondrial OS=Homo sapiens OX=9606 GN=NFU1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	69-UNIMOD:4,72-UNIMOD:4	0.15	25.0	1	1	1
PRT	sp|Q9UBV8|PEF1_HUMAN	Peflin OS=Homo sapiens OX=9606 GN=PEF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	3	3	3
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	317-UNIMOD:4,318-UNIMOD:4	0.06	25.0	5	5	5
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	12-UNIMOD:4	0.17	25.0	4	3	2
PRT	sp|Q9Y4X0-3|AMMR1_HUMAN	Isoform 3 of AMME syndrome candidate gene 1 protein OS=Homo sapiens OX=9606 GN=AMMECR1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	3	3	2
PRT	sp|Q6ZUT1-3|NKAP1_HUMAN	Isoform 3 of Uncharacterized protein NKAPD1 OS=Homo sapiens OX=9606 GN=NKAPD1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	1
PRT	sp|P60468|SC61B_HUMAN	Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.17	25.0	1	1	1
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	21-UNIMOD:35	0.41	25.0	7	7	7
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	2	2	2
PRT	sp|Q9NS86|LANC2_HUMAN	LanC-like protein 2 OS=Homo sapiens OX=9606 GN=LANCL2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.12	25.0	1	1	1
PRT	sp|Q9BSD7|NTPCR_HUMAN	Cancer-related nucleoside-triphosphatase OS=Homo sapiens OX=9606 GN=NTPCR PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	184-UNIMOD:4,101-UNIMOD:4	0.33	25.0	5	4	3
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P27816|MAP4_HUMAN	Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	5	5	5
PRT	sp|O60333-3|KIF1B_HUMAN	Isoform 3 of Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null	350-UNIMOD:4	0.02	25.0	2	2	2
PRT	sp|P61956-2|SUMO2_HUMAN	Isoform 2 of Small ubiquitin-related modifier 2 OS=Homo sapiens OX=9606 GN=SUMO2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.18	25.0	1	1	1
PRT	sp|Q5BKY9|F133B_HUMAN	Protein FAM133B OS=Homo sapiens OX=9606 GN=FAM133B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.22	25.0	6	5	4
PRT	sp|P35030-5|TRY3_HUMAN	Isoform 5 of Trypsin-3 OS=Homo sapiens OX=9606 GN=PRSS3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q9UFW8|CGBP1_HUMAN	CGG triplet repeat-binding protein 1 OS=Homo sapiens OX=9606 GN=CGGBP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	85-UNIMOD:28	0.28	25.0	12	9	7
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.52	25.0	12	9	7
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null	1367-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.10	25.0	3	3	1
PRT	sp|Q76N32|CEP68_HUMAN	Centrosomal protein of 68 kDa OS=Homo sapiens OX=9606 GN=CEP68 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.17	25.0	5	3	1
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.08	25.0	4	3	2
PRT	sp|Q6IQ49|SDE2_HUMAN	Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P42575|CASP2_HUMAN	Caspase-2 OS=Homo sapiens OX=9606 GN=CASP2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1	0.03	25.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.14	25.0	2	2	2
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q6P5R6|RL22L_HUMAN	60S ribosomal protein L22-like 1 OS=Homo sapiens OX=9606 GN=RPL22L1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	2	1	0
PRT	sp|O14757|CHK1_HUMAN	Serine/threonine-protein kinase Chk1 OS=Homo sapiens OX=9606 GN=CHEK1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q69YQ0|CYTSA_HUMAN	Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q01105|SET_HUMAN	Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|P78371|TCPB_HUMAN	T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	2-UNIMOD:1	0.18	24.0	7	6	5
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null	339-UNIMOD:4	0.14	24.0	5	4	3
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q8NDD1|CA131_HUMAN	Uncharacterized protein C1orf131 OS=Homo sapiens OX=9606 GN=C1orf131 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	3	3	3
PRT	sp|Q5T9A4|ATD3B_HUMAN	ATPase family AAA domain-containing protein 3B OS=Homo sapiens OX=9606 GN=ATAD3B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	492-UNIMOD:4	0.11	24.0	6	4	2
PRT	sp|P48507|GSH0_HUMAN	Glutamate--cysteine ligase regulatory subunit OS=Homo sapiens OX=9606 GN=GCLM PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:4	0.17	24.0	3	3	3
PRT	sp|Q9BQQ3-2|GORS1_HUMAN	Isoform 2 of Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.19	24.0	5	3	1
PRT	sp|P62277|RS13_HUMAN	40S ribosomal protein S13 OS=Homo sapiens OX=9606 GN=RPS13 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.26	24.0	4	3	2
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.13	24.0	3	3	3
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.14	24.0	3	2	1
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.42	24.0	6	5	3
PRT	sp|P51610-2|HCFC1_HUMAN	Isoform 2 of Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	2	2	2
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q8WXW3|PIBF1_HUMAN	Progesterone-induced-blocking factor 1 OS=Homo sapiens OX=9606 GN=PIBF1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.44	24.0	3	3	3
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q3MHD2|LSM12_HUMAN	Protein LSM12 homolog OS=Homo sapiens OX=9606 GN=LSM12 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	1-UNIMOD:1	0.13	24.0	6	5	4
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	2	2	2
PRT	sp|Q5VTL8|PR38B_HUMAN	Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	113-UNIMOD:4	0.15	24.0	10	8	6
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null		0.15	24.0	8	6	5
PRT	sp|Q9P021|CRIPT_HUMAN	Cysteine-rich PDZ-binding protein OS=Homo sapiens OX=9606 GN=CRIPT PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	73-UNIMOD:4,76-UNIMOD:4	0.31	24.0	4	2	1
PRT	sp|Q86WX3|AROS_HUMAN	Active regulator of SIRT1 OS=Homo sapiens OX=9606 GN=RPS19BP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|P62910|RL32_HUMAN	60S ribosomal protein L32 OS=Homo sapiens OX=9606 GN=RPL32 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	96-UNIMOD:4,91-UNIMOD:4	0.23	24.0	3	3	3
PRT	sp|O00170|AIP_HUMAN	AH receptor-interacting protein OS=Homo sapiens OX=9606 GN=AIP PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	208-UNIMOD:4	0.24	24.0	9	6	3
PRT	sp|P48730|KC1D_HUMAN	Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.21	24.0	5	5	5
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	5	5	5
PRT	sp|P17066|HSP76_HUMAN	Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P05976-2|MYL1_HUMAN	Isoform MLC3 of Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=MYL1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	58-UNIMOD:35	0.32	24.0	5	4	3
PRT	sp|Q92841|DDX17_HUMAN	Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	4	3	0
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	5	5	5
PRT	sp|Q9NP64|NO40_HUMAN	Nucleolar protein of 40 kDa OS=Homo sapiens OX=9606 GN=ZCCHC17 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.15	24.0	3	2	1
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	2	2	1
PRT	sp|P62847|RS24_HUMAN	40S ribosomal protein S24 OS=Homo sapiens OX=9606 GN=RPS24 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	2	1	0
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	8	6	4
PRT	sp|Q9Y4X0|AMMR1_HUMAN	AMME syndrome candidate gene 1 protein OS=Homo sapiens OX=9606 GN=AMMECR1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|P83881|RL36A_HUMAN	60S ribosomal protein L36a OS=Homo sapiens OX=9606 GN=RPL36A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:4,77-UNIMOD:4,88-UNIMOD:4	0.43	24.0	7	5	3
PRT	sp|Q9BQ69|MACD1_HUMAN	ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	cov|corona04765|ORF1b_France/OCC-31/2020	D870Y,E1242A,P314L	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	null	1232-UNIMOD:4,1241-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	23.0	null	266-UNIMOD:4,2-UNIMOD:1	0.15	23.0	5	4	3
PRT	sp|P62854|RS26_HUMAN	40S ribosomal protein S26 OS=Homo sapiens OX=9606 GN=RPS26 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.21	23.0	2	2	2
PRT	sp|P30048-2|PRDX3_HUMAN	Isoform 2 of Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.21	23.0	4	4	3
PRT	sp|Q9BRS2|RIOK1_HUMAN	Serine/threonine-protein kinase RIO1 OS=Homo sapiens OX=9606 GN=RIOK1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O43837|IDH3B_HUMAN	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.14	23.0	5	4	3
PRT	sp|P62273|RS29_HUMAN	40S ribosomal protein S29 OS=Homo sapiens OX=9606 GN=RPS29 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:4	0.66	23.0	5	4	3
PRT	sp|Q9Y2S6|TMA7_HUMAN	Translation machinery-associated protein 7 OS=Homo sapiens OX=9606 GN=TMA7 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	22-UNIMOD:35	0.34	23.0	6	3	1
PRT	sp|P57060|RWD2B_HUMAN	RWD domain-containing protein 2B OS=Homo sapiens OX=9606 GN=RWDD2B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q92686|NEUG_HUMAN	Neurogranin OS=Homo sapiens OX=9606 GN=NRGN PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.21	23.0	1	1	1
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.12	23.0	2	2	2
PRT	sp|Q66GS9|CP135_HUMAN	Centrosomal protein of 135 kDa OS=Homo sapiens OX=9606 GN=CEP135 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:4	0.07	23.0	7	6	5
PRT	sp|Q9BRJ7|TIRR_HUMAN	Tudor-interacting repair regulator protein OS=Homo sapiens OX=9606 GN=NUDT16L1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	171-UNIMOD:4	0.32	23.0	5	5	5
PRT	sp|Q96AG4|LRC59_HUMAN	Leucine-rich repeat-containing protein 59 OS=Homo sapiens OX=9606 GN=LRRC59 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	1-UNIMOD:1	0.10	23.0	2	2	2
PRT	sp|P63208|SKP1_HUMAN	S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9Y508-2|RN114_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	91-UNIMOD:4,94-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q59GN2|R39L5_HUMAN	Putative 60S ribosomal protein L39-like 5 OS=Homo sapiens OX=9606 GN=RPL39P5 PE=5 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.22	23.0	1	1	1
PRT	sp|Q12923-3|PTN13_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	7	7	6
PRT	sp|Q5TZA2|CROCC_HUMAN	Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	3	3	3
PRT	sp|Q9Y3E2|BOLA1_HUMAN	BolA-like protein 1 OS=Homo sapiens OX=9606 GN=BOLA1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|Q9P016|THYN1_HUMAN	Thymocyte nuclear protein 1 OS=Homo sapiens OX=9606 GN=THYN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.19	23.0	5	4	3
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q3ZCQ8-3|TIM50_HUMAN	Isoform 3 of Mitochondrial import inner membrane translocase subunit TIM50 OS=Homo sapiens OX=9606 GN=TIMM50	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|P63241|IF5A1_HUMAN	Eukaryotic translation initiation factor 5A-1 OS=Homo sapiens OX=9606 GN=EIF5A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null	2-UNIMOD:1,22-UNIMOD:4	0.31	23.0	4	3	2
PRT	sp|Q9BW19|KIFC1_HUMAN	Kinesin-like protein KIFC1 OS=Homo sapiens OX=9606 GN=KIFC1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null	306-UNIMOD:4,381-UNIMOD:35,87-UNIMOD:35	0.14	23.0	7	6	0
PRT	sp|O14578|CTRO_HUMAN	Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	2	2	2
PRT	sp|Q15637|SF01_HUMAN	Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	2	2	2
PRT	sp|Q00535|CDK5_HUMAN	Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null		0.16	23.0	3	3	3
PRT	sp|Q06124|PTN11_HUMAN	Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P53384|NUBP1_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens OX=9606 GN=NUBP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null	31-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|P23025|XPA_HUMAN	DNA repair protein complementing XP-A cells OS=Homo sapiens OX=9606 GN=XPA PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.09	23.0	1	1	1
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P20719|HXA5_HUMAN	Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q92995|UBP13_HUMAN	Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens OX=9606 GN=USP13 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	0
PRT	sp|Q02978|M2OM_HUMAN	Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.05	22.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1.10 OS=Homo sapiens OX=9606 GN=H1-10 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	2-UNIMOD:1	0.15	22.0	2	2	2
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=H2BC13 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	60-UNIMOD:35	0.38	22.0	7	5	4
PRT	sp|Q9NYP9|MS18A_HUMAN	Protein Mis18-alpha OS=Homo sapiens OX=9606 GN=MIS18A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	85-UNIMOD:4,88-UNIMOD:4,25-UNIMOD:4,107-UNIMOD:4	0.29	22.0	4	4	4
PRT	sp|Q13642-1|FHL1_HUMAN	Isoform 1 of Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	71-UNIMOD:4	0.10	22.0	2	2	2
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=H4C1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.31	22.0	3	3	3
PRT	sp|Q96EI5|TCAL4_HUMAN	Transcription elongation factor A protein-like 4 OS=Homo sapiens OX=9606 GN=TCEAL4 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.16	22.0	3	3	3
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.08	22.0	4	4	4
PRT	sp|P31153-2|METK2_HUMAN	Isoform 2 of S-adenosylmethionine synthase isoform type-2 OS=Homo sapiens OX=9606 GN=MAT2A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P62861|RS30_HUMAN	40S ribosomal protein S30 OS=Homo sapiens OX=9606 GN=FAU PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.37	22.0	6	4	2
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q15363|TMED2_HUMAN	Transmembrane emp24 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TMED2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.19	22.0	2	2	2
PRT	sp|Q07666|KHDR1_HUMAN	KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens OX=9606 GN=KHDRBS1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	2	2	2
PRT	sp|P46781|RS9_HUMAN	40S ribosomal protein S9 OS=Homo sapiens OX=9606 GN=RPS9 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.13	22.0	3	2	1
PRT	sp|Q96SN8-2|CK5P2_HUMAN	Isoform 2 of CDK5 regulatory subunit-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK5RAP2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9NXE8|CWC25_HUMAN	Pre-mRNA-splicing factor CWC25 homolog OS=Homo sapiens OX=9606 GN=CWC25 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null		0.10	22.0	4	4	4
PRT	sp|Q14444-2|CAPR1_HUMAN	Isoform 2 of Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	1-UNIMOD:1	0.34	22.0	3	3	3
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|Q04727-4|TLE4_HUMAN	Isoform 4 of Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	0
PRT	sp|P54886-2|P5CS_HUMAN	Isoform Short of Delta-1-pyrroline-5-carboxylate synthase OS=Homo sapiens OX=9606 GN=ALDH18A1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	88-UNIMOD:4	0.07	22.0	5	5	5
PRT	sp|O75223|GGCT_HUMAN	Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.18	22.0	4	4	4
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	106-UNIMOD:4,206-UNIMOD:4	0.12	22.0	2	2	2
PRT	sp|P53350|PLK1_HUMAN	Serine/threonine-protein kinase PLK1 OS=Homo sapiens OX=9606 GN=PLK1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null	212-UNIMOD:4,544-UNIMOD:4	0.11	22.0	4	4	4
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	1889-UNIMOD:4,736-UNIMOD:4,2-UNIMOD:1,1374-UNIMOD:4	0.12	22.0	18	18	18
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O75380|NDUS6_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	1	1	1
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null	36-UNIMOD:35	0.06	22.0	1	1	0
PRT	sp|P18621|RL17_HUMAN	60S ribosomal protein L17 OS=Homo sapiens OX=9606 GN=RPL17 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.17	22.0	2	2	0
PRT	sp|P33992|MCM5_HUMAN	DNA replication licensing factor MCM5 OS=Homo sapiens OX=9606 GN=MCM5 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	207-UNIMOD:4	0.10	22.0	6	6	6
PRT	sp|Q71UM5|RS27L_HUMAN	40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	33-UNIMOD:35	0.31	22.0	2	2	1
PRT	sp|Q9Y285|SYFA_HUMAN	Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	0
PRT	sp|Q9BQ48|RM34_HUMAN	39S ribosomal protein L34, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL34 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null		0.14	22.0	3	1	0
PRT	sp|Q15417|CNN3_HUMAN	Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	null	219-UNIMOD:35	0.09	22.0	3	2	0
PRT	sp|P41223|BUD31_HUMAN	Protein BUD31 homolog OS=Homo sapiens OX=9606 GN=BUD31 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	101-UNIMOD:4,102-UNIMOD:4,117-UNIMOD:4,119-UNIMOD:4,134-UNIMOD:4,137-UNIMOD:4,139-UNIMOD:4	0.38	22.0	5	4	3
PRT	sp|Q9Y5V0|ZN706_HUMAN	Zinc finger protein 706 OS=Homo sapiens OX=9606 GN=ZNF706 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	41-UNIMOD:4,44-UNIMOD:4	0.33	21.0	2	2	2
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	257-UNIMOD:4	0.28	21.0	10	8	6
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	3	3	3
PRT	sp|Q96CP2|FWCH2_HUMAN	FLYWCH family member 2 OS=Homo sapiens OX=9606 GN=FLYWCH2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.34	21.0	3	3	3
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	4	3	2
PRT	sp|P47914|RL29_HUMAN	60S ribosomal protein L29 OS=Homo sapiens OX=9606 GN=RPL29 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	2	1	0
PRT	sp|P82912-2|RT11_HUMAN	Isoform 2 of 28S ribosomal protein S11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS11	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	111-UNIMOD:4	0.16	21.0	2	1	0
PRT	sp|Q9NXU5|ARL15_HUMAN	ADP-ribosylation factor-like protein 15 OS=Homo sapiens OX=9606 GN=ARL15 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q99439-2|CNN2_HUMAN	Isoform 2 of Calponin-2 OS=Homo sapiens OX=9606 GN=CNN2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	136-UNIMOD:4,176-UNIMOD:4	0.10	21.0	2	2	2
PRT	sp|Q96GX9|MTNB_HUMAN	Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	16-UNIMOD:4	0.11	21.0	2	2	2
PRT	sp|Q8NAV1|PR38A_HUMAN	Pre-mRNA-splicing factor 38A OS=Homo sapiens OX=9606 GN=PRPF38A PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	1	1	1
PRT	sp|Q9BQ61|TRIR_HUMAN	Telomerase RNA component interacting RNase OS=Homo sapiens OX=9606 GN=TRIR PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.14	21.0	2	2	2
PRT	sp|P02533|K1C14_HUMAN	Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	3	3	3
PRT	sp|Q969Q0|RL36L_HUMAN	60S ribosomal protein L36a-like OS=Homo sapiens OX=9606 GN=RPL36AL PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.10	21.0	3	1	0
PRT	sp|P62306|RUXF_HUMAN	Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.16	21.0	1	1	1
PRT	sp|P15170-2|ERF3A_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	3	2	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	175-UNIMOD:4	0.07	21.0	3	3	3
PRT	sp|O00541-2|PESC_HUMAN	Isoform 2 of Pescadillo homolog OS=Homo sapiens OX=9606 GN=PES1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.05	21.0	2	2	2
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null		0.24	21.0	5	5	5
PRT	sp|Q9NSD9|SYFB_HUMAN	Phenylalanine--tRNA ligase beta subunit OS=Homo sapiens OX=9606 GN=FARSB PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	297-UNIMOD:4	0.19	21.0	5	5	5
PRT	sp|Q8IWQ3-3|BRSK2_HUMAN	Isoform 3 of Serine/threonine-protein kinase BRSK2 OS=Homo sapiens OX=9606 GN=BRSK2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	3	3	2
PRT	sp|Q9BWE0|REPI1_HUMAN	Replication initiator 1 OS=Homo sapiens OX=9606 GN=REPIN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	2	2	2
PRT	sp|Q9Y5Y2|NUBP2_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	1-UNIMOD:1	0.13	21.0	4	3	2
PRT	sp|Q9UNQ2|DIM1_HUMAN	Probable dimethyladenosine transferase OS=Homo sapiens OX=9606 GN=DIMT1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|P41240|CSK_HUMAN	Tyrosine-protein kinase CSK OS=Homo sapiens OX=9606 GN=CSK PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96HS1-2|PGAM5_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens OX=9606 GN=PGAM5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	168-UNIMOD:4	0.29	21.0	8	8	8
PRT	sp|Q99661-2|KIF2C_HUMAN	Isoform 2 of Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	2	2	2
PRT	sp|P21912|SDHB_HUMAN	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHB PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q6FI81|CPIN1_HUMAN	Anamorsin OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	274-UNIMOD:4,277-UNIMOD:4	0.09	21.0	2	2	2
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	96-UNIMOD:4,208-UNIMOD:4	0.12	21.0	5	4	3
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q14168-5|MPP2_HUMAN	Isoform 5 of MAGUK p55 subfamily member 2 OS=Homo sapiens OX=9606 GN=MPP2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	2	2	2
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	157-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P21741|MK_HUMAN	Midkine OS=Homo sapiens OX=9606 GN=MDK PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null	116-UNIMOD:4,61-UNIMOD:4	0.15	21.0	2	2	2
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	3	3	3
PRT	sp|B2RPK0|HGB1A_HUMAN	Putative high mobility group protein B1-like 1 OS=Homo sapiens OX=9606 GN=HMGB1P1 PE=5 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null	13-UNIMOD:35,23-UNIMOD:4	0.06	21.0	1	1	0
PRT	sp|P52272|HNRPM_HUMAN	Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.05	21.0	2	2	1
PRT	sp|Q9HC38|GLOD4_HUMAN	Glyoxalase domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GLOD4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.11	21.0	2	2	0
PRT	sp|Q01844|EWS_HUMAN	RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	null		0.04	21.0	1	1	0
PRT	sp|O95372|LYPA2_HUMAN	Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null	213-UNIMOD:4	0.12	21.0	2	2	2
PRT	sp|P55081|MFAP1_HUMAN	Microfibrillar-associated protein 1 OS=Homo sapiens OX=9606 GN=MFAP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	2	2	2
PRT	sp|P67809|YBOX1_HUMAN	Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q2TBE0|C19L2_HUMAN	CWF19-like protein 2 OS=Homo sapiens OX=9606 GN=CWF19L2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q86U06|RBM23_HUMAN	Probable RNA-binding protein 23 OS=Homo sapiens OX=9606 GN=RBM23 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	2	2	2
PRT	sp|Q9Y676|RT18B_HUMAN	28S ribosomal protein S18b, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS18B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	0
PRT	sp|Q9BRX2|PELO_HUMAN	Protein pelota homolog OS=Homo sapiens OX=9606 GN=PELO PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	258-UNIMOD:4	0.14	20.0	6	5	4
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null	71-UNIMOD:4	0.07	20.0	2	2	2
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.09	20.0	3	2	1
PRT	sp|Q5VTB9-3|RN220_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF220 OS=Homo sapiens OX=9606 GN=RNF220	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9BVA1|TBB2B_HUMAN	Tubulin beta-2B chain OS=Homo sapiens OX=9606 GN=TUBB2B PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null	127-UNIMOD:4,129-UNIMOD:4	0.10	20.0	3	2	1
PRT	sp|Q6ZWJ1|STXB4_HUMAN	Syntaxin-binding protein 4 OS=Homo sapiens OX=9606 GN=STXBP4 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q9NUI1|DECR2_HUMAN	Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P14174|MIF_HUMAN	Macrophage migration inhibitory factor OS=Homo sapiens OX=9606 GN=MIF PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null	81-UNIMOD:4	0.19	20.0	2	2	2
PRT	sp|P19087|GNAT2_HUMAN	Guanine nucleotide-binding protein G(t) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAT2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q16763|UBE2S_HUMAN	Ubiquitin-conjugating enzyme E2 S OS=Homo sapiens OX=9606 GN=UBE2S PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	1	1	1
PRT	sp|Q6NTE8-2|MRNIP_HUMAN	Isoform 2 of MRN complex-interacting protein OS=Homo sapiens OX=9606 GN=MRNIP	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.06	20.0	1	1	1
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9NRW3|ABC3C_HUMAN	DNA dC->dU-editing enzyme APOBEC-3C OS=Homo sapiens OX=9606 GN=APOBEC3C PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null	65-UNIMOD:4	0.07	20.0	1	1	1
PRT	sp|Q15276-2|RABE1_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q9NQ88|TIGAR_HUMAN	Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q99496|RING2_HUMAN	E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null	394-UNIMOD:4	0.06	20.0	3	3	3
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null	230-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|A0A0U1RRE5|NBDY_HUMAN	Negative regulator of P-body association OS=Homo sapiens OX=9606 GN=NBDY PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.41	20.0	1	1	1
PRT	sp|Q9UG63|ABCF2_HUMAN	ATP-binding cassette sub-family F member 2 OS=Homo sapiens OX=9606 GN=ABCF2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	2	2	2
PRT	cov|corona00646|ORF1b_Japan/Donner20/2020	P1000T	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null	1007-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P17661|DESM_HUMAN	Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|O15083|ERC2_HUMAN	ERC protein 2 OS=Homo sapiens OX=9606 GN=ERC2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.01	20.0	1	1	0
PRT	sp|Q9NVI7|ATD3A_HUMAN	ATPase family AAA domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ATAD3A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q8NC51|PAIRB_HUMAN	Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.06	20.0	3	2	0
PRT	sp|P0DME0|SETLP_HUMAN	Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	0
PRT	sp|P33316|DUT_HUMAN	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.14	20.0	4	3	1
PRT	sp|P33778|H2B1B_HUMAN	Histone H2B type 1-B OS=Homo sapiens OX=9606 GN=H2BC3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null	63-UNIMOD:35	0.21	20.0	2	2	0
PRT	sp|P31689|DNJA1_HUMAN	DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.08	20.0	2	2	1
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.19	20.0	4	4	4
PRT	sp|Q9Y388|RBMX2_HUMAN	RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.07	20.0	3	2	1
PRT	sp|Q9BYE2|TMPSD_HUMAN	Transmembrane protease serine 13 OS=Homo sapiens OX=9606 GN=TMPRSS13 PE=2 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|O75340|PDCD6_HUMAN	Programmed cell death protein 6 OS=Homo sapiens OX=9606 GN=PDCD6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null		0.13	20.0	2	2	2
PRT	sp|P04908|H2A1B_HUMAN	Histone H2A type 1-B/E OS=Homo sapiens OX=9606 GN=H2AC4 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.15	20.0	1	1	1
PRT	sp|Q15276|RABE1_HUMAN	Rab GTPase-binding effector protein 1 OS=Homo sapiens OX=9606 GN=RABEP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q8TBY8|PMFBP_HUMAN	Polyamine-modulated factor 1-binding protein 1 OS=Homo sapiens OX=9606 GN=PMFBP1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null	741-UNIMOD:4	0.02	20.0	3	1	0
PRT	sp|Q96LB3|IFT74_HUMAN	Intraflagellar transport protein 74 homolog OS=Homo sapiens OX=9606 GN=IFT74 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q76N32-2|CEP68_HUMAN	Isoform 2 of Centrosomal protein of 68 kDa OS=Homo sapiens OX=9606 GN=CEP68	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	357-UNIMOD:4	0.07	19.0	3	3	3
PRT	sp|Q96T17-5|MA7D2_HUMAN	Isoform 5 of MAP7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAP7D2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	420-UNIMOD:4	0.11	19.0	3	3	2
PRT	sp|Q9GZT9|EGLN1_HUMAN	Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	2	1	0
PRT	sp|Q9NWT1|PK1IP_HUMAN	p21-activated protein kinase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAK1IP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|O00483|NDUA4_HUMAN	Cytochrome c oxidase subunit NDUFA4 OS=Homo sapiens OX=9606 GN=NDUFA4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.14	19.0	1	1	1
PRT	sp|Q9H7C9|AAMDC_HUMAN	Mth938 domain-containing protein OS=Homo sapiens OX=9606 GN=AAMDC PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	2	1	0
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=H2AC14 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.06	19.0	1	1	1
PRT	sp|Q08117|TLE5_HUMAN	TLE family member 5 OS=Homo sapiens OX=9606 GN=TLE5 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	2	2	2
PRT	sp|P48643|TCPE_HUMAN	T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	3	3	3
PRT	sp|P39748|FEN1_HUMAN	Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	2	2	2
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS1 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	2	2	2
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	228-UNIMOD:4	0.12	19.0	2	2	2
PRT	sp|Q9BY77-2|PDIP3_HUMAN	Isoform 2 of Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null		0.12	19.0	4	2	1
PRT	sp|Q92576-2|PHF3_HUMAN	Isoform 2 of PHD finger protein 3 OS=Homo sapiens OX=9606 GN=PHF3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	1621-UNIMOD:4	0.01	19.0	2	2	2
PRT	sp|P31040-3|SDHA_HUMAN	Isoform 3 of Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens OX=9606 GN=SDHA	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	391-UNIMOD:4	0.04	19.0	2	2	2
PRT	sp|Q00013|EM55_HUMAN	55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q5HYJ3|FA76B_HUMAN	Protein FAM76B OS=Homo sapiens OX=9606 GN=FAM76B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P42766|RL35_HUMAN	60S ribosomal protein L35 OS=Homo sapiens OX=9606 GN=RPL35 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null		0.09	19.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	1035-UNIMOD:4	0.02	19.0	2	2	2
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	334-UNIMOD:4	0.06	19.0	2	2	1
PRT	sp|Q06124-1|PTN11_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	null	104-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P41219|PERI_HUMAN	Peripherin OS=Homo sapiens OX=9606 GN=PRPH PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	1
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null	242-UNIMOD:4,81-UNIMOD:35,82-UNIMOD:4,85-UNIMOD:4,87-UNIMOD:4,94-UNIMOD:4	0.17	19.0	4	4	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	2	2	2
PRT	sp|Q04727|TLE4_HUMAN	Transducin-like enhancer protein 4 OS=Homo sapiens OX=9606 GN=TLE4 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.01	19.0	1	1	0
PRT	sp|P56270|MAZ_HUMAN	Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null	421-UNIMOD:4,424-UNIMOD:4	0.03	19.0	1	1	0
PRT	sp|Q58FF8|H90B2_HUMAN	Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens OX=9606 GN=HSP90AB2P PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	0
PRT	sp|Q8WWM7|ATX2L_HUMAN	Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	2	1	0
PRT	sp|P46779|RL28_HUMAN	60S ribosomal protein L28 OS=Homo sapiens OX=9606 GN=RPL28 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	19.0	null	13-UNIMOD:4	0.16	19.0	4	3	2
PRT	sp|P82921|RT21_HUMAN	28S ribosomal protein S21, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS21 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	19.0	null		0.32	19.0	2	2	2
PRT	sp|Q00059|TFAM_HUMAN	Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q9NYK5|RM39_HUMAN	39S ribosomal protein L39, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL39 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.04	19.0	1	1	1
PRT	sp|Q9Y230|RUVB2_HUMAN	RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null		0.05	19.0	1	1	1
PRT	sp|Q16775|GLO2_HUMAN	Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	null	219-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q6PJ69|TRI65_HUMAN	Tripartite motif-containing protein 65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	2-UNIMOD:1	0.02	18.0	1	1	1
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	225-UNIMOD:4	0.03	18.0	1	1	1
PRT	sp|O14556|G3PT_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Homo sapiens OX=9606 GN=GAPDHS PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|Q14807-2|KIF22_HUMAN	Isoform 2 of Kinesin-like protein KIF22 OS=Homo sapiens OX=9606 GN=KIF22	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	0
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	2	2	2
PRT	sp|P0DPB5|RPC22_HUMAN	Protein POLR1D, isoform 2 OS=Homo sapiens OX=9606 GN=POLR1D PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	37-UNIMOD:4	0.08	18.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null		0.33	18.0	3	2	1
PRT	sp|Q8N257|H2B3B_HUMAN	Histone H2B type 3-B OS=Homo sapiens OX=9606 GN=H2BU1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	0
PRT	sp|P51571|SSRD_HUMAN	Translocon-associated protein subunit delta OS=Homo sapiens OX=9606 GN=SSR4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|Q00325-2|MPCP_HUMAN	Isoform B of Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	2	2	2
PRT	sp|P62993-2|GRB2_HUMAN	Isoform 2 of Growth factor receptor-bound protein 2 OS=Homo sapiens OX=9606 GN=GRB2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P07196|NFL_HUMAN	Neurofilament light polypeptide OS=Homo sapiens OX=9606 GN=NEFL PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	2	2	2
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q5MNZ6|WIPI3_HUMAN	WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens OX=9606 GN=WDR45B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	38-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|O75828|CBR3_HUMAN	Carbonyl reductase [NADPH] 3 OS=Homo sapiens OX=9606 GN=CBR3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q9Y3C8|UFC1_HUMAN	Ubiquitin-fold modifier-conjugating enzyme 1 OS=Homo sapiens OX=9606 GN=UFC1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	1	1	1
PRT	sp|P07858|CATB_HUMAN	Cathepsin B OS=Homo sapiens OX=9606 GN=CTSB PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q99714|HCD2_HUMAN	3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.07	18.0	2	1	0
PRT	sp|Q9BYN0|SRXN1_HUMAN	Sulfiredoxin-1 OS=Homo sapiens OX=9606 GN=SRXN1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|Q96MN5-2|TEAN2_HUMAN	Isoform 2 of Transcription elongation factor A N-terminal and central domain-containing protein 2 OS=Homo sapiens OX=9606 GN=TCEANC2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|Q9P1F3|ABRAL_HUMAN	Costars family protein ABRACL OS=Homo sapiens OX=9606 GN=ABRACL PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	1-UNIMOD:1	0.21	18.0	1	1	1
PRT	sp|Q8WXX5|DNJC9_HUMAN	DnaJ homolog subfamily C member 9 OS=Homo sapiens OX=9606 GN=DNAJC9 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|O95816-2|BAG2_HUMAN	Isoform 2 of BAG family molecular chaperone regulator 2 OS=Homo sapiens OX=9606 GN=BAG2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q9NWB6|ARGL1_HUMAN	Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.13	18.0	4	4	4
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O76031|CLPX_HUMAN	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	3	1	0
PRT	sp|O75330-4|HMMR_HUMAN	Isoform 4 of Hyaluronan mediated motility receptor OS=Homo sapiens OX=9606 GN=HMMR	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.05	18.0	2	1	0
PRT	sp|Q8NFW8|NEUA_HUMAN	N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null	394-UNIMOD:4	0.06	18.0	2	2	2
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q86U28|ISCA2_HUMAN	Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	null		0.08	18.0	1	1	1
PRT	cov|corona00277|ORF1b_USA/MA1/2020_travel_history	Y1319C	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	18.0	null	1319-UNIMOD:4	0.01	18.0	5	1	0
PRT	sp|Q96L14|C170L_HUMAN	Cep170-like protein OS=Homo sapiens OX=9606 GN=CEP170P1 PE=5 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null	251-UNIMOD:35	0.09	18.0	2	1	0
PRT	sp|Q9H9A6|LRC40_HUMAN	Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null		0.10	18.0	3	3	3
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	0
PRT	sp|P35080|PROF2_HUMAN	Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.11	18.0	1	1	0
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	18.0	null		0.10	18.0	2	2	2
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q69YN2|C19L1_HUMAN	CWF19-like protein 1 OS=Homo sapiens OX=9606 GN=CWF19L1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.03	18.0	1	1	0
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	0
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q9BZE4|NOG1_HUMAN	Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	2-UNIMOD:1	0.01	17.0	1	1	1
PRT	sp|Q96NC0|ZMAT2_HUMAN	Zinc finger matrin-type protein 2 OS=Homo sapiens OX=9606 GN=ZMAT2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.07	17.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q6UB35|C1TM_HUMAN	Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	69-UNIMOD:4	0.22	17.0	1	1	1
PRT	sp|Q9H773|DCTP1_HUMAN	dCTP pyrophosphatase 1 OS=Homo sapiens OX=9606 GN=DCTPP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	17.0	null		0.13	17.0	4	2	0
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	110-UNIMOD:4,111-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q14103-4|HNRPD_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.05	17.0	1	1	0
PRT	sp|Q9Y2R4|DDX52_HUMAN	Probable ATP-dependent RNA helicase DDX52 OS=Homo sapiens OX=9606 GN=DDX52 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	17.0	null		0.10	17.0	3	3	3
PRT	sp|O95861-3|BPNT1_HUMAN	Isoform 3 of 3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q96C92-4|ENTR1_HUMAN	Isoform 4 of Endosome-associated-trafficking regulator 1 OS=Homo sapiens OX=9606 GN=ENTR1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q96E11-7|RRFM_HUMAN	Isoform 7 of Ribosome-recycling factor, mitochondrial OS=Homo sapiens OX=9606 GN=MRRF	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.18	17.0	2	2	2
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	571-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q2M1P5|KIF7_HUMAN	Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9ULC4-2|MCTS1_HUMAN	Isoform 2 of Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.11	17.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q99700-2|ATX2_HUMAN	Isoform 2 of Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9H3J6|CL065_HUMAN	Probable peptide chain release factor C12orf65, mitochondrial OS=Homo sapiens OX=9606 GN=C12orf65 PE=2 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null	81-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|O60884|DNJA2_HUMAN	DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|E9PRG8|CK098_HUMAN	Uncharacterized protein C11orf98 OS=Homo sapiens OX=9606 GN=C11orf98 PE=4 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.11	17.0	1	1	1
PRT	sp|P62714|PP2AB_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2CB PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9HCG8|CWC22_HUMAN	Pre-mRNA-splicing factor CWC22 homolog OS=Homo sapiens OX=9606 GN=CWC22 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	null		0.03	17.0	2	2	2
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.00	17.0	2	1	0
PRT	cov|corona09406|ORF1b_USA/WA-S1067/2020	V1116I	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	cov|corona00756|ORF1b_India/1104/2020	A1369V	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	1367-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q15637-2|SF01_HUMAN	Isoform 2 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	null	282-UNIMOD:385,282-UNIMOD:4,292-UNIMOD:4	0.02	17.0	1	1	0
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	2	2	2
PRT	sp|Q96L21|RL10L_HUMAN	60S ribosomal protein L10-like OS=Homo sapiens OX=9606 GN=RPL10L PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.11	17.0	2	2	0
PRT	sp|P12235|ADT1_HUMAN	ADP/ATP translocase 1 OS=Homo sapiens OX=9606 GN=SLC25A4 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	282-UNIMOD:35	0.06	17.0	1	1	1
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	0
PRT	sp|Q13642|FHL1_HUMAN	Four and a half LIM domains protein 1 OS=Homo sapiens OX=9606 GN=FHL1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	150-UNIMOD:4,153-UNIMOD:4	0.04	17.0	1	1	1
PRT	sp|Q15233|NONO_HUMAN	Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q9NWY4|HPF1_HUMAN	Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	124-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	3293-UNIMOD:4	0.01	17.0	2	2	2
PRT	sp|P08559|ODPA_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|Q4KMP7|TB10B_HUMAN	TBC1 domain family member 10B OS=Homo sapiens OX=9606 GN=TBC1D10B PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q08722|CD47_HUMAN	Leukocyte surface antigen CD47 OS=Homo sapiens OX=9606 GN=CD47 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	null	100-UNIMOD:35	0.03	17.0	1	1	1
PRT	sp|Q9Y4A5|TRRAP_HUMAN	Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	null	3645-UNIMOD:35	0.00	17.0	1	1	1
PRT	sp|Q09FC8-4|ZN415_HUMAN	Isoform 4 of Zinc finger protein 415 OS=Homo sapiens OX=9606 GN=ZNF415	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.02	17.0	1	1	1
PRT	sp|Q15652|JHD2C_HUMAN	Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.00	17.0	1	1	1
PRT	sp|O15164|TIF1A_HUMAN	Transcription intermediary factor 1-alpha OS=Homo sapiens OX=9606 GN=TRIM24 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null		0.01	17.0	1	1	1
PRT	sp|Q9UBF2|COPG2_HUMAN	Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	361-UNIMOD:35	0.02	17.0	1	1	1
PRT	cov|corona00530|ORF1b_Australia/VIC614/2020	P1001S	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	null	1007-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q6P6C2|ALKB5_HUMAN	RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	16.0	null	2-UNIMOD:1	0.05	16.0	2	2	2
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q96BH1|RNF25_HUMAN	E3 ubiquitin-protein ligase RNF25 OS=Homo sapiens OX=9606 GN=RNF25 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null	198-UNIMOD:4,201-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q5W111-2|SPRY7_HUMAN	Isoform 2 of SPRY domain-containing protein 7 OS=Homo sapiens OX=9606 GN=SPRYD7	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|O43678-2|NDUA2_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Homo sapiens OX=9606 GN=NDUFA2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null	58-UNIMOD:4	0.12	16.0	1	1	1
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P98077|SHC2_HUMAN	SHC-transforming protein 2 OS=Homo sapiens OX=9606 GN=SHC2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P35244|RFA3_HUMAN	Replication protein A 14 kDa subunit OS=Homo sapiens OX=9606 GN=RPA3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.15	16.0	1	1	1
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.10	16.0	1	1	1
PRT	sp|Q15464|SHB_HUMAN	SH2 domain-containing adapter protein B OS=Homo sapiens OX=9606 GN=SHB PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null	115-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q9P2S5|WRP73_HUMAN	WD repeat-containing protein WRAP73 OS=Homo sapiens OX=9606 GN=WRAP73 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q9BZL1|UBL5_HUMAN	Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.14	16.0	1	1	1
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|O75937|DNJC8_HUMAN	DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9NPJ6-2|MED4_HUMAN	Isoform 2 of Mediator of RNA polymerase II transcription subunit 4 OS=Homo sapiens OX=9606 GN=MED4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.08	16.0	1	1	1
PRT	sp|P23921|RIR1_HUMAN	Ribonucleoside-diphosphate reductase large subunit OS=Homo sapiens OX=9606 GN=RRM1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NSC7|SIA7A_HUMAN	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 OS=Homo sapiens OX=9606 GN=ST6GALNAC1 PE=2 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q96EK6|GNA1_HUMAN	Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null	99-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|O43819|SCO2_HUMAN	Protein SCO2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=SCO2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|O43813|LANC1_HUMAN	Glutathione S-transferase LANCL1 OS=Homo sapiens OX=9606 GN=LANCL1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q02878|RL6_HUMAN	60S ribosomal protein L6 OS=Homo sapiens OX=9606 GN=RPL6 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P0DN26|PAL4F_HUMAN	Peptidyl-prolyl cis-trans isomerase A-like 4F OS=Homo sapiens OX=9606 GN=PPIAL4F PE=3 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1-0 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q13561|DCTN2_HUMAN	Dynactin subunit 2 OS=Homo sapiens OX=9606 GN=DCTN2 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q96HP4|OXND1_HUMAN	Oxidoreductase NAD-binding domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OXNAD1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q5JTW2|CEP78_HUMAN	Centrosomal protein of 78 kDa OS=Homo sapiens OX=9606 GN=CEP78 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q8N4C6-10|NIN_HUMAN	Isoform 3 of Ninein OS=Homo sapiens OX=9606 GN=NIN	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.00	16.0	1	1	0
PRT	cov|corona02661|ORF1b_Uganda/UG003/2020	D955H	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	null	952-UNIMOD:385,952-UNIMOD:4,953-UNIMOD:4	0.00	16.0	1	1	1
PRT	sp|Q9BQQ3|GORS1_HUMAN	Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	192-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|P78549|NTH_HUMAN	Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.06	16.0	1	1	0
PRT	sp|P50991|TCPD_HUMAN	T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	450-UNIMOD:4	0.02	16.0	1	1	0
PRT	sp|Q5M9Q1|NKAPL_HUMAN	NKAP-like protein OS=Homo sapiens OX=9606 GN=NKAPL PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P49368|TCPG_HUMAN	T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	1-UNIMOD:1	0.03	16.0	1	1	1
PRT	sp|Q9NSV4|DIAP3_HUMAN	Protein diaphanous homolog 3 OS=Homo sapiens OX=9606 GN=DIAPH3 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	0
PRT	sp|Q9UPN4|CP131_HUMAN	Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	0
PRT	sp|P13647|K2C5_HUMAN	Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	55-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q7L3T8|SYPM_HUMAN	Probable proline--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=PARS2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q86UK7|ZN598_HUMAN	E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	835-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|P78368|KC1G2_HUMAN	Casein kinase I isoform gamma-2 OS=Homo sapiens OX=9606 GN=CSNK1G2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q9UNZ5|L10K_HUMAN	Leydig cell tumor 10 kDa protein homolog OS=Homo sapiens OX=9606 GN=C19orf53 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.14	16.0	2	2	2
PRT	sp|Q04721|NOTC2_HUMAN	Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NW75|GPTC2_HUMAN	G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|Q5KU26|COL12_HUMAN	Collectin-12 OS=Homo sapiens OX=9606 GN=COLEC12 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NUP9|LIN7C_HUMAN	Protein lin-7 homolog C OS=Homo sapiens OX=9606 GN=LIN7C PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q9NXR1|NDE1_HUMAN	Nuclear distribution protein nudE homolog 1 OS=Homo sapiens OX=9606 GN=NDE1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q9Y3Z3|SAMH1_HUMAN	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P28062|PSB8_HUMAN	Proteasome subunit beta type-8 OS=Homo sapiens OX=9606 GN=PSMB8 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	null	7-UNIMOD:4	0.04	16.0	1	1	1
PRT	sp|Q96N67|DOCK7_HUMAN	Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q86XR2|NIBA3_HUMAN	Protein Niban 3 OS=Homo sapiens OX=9606 GN=NIBAN3 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q7Z6J2|GRASP_HUMAN	Protein TAMALIN OS=Homo sapiens OX=9606 GN=TAMALIN PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.00	16.0	1	1	1
PRT	sp|Q86UW7|CAPS2_HUMAN	Calcium-dependent secretion activator 2 OS=Homo sapiens OX=9606 GN=CADPS2 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	2	1	0
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	1349-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q16670|ZSC26_HUMAN	Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZSCAN26 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|Q8TDC3|BRSK1_HUMAN	Serine/threonine-protein kinase BRSK1 OS=Homo sapiens OX=9606 GN=BRSK1 PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	0
PRT	sp|Q9UPT6|JIP3_HUMAN	C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|O14910|LIN7A_HUMAN	Protein lin-7 homolog A OS=Homo sapiens OX=9606 GN=LIN7A PE=1 SV=2	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.09	16.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P07203|GPX1_HUMAN	Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q9ULC4|MCTS1_HUMAN	Malignant T-cell-amplified sequence 1 OS=Homo sapiens OX=9606 GN=MCTS1 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q13162|PRDX4_HUMAN	Peroxiredoxin-4 OS=Homo sapiens OX=9606 GN=PRDX4 PE=1 SV=1	null	null	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	null	245-UNIMOD:4	0.09	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	1	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	70.0	32-UNIMOD:4	ms_run[2]:scan=23347	50.236	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	2	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	68.0	32-UNIMOD:4	ms_run[2]:scan=24334	52.141	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	3	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	67.0	32-UNIMOD:4	ms_run[1]:scan=23675	50.871499	4	4030.885170	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	4	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	67.0	32-UNIMOD:4	ms_run[1]:scan=24012	51.508757	4	4030.885069	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	5	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	62.0	32-UNIMOD:4	ms_run[2]:scan=23348	50.237	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	6	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	62.0	32-UNIMOD:4	ms_run[1]:scan=28074	60.987721	4	4030.885229	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	7	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	60.0	32-UNIMOD:4	ms_run[2]:scan=26614	57.198	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	8	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	59.0	32-UNIMOD:4	ms_run[1]:scan=27476	59.722949	4	4030.885229	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	9	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	58.0	32-UNIMOD:4	ms_run[2]:scan=25841	55.307	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	10	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	57.0	32-UNIMOD:4	ms_run[2]:scan=24662	52.785	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	11	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	32-UNIMOD:4	ms_run[2]:scan=22740	49.073	5	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	12	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	32-UNIMOD:4	ms_run[2]:scan=24327	52.126	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	13	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	56.0	32-UNIMOD:4	ms_run[2]:scan=32092	73.28	4	4030.8855	4030.8855	K	F	1448	1484
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	14	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	55.0	15-UNIMOD:35	ms_run[2]:scan=23350	50.243	3	3398.7333	3398.7333	K	I	1142	1172
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	15	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	55.0	32-UNIMOD:4	ms_run[1]:scan=27711	60.354944	4	4030.885229	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	16	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	54.0	32-UNIMOD:4	ms_run[2]:scan=25304	54.048	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	17	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	54.0	32-UNIMOD:4	ms_run[2]:scan=26124	55.936	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	18	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	54.0	32-UNIMOD:4	ms_run[2]:scan=26381	56.563	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	19	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	32-UNIMOD:4	ms_run[2]:scan=23022	49.605	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	20	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	32-UNIMOD:4	ms_run[2]:scan=23023	49.606	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	21	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	53.0	32-UNIMOD:4	ms_run[2]:scan=24990	53.421	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	22	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	53.0	32-UNIMOD:4	ms_run[1]:scan=28461	61.635406	4	4030.885229	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	23	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	51.0	32-UNIMOD:4	ms_run[2]:scan=24006	51.497	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	24	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	51.0	32-UNIMOD:4	ms_run[2]:scan=25579	54.675	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ASANIGCNHTGVVGEGSEGLNDNLLEILQK	25	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	7-UNIMOD:4	ms_run[2]:scan=22289	48.145	3	3108.5146	3108.5146	R	E	427	457
PSM	EAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK	26	sp|Q3ZCM7|TBB8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=21951	47.41	3	3310.5268	3310.5268	K	I	123	155
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	27	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	50.0	32-UNIMOD:4	ms_run[2]:scan=26854	57.829	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ITGLYPTLNISDEFSSNVANYQK	28	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	49.0		ms_run[2]:scan=23809	51.117	3	2573.2649	2573.2649	R	V	1172	1195
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	29	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	49.0		ms_run[1]:scan=24103	51.683507	3	2797.335641	2797.336097	R	G	78	104
PSM	AMQDAEVSKSDIGEVILVGGMTR	30	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0		ms_run[2]:scan=19945	43.679	3	2405.193	2405.1930	K	M	369	392
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	31	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0	32-UNIMOD:4	ms_run[2]:scan=23085	49.721	5	4030.8855	4030.8855	K	F	1448	1484
PSM	IVYTACSHAAVDALCEK	32	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12027	28.489	2	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	33	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	48.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12034	28.506	2	1906.8917	1906.8917	R	A	1227	1244
PSM	DQELEALQQEQQQAQGQEER	34	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=13693	31.773	2	2384.084	2384.0840	R	V	1816	1836
PSM	MMYGVSPWGDSPIDFEDSAHVPCPR	35	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0	23-UNIMOD:4	ms_run[2]:scan=22403	48.454	3	2849.2248	2849.2248	R	G	478	503
PSM	TIGGGDDSFNTFFSETGAGK	36	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	47.0		ms_run[2]:scan=20966	45.617	2	2006.8858	2006.8858	K	H	41	61
PSM	IVYTACSHAAVDALCEK	37	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=12672	29.777776	2	1907.894007	1906.891719	R	A	1227	1244
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	38	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	47.0	32-UNIMOD:4	ms_run[1]:scan=28075	60.989269	3	4030.886131	4030.885455	K	F	1448	1484
PSM	AKHYVYIGDPAQLPAPR	39	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=12096	28.636	2	1895.0054	1895.0054	R	T	1316	1333
PSM	ITGLYPTLNISDEFSSNVANYQK	40	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0		ms_run[2]:scan=23481	50.488	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IVYTACSHAAVDALCEK	41	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12350	29.139	2	1906.8917	1906.8917	R	A	1227	1244
PSM	QLSQQLNGLVCESATCVNGEGPASSANLK	42	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	46.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=18597	40.974	3	3031.4339	3031.4339	R	D	129	158
PSM	QLFHPEQLITGKEDAANNYAR	43	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	46.0	1-UNIMOD:28	ms_run[1]:scan=19146	41.979632	3	2397.1701	2397.1708	R	G	85	106
PSM	ITGLYPTLNISDEFSSNVANYQK	44	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=24143	51.754	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IVYTACSHAAVDALCEK	45	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=13001	30.408	2	1906.8917	1906.8917	R	A	1227	1244
PSM	LQEEMLQREEAENTLQSFR	46	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=16722	37.529	3	2350.1223	2350.1223	K	Q	189	208
PSM	LVQDVANNTNEEAGDGTTTATVLAR	47	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=12867	30.149	3	2559.2413	2559.2413	K	S	97	122
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	48	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:4	ms_run[2]:scan=22365	48.363	3	2994.3925	2994.3926	K	F	396	424
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	49	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0	16-UNIMOD:4	ms_run[2]:scan=22705	49.01	3	2994.3925	2994.3926	K	F	396	424
PSM	VRGPDAAPFLLGLLTNELPLPSPAAAGAPPAAR	50	sp|Q5T440|CAF17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	45.0		ms_run[2]:scan=27787	60.487	3	3219.7768	3219.7768	R	A	61	94
PSM	IVYTACSHAAVDALCEK	51	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13762	31.895782	2	1908.888645	1906.891719	R	A	1227	1244
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	52	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0	32-UNIMOD:4	ms_run[1]:scan=28827	62.270047	4	4030.885229	4030.885455	K	F	1448	1484
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	53	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	45.0	16-UNIMOD:4	ms_run[1]:scan=22354	48.335133	3	2995.392942	2994.392551	K	F	396	424
PSM	ALMLQGVDLLADAVAVTMGPK	54	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=28158	61.132	3	2112.1323	2112.1323	R	G	38	59
PSM	HSQCSEAIITVLCGTEGAQDGLSKPK	55	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=16595	37.302	4	2785.3375	2785.3375	K	N	1136	1162
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	56	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0	32-UNIMOD:4	ms_run[2]:scan=27081	58.462	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ITGLYPTLNISDEFSSNVANYQK	57	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=23705	50.925	2	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	58	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=24455	52.381	3	2573.2649	2573.2649	R	V	1172	1195
PSM	MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR	59	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=23563	50.659	4	3503.7871	3503.7871	R	L	145	179
PSM	NIADLMTQAGVEELESENKIPATQK	60	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=23148	49.837	3	2728.3589	2728.3589	K	S	51	76
PSM	VETGVLKPGMVVTFAPVNVTTEVK	61	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	44.0		ms_run[2]:scan=20546	44.861	3	2514.3767	2514.3767	R	S	267	291
PSM	VQIGEYTFEKGDYGDAVVYR	62	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0		ms_run[1]:scan=18949	41.624995	3	2309.104824	2308.101178	K	G	1116	1136
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	63	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	44.0	32-UNIMOD:4	ms_run[1]:scan=27473	59.715574	3	4030.886131	4030.885455	K	F	1448	1484
PSM	ATAGDTHLGGEDFDNR	64	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=8531	21.753	2	1674.7234	1674.7234	K	L	221	237
PSM	AYHEQLSVAEITNACFEPANQMVK	65	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	15-UNIMOD:4,22-UNIMOD:35	ms_run[2]:scan=17444	38.879	3	2765.2789	2765.2789	K	C	281	305
PSM	EQGELKEQSLQSQLDEAQR	66	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=11819	28.129	3	2215.0717	2215.0717	R	A	1792	1811
PSM	GVITHDVSSAINRPQIGVVR	67	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=12809	30.006	2	2117.1705	2117.1705	K	E	1401	1421
PSM	HLSSLDSLESCYLSEFQTIR	68	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	11-UNIMOD:4	ms_run[2]:scan=24529	52.523	3	2384.1318	2384.1318	R	E	964	984
PSM	LAHLLASAQKEPEAAAPAPGTGGDSVCGETHR	69	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0	27-UNIMOD:4	ms_run[2]:scan=9583	23.574	4	3197.5524	3197.5524	R	A	768	800
PSM	VQIGEYTFEKGDYGDAVVYR	70	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	43.0		ms_run[2]:scan=18604	40.988	3	2308.1012	2308.1012	K	G	1116	1136
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	71	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	15-UNIMOD:35	ms_run[1]:scan=23392	50.318907	4	3398.731414	3398.733299	K	I	1142	1172
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	72	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	43.0	32-UNIMOD:4	ms_run[1]:scan=28462	61.636954	3	4030.886131	4030.885455	K	F	1448	1484
PSM	DHMVLLEFVTAAGITLGMDELYK	73	tr|C5MKY7|C5MKY7_HCMV	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	3-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=27853	60.602	3	2597.2757	2597.2757	R	-	217	240
PSM	DQELEALQQEQQQAQGQEER	74	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=13638	31.664	3	2384.084	2384.0840	R	V	1816	1836
PSM	ITGLYPTLNISDEFSSNVANYQK	75	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=23372	50.281	2	2573.2649	2573.2649	R	V	1172	1195
PSM	ITSENPDEGFKPSSGTVQELNFR	76	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=15274	34.956	3	2551.2191	2551.2191	R	S	510	533
PSM	KEAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK	77	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=20060	43.876	4	3438.6218	3438.6218	R	I	122	155
PSM	LSLSNMHTAQLELTQANLQK	78	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17299	38.556	3	2239.1631	2239.1631	R	E	252	272
PSM	NADMSEEMQQDSVECATQALEK	79	sp|P63167|DYL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	15-UNIMOD:4	ms_run[2]:scan=18576	40.939	3	2513.0356	2513.0356	K	Y	10	32
PSM	SHKPPISFPLCANGQVFGLYK	80	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0	11-UNIMOD:4	ms_run[2]:scan=19825	43.461	3	2359.2147	2359.2147	K	N	997	1018
PSM	TAAFLLPILSQIYSDGPGEALR	81	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=27988	60.838	3	2331.2474	2331.2474	K	A	215	237
PSM	VQIGEYTFEKGDYGDAVVYR	82	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=17926	39.717	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	83	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=18269	40.357	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQQQALHSQQQLEAEAQK	84	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	42.0		ms_run[2]:scan=8250	21.166	3	2063.0396	2063.0396	K	H	2811	2829
PSM	IVYTACSHAAVDALCEK	85	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=14035	32.532663	2	1907.895629	1906.891719	R	A	1227	1244
PSM	RCPAEIVDTVSALVYDNK	86	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	42.0	2-UNIMOD:4	ms_run[1]:scan=22282	48.126112	2	2049.019040	2049.020091	R	L	1366	1384
PSM	DLEAEHVEVEDTTLNR	87	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=12598	29.64	2	1868.8752	1868.8752	R	C	15	31
PSM	DQELEALQQEQQQAQGQEER	88	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=13631	31.647	3	2384.084	2384.0840	R	V	1816	1836
PSM	EAMVAFFNSAVASAEEEQAR	89	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=25024	53.484	2	2155.9844	2155.9844	R	L	734	754
PSM	EMEENFAVEAANYQDTIGR	90	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19448	42.714	2	2185.9586	2185.9586	R	L	346	365
PSM	GEQGVQLGEVSGVEAEPSPDGMEK	91	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=15015	34.402	3	2428.1064	2428.1064	R	Q	2242	2266
PSM	GEQGVQLGEVSGVEAEPSPDGMEK	92	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=14996	34.338	3	2428.1064	2428.1064	R	Q	2242	2266
PSM	GLTQELEQFHQEQLTSLVEK	93	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=21687	46.913	3	2356.1911	2356.1911	R	H	757	777
PSM	HPELADKNVPNLHVMK	94	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=9698	23.801	4	1840.9618	1840.9618	K	A	32	48
PSM	HQQEAATTQLEQLHQEAK	95	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=8628	21.915	3	2089.0188	2089.0188	R	R	701	719
PSM	IAQLEEELEEEQGNTELINDR	96	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=19701	43.175	3	2471.1664	2471.1664	R	L	1731	1752
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	97	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	32-UNIMOD:4	ms_run[2]:scan=23673	50.866	3	4030.8855	4030.8855	K	F	1448	1484
PSM	LILPVGPAGGNQMLEQYDKLQDGSIK	98	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=22370	48.373	3	2783.4528	2783.4528	R	M	179	205
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	99	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=24936	53.317	4	3382.7384	3382.7384	K	I	1142	1172
PSM	QAQQERDELADEIANSSGK	100	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=11747	27.972	3	2087.972	2087.9720	R	G	1698	1717
PSM	SLEASTATLQASLDACQAHSR	101	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0	16-UNIMOD:4	ms_run[2]:scan=15028	34.437	3	2216.0492	2216.0492	R	Q	1993	2014
PSM	TVSHEAEVHAESLQQK	102	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=6326	17.121	3	1791.8751	1791.8751	K	L	1363	1379
PSM	VQIGEYTFEKGDYGDAVVYR	103	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	41.0		ms_run[2]:scan=17651	39.229	2	2308.1012	2308.1012	K	G	1116	1136
PSM	TIQVENSHLILTGAGALNK	104	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=15545	35.442649	2	1979.091404	1978.084740	R	V	1838	1857
PSM	AKHYVYIGDPAQLPAPR	105	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0		ms_run[1]:scan=12084	28.613357	2	1896.008472	1895.005367	R	T	1316	1333
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	106	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	32-UNIMOD:4	ms_run[1]:scan=27708	60.347842	3	4030.886131	4030.885455	K	F	1448	1484
PSM	KGLIAAICAGPTALLAHEIGFGSK	107	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	41.0	8-UNIMOD:4	ms_run[1]:scan=23624	50.774503	4	2394.308912	2394.309337	R	V	99	123
PSM	AYHEQLSVAEITNACFEPANQMVK	108	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	15-UNIMOD:4	ms_run[2]:scan=19182	42.081	3	2749.284	2749.2840	K	C	281	305
PSM	EAVCFIPGEGHTLQEHQIVLVEGGR	109	sp|O15235|RT12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	4-UNIMOD:4	ms_run[2]:scan=17331	38.61	4	2774.381	2774.3810	R	T	90	115
PSM	EGPYDVVVLPGGNLGAQNLSESAAVK	110	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=21060	45.798	3	2583.318	2583.3180	K	E	64	90
PSM	FIIGSVSEDNSEDEISNLVK	111	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=22107	47.754	2	2194.0641	2194.0641	R	L	19	39
PSM	GHYTEGAELVDSVLDVVRK	112	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=22653	48.916	3	2086.0695	2086.0695	K	E	104	123
PSM	IQTHIVQQENHLLKDELEK	113	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=11932	28.316	4	2314.2281	2314.2281	K	M	1667	1686
PSM	KNLDSTTVAIHDEEIYCK	114	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	17-UNIMOD:4	ms_run[2]:scan=11081	26.718	3	2135.0205	2135.0205	R	S	42	60
PSM	MMYGVSPWGDSPIDFEDSAHVPCPR	115	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	23-UNIMOD:4	ms_run[2]:scan=22393	48.428	3	2849.2248	2849.2248	R	G	478	503
PSM	SLEASTATLQASLDACQAHSR	116	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0	16-UNIMOD:4	ms_run[2]:scan=15018	34.409	3	2216.0492	2216.0492	R	Q	1993	2014
PSM	VQIGEYTFEKGDYGDAVVYR	117	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	40.0		ms_run[2]:scan=19639	43.06	3	2308.1012	2308.1012	K	G	1116	1136
PSM	LSPGSGGPEAQTAGPVTPASISGR	118	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=12462	29.334115	2	2194.105107	2193.102575	R	F	2351	2375
PSM	VEDMAELTCLNEASVLHNLK	119	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	9-UNIMOD:4	ms_run[1]:scan=21387	46.379259	3	2285.116329	2285.103169	K	D	87	107
PSM	ITGLYPTLNISDEFSSNVANYQK	120	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=24817	53.08636	3	2574.266298	2573.264949	R	V	1172	1195
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	121	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=27081	58.461989	4	4029.882414	4027.852775	K	F	1448	1484
PSM	LGEMWNNTAADDKQPYEK	122	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	40.0		ms_run[1]:scan=12037	28.514452	3	2109.950059	2108.947320	K	K	129	147
PSM	AAAIGIDLGTTYSCVGVFQHGK	123	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	14-UNIMOD:4	ms_run[2]:scan=19734	43.25	3	2264.126	2264.1260	K	V	4	26
PSM	ADEHVIDQGDDGDNFYVIER	124	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=15479	35.322	3	2306.0087	2306.0087	K	G	162	182
PSM	APKPDGPGGGPGGSHMGGNYGDDR	125	sp|P35637-2|FUS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=5735	16.038	4	2251.9665	2251.9665	K	R	448	472
PSM	AYHEQLTVAEITNACFEPANQMVK	126	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	15-UNIMOD:4	ms_run[2]:scan=19414	42.642	3	2763.2996	2763.2996	K	C	281	305
PSM	DLYDKLQFTSLEIPR	127	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=22358	48.346	2	1836.9622	1836.9622	R	R	1503	1518
PSM	DMAGLLKPTACTMLVSSLR	128	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=22642	48.896	3	2063.0577	2063.0577	K	D	742	761
PSM	DQYLGHLQQYVAAYQQLTSEK	129	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=24745	52.949	3	2482.2129	2482.2129	R	E	613	634
PSM	EAMVAFFNSAVASAEEEQAR	130	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=24939	53.321	3	2155.9844	2155.9844	R	L	734	754
PSM	EIETYHNLLEGGQEDFESSGAGK	131	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16846	37.745	3	2509.1245	2509.1245	K	I	450	473
PSM	GNLYSFGCPEYGQLGHNSDGK	132	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4	ms_run[2]:scan=15221	34.84	3	2298.9964	2298.9964	K	F	273	294
PSM	HNDMHYECMTPCQVTSDSDKEK	133	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	8-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8652	21.956	4	2711.072	2711.0720	R	T	90	112
PSM	HQLEALESPLCIQHEGHVSDR	134	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=11837	28.157	5	2454.171	2454.1710	R	C	603	624
PSM	HYGPGWVSMANAGK	135	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12061	28.573	2	1473.6823	1473.6823	K	D	132	146
PSM	IDSIPHLNNSTPLVDPSVYGYGVQK	136	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=19624	43.032	3	2712.3759	2712.3759	K	R	33	58
PSM	IPLSQEEITLQGHAFEAR	137	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=16548	37.217	3	2038.0484	2038.0484	K	I	368	386
PSM	LQQLEQDLTSDDALHCSQCGR	138	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=13803	31.981	3	2473.0962	2473.0962	R	E	821	842
PSM	MMCGAPSATQPATAETQHIADQVR	139	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	1-UNIMOD:1,3-UNIMOD:4	ms_run[2]:scan=17025	38.061	3	2612.1781	2612.1781	-	S	1	25
PSM	NQMAEPPPPEPPAGPSEVEQQLQAEAEHLRK	140	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	3-UNIMOD:35	ms_run[2]:scan=19574	42.94	4	3419.6416	3419.6416	R	E	444	475
PSM	QLSQQLNGLVCESATCVNGEGPASSANLK	141	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=18583	40.949	3	3031.4339	3031.4339	R	D	129	158
PSM	QNSLESELMELHETMASLQSR	142	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	9-UNIMOD:35	ms_run[2]:scan=25405	54.325	3	2448.1261	2448.1261	K	L	1308	1329
PSM	RLDESLTQSLTSPGPVLLHPSPSTTQAASR	143	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=17146	38.28	4	3145.6368	3145.6368	R	-	2413	2443
PSM	RVSVCAETYNPDEEEEDTDPR	144	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	5-UNIMOD:4	ms_run[2]:scan=9970	24.387	3	2510.0503	2510.0503	R	V	97	118
PSM	SHKPPISFPLCANGQVFGLYK	145	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	11-UNIMOD:4	ms_run[2]:scan=20180	44.089	3	2359.2147	2359.2147	K	N	997	1018
PSM	SQVFSTAADGQTQVEIK	146	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0		ms_run[2]:scan=12900	30.232	2	1807.8952	1807.8952	K	V	469	486
PSM	TLSNEEHFQEPDCSLEAQPK	147	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	13-UNIMOD:4	ms_run[2]:scan=11520	27.506	3	2358.0434	2358.0434	R	Y	78	98
PSM	VETGVLKPGMVVTFAPVNVTTEVK	148	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	39.0	10-UNIMOD:35	ms_run[2]:scan=18833	41.414	3	2530.3717	2530.3717	R	S	267	291
PSM	HYGPGWVSMANAGK	149	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=12070	28.586591	2	1473.683738	1473.682318	K	D	132	146
PSM	LGEMWNNTAADDKQPYEK	150	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=12042	28.529135	3	2109.950059	2108.947320	K	K	129	147
PSM	VRGPDAAPFLLGLLTNELPLPSPAAAGAPPAAR	151	sp|Q5T440|CAF17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	39.0		ms_run[1]:scan=27789	60.490297	4	3220.776890	3219.776818	R	A	61	94
PSM	CEAPDANQQLQQAMEER	152	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4	ms_run[2]:scan=14003	32.471	2	2016.8629	2016.8629	R	A	356	373
PSM	CPAEIVDTVSALVYDNK	153	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4	ms_run[2]:scan=25236	53.902	2	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	154	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4	ms_run[2]:scan=25501	54.529	2	1892.919	1892.9190	R	L	1367	1384
PSM	CQEVISWLDANTLAEKDEFEHK	155	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:4	ms_run[2]:scan=20549	44.865	4	2661.2381	2661.2381	K	R	574	596
PSM	EVLHNQLLLQTQLVDQLQQQEAQGK	156	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=21250	46.132	3	2900.5356	2900.5356	K	A	634	659
PSM	FIIGSVSEDNSEDEISNLVK	157	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=22137	47.808	3	2194.0641	2194.0641	R	L	19	39
PSM	GVITHDVSSAINRPQIGVVR	158	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12003	28.44	4	2117.1705	2117.1705	K	E	1401	1421
PSM	HGEEVTPEDVLSAAMYPDVFAHFK	159	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	15-UNIMOD:35	ms_run[2]:scan=23811	51.12	4	2704.2479	2704.2479	R	D	998	1022
PSM	IHNANPELTDGQIQAMLR	160	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16721	37.528	3	2020.016	2020.0160	K	R	2232	2250
PSM	IKEEFQFLQAQYHSLK	161	sp|Q04724|TLE1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=16463	37.073	3	2008.0418	2008.0418	R	L	29	45
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	162	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	32-UNIMOD:4	ms_run[2]:scan=24644	52.752	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	163	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	32-UNIMOD:4	ms_run[2]:scan=31767	72.56	3	4030.8855	4030.8855	K	F	1448	1484
PSM	IQALQTACPDLQLSAASVGNCPTKK	164	sp|Q15154|PCM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	8-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=15279	34.968	3	2670.3469	2670.3469	K	Y	763	788
PSM	ISVMGGEQAANVLATITK	165	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23137	49.818	2	1801.9608	1801.9608	R	D	470	488
PSM	ITGLYPTLNISDEFSSNVANYQK	166	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=25206	53.843	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	167	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=27620	60.161	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITSENPDEGFKPSSGTVQELNFR	168	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=15267	34.941	3	2551.2191	2551.2191	R	S	510	533
PSM	KLEMTELLLQQFSSR	169	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=23068	49.689	2	1821.9659	1821.9659	K	C	341	356
PSM	LGEHNIEVLEGNEQFINAAK	170	sp|P07477|TRY1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=17463	38.912	3	2224.1124	2224.1124	R	I	73	93
PSM	LNSHETTITQQSVSDSHLAELQEK	171	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=11665	27.762	4	2694.3097	2694.3097	K	I	387	411
PSM	LPATQEVVTQLQSQILELQGELK	172	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=27822	60.549	3	2564.4061	2564.4061	R	E	954	977
PSM	LTGQQGEEPSLVSPSTSCGSLTER	173	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	18-UNIMOD:4	ms_run[2]:scan=13270	30.901	3	2519.181	2519.1810	K	L	3556	3580
PSM	MDEPSPLAQPLELNQHSR	174	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	1-UNIMOD:1	ms_run[2]:scan=18981	41.681	2	2103.0055	2103.0055	-	F	1	19
PSM	NASLASSNNDLQVAEEQYQR	175	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=14465	33.286	2	2236.0356	2236.0356	K	L	495	515
PSM	SQVFSTAADGQTQVEIK	176	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12880	30.189	2	1807.8952	1807.8952	K	V	469	486
PSM	TVQDLTSVVQTLLQQMQDK	177	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=28055	60.956	3	2174.1253	2174.1253	K	F	8	27
PSM	VDGSVNAYAINVSQK	178	sp|Q8WVK2|SNR27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=12189	28.854	2	1563.7893	1563.7893	K	R	120	135
PSM	VETGVLKPGMVVTFAPVNVTTEVK	179	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=20601	44.957	4	2514.3767	2514.3767	R	S	267	291
PSM	VQIGEYTFEKGDYGDAVVYR	180	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0		ms_run[2]:scan=19246	42.257	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VSALNSVHCEHVEDEGESR	181	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	38.0	9-UNIMOD:4	ms_run[2]:scan=7439	19.539	3	2152.9444	2152.9444	R	Y	1761	1780
PSM	LASTEQTELLASKEDEDTIK	182	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=12323	29.087808	3	2222.108662	2220.100903	R	I	695	715
PSM	QVQSLTCEVDALKGTNESLER	183	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	38.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=21100	45.872544	3	2359.1269	2359.1320	R	Q	322	343
PSM	MVSLLSVLLSMQGAVDINK	184	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	1-UNIMOD:35	ms_run[1]:scan=28034	60.918832	2	2034.090028	2033.090085	K	L	3911	3930
PSM	NHTLALTETGSVFAFGENK	185	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=18491	40.785676	3	2035.000496	2035.001070	R	M	212	231
PSM	VMTIPYQPMPASSPVICAGGQDR	186	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0	17-UNIMOD:4	ms_run[1]:scan=19179	42.07186	3	2477.182376	2474.175622	R	C	178	201
PSM	AMTDTFTLQAHDQFSPFSSSSGR	187	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	38.0		ms_run[1]:scan=19299	42.374329	3	2520.132982	2517.123052	K	R	521	544
PSM	AFVHWYVGEGMEEGEFSEAR	188	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19833	43.475	3	2329.011	2329.0110	R	E	403	423
PSM	ALEQQPLAAGAAPPELQWLR	189	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=23314	50.172	3	2158.1535	2158.1535	R	A	1904	1924
PSM	AMTDTFTLQAHDQFSPFSSSSGR	190	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19344	42.464	3	2517.1231	2517.1231	K	R	521	544
PSM	ASVSSLQEVAMFLQASVLER	191	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:35	ms_run[2]:scan=27905	60.697	3	2180.1147	2180.1147	K	D	2185	2205
PSM	AYSEALAAFGNGALFVEK	192	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=23669	50.857	2	1856.9309	1856.9309	R	F	220	238
PSM	CLAAEDVVFIGPDTHAIQAMGDKIESK	193	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4	ms_run[2]:scan=21365	46.339	4	2914.4205	2914.4205	R	L	155	182
PSM	CPEPPSGSPPEGPEIQLEVTQR	194	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	1-UNIMOD:4	ms_run[2]:scan=15663	35.655	3	2403.1376	2403.1376	R	A	1625	1647
PSM	DMIILPEMVGSMVGVYNGK	195	sp|P62841|RS15_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27725	60.376	3	2052.0094	2052.0094	R	T	82	101
PSM	DTLAGQTVDLQGEVDSLSK	196	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20046	43.849	3	1974.9746	1974.9746	R	E	445	464
PSM	ELNSNHDGADETSEKEQQEAIEHIDEVQNEIDR	197	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17596	39.137	5	3820.6896	3820.6896	K	L	12	45
PSM	ETVEILETNHTELMEHEASLSR	198	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=15445	35.266	4	2567.2173	2567.2173	R	N	311	333
PSM	GAEEMETVIPVDVMR	199	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20307	44.352	2	1674.7957	1674.7957	K	R	13	28
PSM	GGAAVDPDSGLEHSAHVLEK	200	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10742	26.082	3	1987.9599	1987.9599	K	G	529	549
PSM	IEDLSQQAQLAAAEK	201	sp|Q13765|NACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12567	29.582	2	1613.8261	1613.8261	K	F	128	143
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	202	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	32-UNIMOD:4	ms_run[2]:scan=30086	64.804	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILLAELEQLKGQGK	203	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=17391	38.745	2	1538.9032	1538.9032	K	S	130	144
PSM	IQALQTACPDLQLSAASVGNCPTKK	204	sp|Q15154|PCM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	8-UNIMOD:4,21-UNIMOD:4	ms_run[2]:scan=15295	35.003	3	2670.3469	2670.3469	K	Y	763	788
PSM	ISVMGGEQAANVLATITK	205	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	4-UNIMOD:35	ms_run[2]:scan=20705	45.139	2	1817.9557	1817.9557	R	D	470	488
PSM	ITGLYPTLNISDEFSSNVANYQK	206	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=27966	60.799	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IVYTACSHAAVDALCEK	207	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=13744	31.861	2	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	208	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=29150	62.905	2	1906.8917	1906.8917	R	A	1227	1244
PSM	KAVFISPYNSQNAVASK	209	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=10797	26.19	3	1822.9577	1822.9577	R	I	1431	1448
PSM	LAETQEEISAEVAAK	210	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12050	28.553	2	1587.7992	1587.7992	R	A	108	123
PSM	LAETQEEISAEVAAK	211	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12141	28.756	2	1587.7992	1587.7992	R	A	108	123
PSM	LAHLLASAQKEPEAAAPAPGTGGDSVCGETHR	212	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	27-UNIMOD:4	ms_run[2]:scan=9564	23.542	5	3197.5524	3197.5524	R	A	768	800
PSM	LILPVGPAGGNQMLEQYDKLQDGSIK	213	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=22359	48.347	3	2783.4528	2783.4528	R	M	179	205
PSM	LKEAEESLQQQQQEQEEALK	214	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9940	24.336	3	2385.166	2385.1660	R	Q	529	549
PSM	LKEAEESLQQQQQEQEEALK	215	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=9984	24.412	3	2385.166	2385.1660	R	Q	529	549
PSM	LQDEIQNMKEEMAR	216	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=12933	30.291	2	1733.8077	1733.8077	R	H	365	379
PSM	MPVIKPDIANWELSVK	217	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=20409	44.561	3	1838.9964	1838.9964	R	L	549	565
PSM	MVSLLSVLLSMQGAVDINK	218	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=28174	61.159	3	2017.0952	2017.0952	K	L	3911	3930
PSM	NQAIDACDANTTPGGVTDVIK	219	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=13641	31.671	2	2159.0165	2159.0165	K	N	2144	2165
PSM	NQMAEPPPPEPPAGPSEVEQQLQAEAEHLRK	220	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=19836	43.484	4	3403.6467	3403.6467	R	E	444	475
PSM	QLFHPEQLITGKEDAANNYAR	221	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=14970	34.259	3	2414.1979	2414.1979	R	G	85	106
PSM	STAGDTHLGGEDFDNR	222	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=8476	21.637	2	1690.7183	1690.7183	K	M	221	237
PSM	SVSETPPLSGNDTDSLSCDSGSSATSTPCVSR	223	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	18-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=12953	30.327	3	3257.3936	3257.3936	K	L	1680	1712
PSM	TDQAQKAEGAGDAK	224	sp|P05204|HMGN2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2136	8.7233	2	1388.6532	1388.6532	K	-	77	91
PSM	TNSTGGSSGSSVGGGSGK	225	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0		ms_run[2]:scan=2089	8.6495	2	1482.6546	1482.6546	R	T	35	53
PSM	TSAAQAIHPGCGFLSENMEFAELCK	226	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	11-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=20555	44.874	3	2767.2404	2767.2404	K	Q	119	144
PSM	VVVPIYCTSFLAVEEDKQQK	227	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	37.0	7-UNIMOD:4	ms_run[2]:scan=20135	44.006	3	2352.2035	2352.2035	K	I	240	260
PSM	ELENLLSQEEEENIVLEEENKK	228	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=19403	42.619411	3	2659.299182	2657.291951	K	A	2412	2434
PSM	ITGLYPTLNISDEFSSNVANYQK	229	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=29085	62.78939	3	2574.267742	2573.264949	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	230	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=27224	58.898738	3	2574.268682	2573.264949	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	231	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=24532	52.52766	3	2573.264435	2573.264949	R	V	1172	1195
PSM	KAVFISPYNSQNAVASK	232	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=10824	26.234153	2	1822.957938	1822.957748	R	I	1431	1448
PSM	ETGVDLTKDNMALQR	233	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=11792	28.075249	2	1690.841167	1689.835584	R	V	293	308
PSM	CDHCGETSWQTGDFVK	234	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	37.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=15554	35.456211	2	1908.7402	1908.7402	K	A	323	339
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	235	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=24889	53.225238	3	3232.486324	3230.454500	R	C	257	285
PSM	KNLDSTTVAIHDEEIYCK	236	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	17-UNIMOD:4	ms_run[1]:scan=11063	26.686288	3	2136.025003	2135.020485	R	S	42	60
PSM	NADMSEEMQQDSVECATQALEK	237	sp|P63167|DYL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0	15-UNIMOD:4	ms_run[1]:scan=18666	41.098723	3	2513.034943	2513.035619	K	Y	10	32
PSM	DAAASASTPAQAPTSDSPVAEDASR	238	sp|P55789|ALR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	37.0		ms_run[1]:scan=9619	23.641992	3	2373.069971	2372.072791	R	R	43	68
PSM	AQTQEFQGSEDYETALSGK	239	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14161	32.749	2	2087.9284	2087.9284	K	E	358	377
PSM	CGETGHVAINCSK	240	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=4362	13.367	2	1431.6235	1431.6235	R	T	133	146
PSM	CPVAQLEQDDQVSPSSTFCK	241	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=14602	33.526	3	2295.0147	2295.0147	K	V	252	272
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	242	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	1-UNIMOD:4	ms_run[2]:scan=18749	41.251	5	3944.8639	3944.8639	R	L	201	238
PSM	DGEHVIDQGDDGDNFYVIDR	243	sp|P31323|KAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16255	36.7	3	2277.9774	2277.9774	K	G	177	197
PSM	DLETQIECLMSDQECVKR	244	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	8-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=24599	52.661	3	2253.0076	2253.0076	R	N	2318	2336
PSM	EMEENFAVEAANYQDTIGR	245	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	2-UNIMOD:35	ms_run[2]:scan=17930	39.722	2	2201.9535	2201.9535	R	L	346	365
PSM	EMEENFAVEAANYQDTIGR	246	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19556	42.91	3	2185.9586	2185.9586	R	L	346	365
PSM	ENLTAQVEHLQAAVVEAR	247	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19811	43.432	3	1977.028	1977.0280	K	A	1351	1369
PSM	EREEVLCQAGASEQLASQR	248	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	7-UNIMOD:4	ms_run[2]:scan=10617	25.741	3	2160.0229	2160.0229	R	L	950	969
PSM	FSAEQDAFLQEAQEQHAR	249	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14709	33.741	3	2103.961	2103.9610	K	E	882	900
PSM	GANAVGYTNYPDNVVFK	250	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16337	36.845	2	1827.8792	1827.8792	R	F	645	662
PSM	GNFGGSFAGSFGGAGGHAPGVAR	251	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14389	33.153	3	2033.9456	2033.9456	R	K	589	612
PSM	GPAVGIDLGTTYSCVGVFQHGK	252	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	14-UNIMOD:4	ms_run[2]:scan=18922	41.574	3	2262.1103	2262.1103	K	V	4	26
PSM	IGGVQQDTILAEGLHFR	253	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19452	42.722	3	1852.9795	1852.9795	R	I	55	72
PSM	ILLAELEQLKGQGK	254	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=17366	38.676	2	1538.9032	1538.9032	K	S	130	144
PSM	ITGLYPTLNISDEFSSNVANYQK	255	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=25757	55.116	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	256	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=26296	56.375	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	257	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=26781	57.639	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IVGDLAQFMVQNGLSR	258	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=23609	50.742	2	1746.9087	1746.9087	K	A	913	929
PSM	IVYTACSHAAVDALCEK	259	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=17697	39.311	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	260	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=18054	39.951	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	261	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=24818	53.088	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	262	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=25147	53.722	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	263	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28566	61.813	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	264	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=15880	36.038	3	1906.8917	1906.8917	R	A	1227	1244
PSM	KVESLQEEIAFLK	265	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=18795	41.336	2	1532.845	1532.8450	R	K	223	236
PSM	LGELQGEAASREDTICLLQNEK	266	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	16-UNIMOD:4	ms_run[2]:scan=16080	36.397	3	2473.2119	2473.2119	R	I	754	776
PSM	LIEMNGGGTGCNHELEMIR	267	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	11-UNIMOD:4	ms_run[2]:scan=14640	33.596	3	2129.9656	2129.9656	K	Q	3490	3509
PSM	LQEEMLQREEAENTLQSFR	268	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	5-UNIMOD:35	ms_run[2]:scan=15379	35.149	3	2366.1172	2366.1172	K	Q	189	208
PSM	LSSTQQSLAEKETHLTNLR	269	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=11208	26.939	4	2155.1233	2155.1233	K	A	895	914
PSM	LTQLEQSALQAELEKER	270	sp|Q7Z7A1-2|CNTRL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15836	35.962	3	1985.0429	1985.0429	R	Q	180	197
PSM	MVMIQDGPLPTGADKPLR	271	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=15012	34.392	3	1938.0067	1938.0067	K	I	196	214
PSM	PGLVDSNPAPPESQEK	272	sp|Q14061|COX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=9016	22.598	2	1663.8053	1663.8053	M	K	2	18
PSM	QVTALQEEGTLGLYHAQLK	273	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=16271	36.727	3	2098.1059	2098.1059	R	V	2622	2641
PSM	SAAQAAAQTNSNAAGK	274	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=2862	10.091	2	1459.7015	1459.7015	K	Q	53	69
PSM	SGGASHSELIHNLR	275	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=6540	17.497	3	1476.7433	1476.7433	K	K	5	19
PSM	SSEIEELKATIENLQENQK	276	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22654	48.918	3	2202.1016	2202.1016	R	R	1711	1730
PSM	TLLNAQPPVGAAYQDSPGEQK	277	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14078	32.605	3	2183.0859	2183.0859	K	G	1005	1026
PSM	TQLEELEDELQATEDAK	278	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=22428	48.51	2	1960.9113	1960.9113	K	L	1539	1556
PSM	TVAGGAWTYNTTSAVTVK	279	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=14743	33.809	2	1825.921	1825.9210	K	S	63	81
PSM	VETGVLKPGMVVTFAPVNVTTEVK	280	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	10-UNIMOD:35	ms_run[2]:scan=20567	44.895	3	2530.3717	2530.3717	R	S	267	291
PSM	VQIGEYTFEKGDYGDAVVYR	281	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=20888	45.475	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VSALNSVHCEHVEDEGESR	282	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0	9-UNIMOD:4	ms_run[2]:scan=7426	19.513	4	2152.9444	2152.9444	R	Y	1761	1780
PSM	WFNGQPIHAELSPVTDFR	283	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	36.0		ms_run[2]:scan=19743	43.271	3	2113.0381	2113.0381	R	E	134	152
PSM	MDGASAEQDGLQEDR	284	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	1-UNIMOD:1	ms_run[1]:scan=12516	29.469897	2	1663.681370	1662.679143	-	S	1	16
PSM	IVYTACSHAAVDALCEK	285	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=15245	34.898357	2	1908.9232	1906.8912	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	286	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=17330	38.608162	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	287	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=14188	32.795336	3	1906.890582	1906.891719	R	A	1227	1244
PSM	VGILCIMSDRDLYDK	288	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=15815	35.923847	2	1812.876291	1812.875007	K	L	1493	1508
PSM	KAYVEANQMLGDLIK	289	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0		ms_run[1]:scan=18616	41.006182	2	1691.899728	1691.891643	K	V	892	907
PSM	HGEEVTPEDVLSAAMYPDVFAHFK	290	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	15-UNIMOD:35	ms_run[1]:scan=23801	51.101924	3	2704.255598	2704.247919	R	D	998	1022
PSM	ALMLQGVDLLADAVAVTMGPK	291	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	18-UNIMOD:35	ms_run[1]:scan=27865	60.62548	3	2129.127235	2128.127199	R	G	38	59
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	292	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	36.0	1-UNIMOD:28	ms_run[1]:scan=16000	36.254214	3	2588.1401	2588.1419	R	G	244	269
PSM	LPAAGVGDMVMATVK	293	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	9-UNIMOD:35	ms_run[1]:scan=14778	33.880883	2	1474.752118	1474.752372	R	K	52	67
PSM	ADHQPLTEASYVNLPTIALCNTDSPLR	294	sp|P08865|RSSA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	36.0	20-UNIMOD:4	ms_run[1]:scan=22283	48.127645	3	2997.478722	2995.470936	R	Y	129	156
PSM	AATIVATSEGSLWGLDR	295	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20358	44.45	2	1745.8948	1745.8948	R	V	218	235
PSM	AEAEAQAEELSFPR	296	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=14030	32.523	2	1546.7264	1546.7264	R	S	929	943
PSM	AEQSIAELSSSENTLK	297	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13004	30.412	2	1705.837	1705.8370	R	T	573	589
PSM	ALAPTWEQLALGLEHSETVK	298	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=24522	52.508	3	2192.1477	2192.1477	K	I	222	242
PSM	ALDVGSGSGILTACFAR	299	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	14-UNIMOD:4	ms_run[2]:scan=19975	43.727	2	1693.8458	1693.8458	K	M	82	99
PSM	CPAEIVDTVSALVYDNK	300	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=24912	53.27	2	1892.919	1892.9190	R	L	1367	1384
PSM	CQHAAHIISELILTAQER	301	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	1-UNIMOD:4	ms_run[2]:scan=19633	43.048	3	2089.0739	2089.0739	R	D	310	328
PSM	DAEDAMDAMDGAVLDGR	302	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20097	43.938	2	1750.7138	1750.7138	R	E	67	84
PSM	DLYDKLQFTSLEIPR	303	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=22331	48.266	3	1836.9622	1836.9622	R	R	1503	1518
PSM	ELAGLHHSLSHSLLAVAQAPEATVLEAETR	304	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20304	44.345	5	3149.6469	3149.6469	R	R	2383	2413
PSM	FGIIRPGCALESTTAILQQK	305	sp|Q86U90|YRDC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=20343	44.426	3	2202.1831	2202.1831	K	Y	249	269
PSM	FLDPLPTSGITPGATVLTASGQTVGK	306	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=22631	48.876	3	2527.3534	2527.3534	R	F	284	310
PSM	FVDGLMIHSGDPVNYYVDTAVR	307	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=21277	46.18	3	2467.1842	2467.1842	K	H	152	174
PSM	GQVLPAHTLLNTVDVELIYEGVK	308	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=24860	53.169	3	2507.3635	2507.3635	R	Y	658	681
PSM	GVITHDVSSAINRPQIGVVR	309	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13066	30.519	4	2117.1705	2117.1705	K	E	1401	1421
PSM	GVITHDVSSAINRPQIGVVR	310	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13073	30.532	3	2117.1705	2117.1705	K	E	1401	1421
PSM	GVITHDVSSAINRPQIGVVR	311	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12798	29.988	5	2117.1705	2117.1705	K	E	1401	1421
PSM	HSQEIAQFQAELAEAR	312	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=15898	36.071	3	1826.8911	1826.8911	K	A	1247	1263
PSM	IAQLEEELEEEQGNTELINDR	313	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=19648	43.076	3	2471.1664	2471.1664	R	L	1731	1752
PSM	IGSFGPQEDLLFLR	314	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=24395	52.258	2	1590.8406	1590.8406	R	A	1688	1702
PSM	IHNANPELTDGQIQAMLR	315	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:35	ms_run[2]:scan=12368	29.168	3	2036.0109	2036.0109	K	R	2232	2250
PSM	IINEPTAAAIAYGLDKK	316	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16682	37.456	3	1786.9829	1786.9829	R	V	172	189
PSM	ISVMGGEQAANVLATITK	317	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	4-UNIMOD:35	ms_run[2]:scan=20713	45.155	2	1817.9557	1817.9557	R	D	470	488
PSM	IVYTACSHAAVDALCEK	318	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12259	28.979	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	319	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=12584	29.614	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	320	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=18731	41.219	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	321	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=19944	43.678	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	322	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=20294	44.314	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	323	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=21012	45.703	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	324	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=21715	46.967	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	325	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22029	47.603	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	326	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=23783	51.069	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	327	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=25764	55.131	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	328	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=26543	57.026	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	329	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=27338	59.236	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	330	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=27525	59.87	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	331	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=27798	60.507	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	332	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28169	61.152	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	333	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28920	62.464	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	334	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=32002	73.116	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	335	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=32348	73.752	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	336	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22665	48.939	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	337	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=29268	63.113	3	1906.8917	1906.8917	R	A	1227	1244
PSM	KQELEEICHDLEAR	338	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=13167	30.706	3	1768.8414	1768.8414	K	V	910	924
PSM	KQELEEICHDLEAR	339	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	8-UNIMOD:4	ms_run[2]:scan=13192	30.751	3	1768.8414	1768.8414	K	V	910	924
PSM	LASTEQTELLASKEDEDTIK	340	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12334	29.106	3	2220.1009	2220.1009	R	I	695	715
PSM	LILPVGPAGGNQMLEQYDK	341	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=21224	46.087	3	2042.0507	2042.0507	R	L	179	198
PSM	LQALANEQAAAAHELEK	342	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12549	29.545	3	1805.9272	1805.9272	K	M	654	671
PSM	LQELEAEQQQIQEER	343	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12308	29.06	2	1869.9068	1869.9068	R	E	1959	1974
PSM	LSGSDLGGHSSLLER	344	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=11431	27.345	2	1526.7689	1526.7689	R	L	2476	2491
PSM	LSPGSGGPEAQTAGPVTPASISGR	345	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12389	29.205	3	2193.1026	2193.1026	R	F	2351	2375
PSM	LVEALCAEHQINLIK	346	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	6-UNIMOD:4	ms_run[2]:scan=15828	35.947	2	1749.9447	1749.9447	K	V	64	79
PSM	NGSDGEEMTFSSLHQVR	347	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=12542	29.526	3	1892.8323	1892.8323	K	Y	1162	1179
PSM	NQAIDACDANTTPGGVTDVIK	348	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	7-UNIMOD:4	ms_run[2]:scan=13640	31.67	3	2159.0165	2159.0165	K	N	2144	2165
PSM	NQVAMNPTNTVFDAK	349	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=13594	31.557	2	1648.7879	1648.7879	K	R	57	72
PSM	NTHATTHNAYDLEVIDIFK	350	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=20050	43.855	3	2201.0753	2201.0753	K	I	820	839
PSM	RCPAEIVDTVSALVYDNK	351	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=20921	45.534	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	352	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=22261	48.068	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	353	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	2-UNIMOD:4	ms_run[2]:scan=22526	48.697	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RDNYVPEVSALDQEIIEVDPDTK	354	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=22086	47.715	3	2644.2868	2644.2868	R	E	81	104
PSM	RGSLPSHLQLADPQGSWQEQLAAPEEGETK	355	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=16610	37.327	4	3258.5905	3258.5905	R	I	1019	1049
PSM	SAGEEEDGPVLTDEQK	356	sp|Q66PJ3-7|AR6P4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8577	21.829	2	1702.7534	1702.7534	R	S	137	153
PSM	SGNSDVYENEIPGGQYTNLHFQAHSMGLGSK	357	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	26-UNIMOD:35	ms_run[2]:scan=15525	35.407	4	3352.5055	3352.5055	K	F	856	887
PSM	SGQVEHLQQETAALKK	358	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=8424	21.486	3	1765.9323	1765.9323	K	Q	821	837
PSM	SHKPPISFPLCANGQVFGLYK	359	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	11-UNIMOD:4	ms_run[2]:scan=19510	42.828	3	2359.2147	2359.2147	K	N	997	1018
PSM	SLESTTLTEKEGEIYCK	360	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	16-UNIMOD:4	ms_run[2]:scan=12241	28.946	3	1986.9456	1986.9456	K	G	152	169
PSM	TNEKVELQELNDR	361	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=9721	23.859	2	1586.79	1586.7900	R	F	101	114
PSM	TPWLYEQEGEVEKPFIK	362	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=18908	41.55	3	2092.0517	2092.0517	R	T	1209	1226
PSM	TVGTQDTPYMVNGQEIPADTLGQFPSIK	363	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=22437	48.526	3	3006.4645	3006.4645	K	D	335	363
PSM	TVQDLTSVVQTLLQQMQDK	364	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=28061	60.965	2	2174.1253	2174.1253	K	F	8	27
PSM	VGLNQQLLQLEEENQSVCSR	365	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	18-UNIMOD:4	ms_run[2]:scan=19855	43.52	3	2343.1489	2343.1489	K	M	613	633
PSM	VMTIPYQPMPASSPVICAGGQDR	366	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0	17-UNIMOD:4	ms_run[2]:scan=19114	41.921	3	2474.1756	2474.1756	R	C	178	201
PSM	VQIGEYTFEKGDYGDAVVYR	367	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	35.0		ms_run[2]:scan=27985	60.831	3	2308.1012	2308.1012	K	G	1116	1136
PSM	AQVVDLLQQELTAAEQR	368	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=24771	53.000819	2	1913.013889	1911.006155	R	N	272	289
PSM	GALLLSSIELEELKAENEK	369	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=20425	44.608672	3	2086.122309	2085.120516	K	L	485	504
PSM	VQIGEYTFEKGDYGDAVVYR	370	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=27634	60.187762	3	2309.103553	2308.101178	K	G	1116	1136
PSM	IVYTACSHAAVDALCEK	371	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=15520	35.395335	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	372	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=26044	55.765587	3	1908.902934	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	373	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=26709	57.446604	3	1906.891468	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	374	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=18972	41.664874	3	1906.891070	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	375	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=16963	37.955054	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	376	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=15191	34.765595	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	377	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=14919	34.137848	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	378	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=19077	41.857806	3	1907.894596	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	379	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=29605	63.741887	3	1907.894343	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	380	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=16241	36.679103	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	381	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13868	32.15112	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	382	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=25611	54.754438	3	1906.890081	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	383	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=23124	49.793196	3	1907.893556	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	384	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=26550	57.039857	3	1906.891468	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	385	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13258	30.880514	3	1906.890537	1906.891719	R	A	1227	1244
PSM	LRDVLSSNEATMQSMESLLR	386	sp|Q5VU43|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0		ms_run[1]:scan=22793	49.167494	3	2280.127732	2279.124966	R	A	523	543
PSM	LPAAGVGDMVMATVK	387	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	35.0	9-UNIMOD:35	ms_run[1]:scan=14712	33.745738	2	1474.752118	1474.752372	R	K	52	67
PSM	AAGVEAAAEVAATEIK	388	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=25779	55.163	2	1541.7937	1541.7937	M	M	2	18
PSM	AQQNNVEHKVETFSGVYK	389	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11230	26.977	4	2077.0229	2077.0229	K	K	161	179
PSM	CTLCSQPGATIGCEIK	390	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=12588	29.623	2	1793.811	1793.8110	K	A	246	262
PSM	DVLQAAAAEHQDQGQEVNGEVR	391	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11390	27.269	3	2363.1102	2363.1102	K	S	363	385
PSM	EADIDGDGQVNYEEFVQMMTAK	392	sp|P0DP25|CALM3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25879	55.386	3	2489.0727	2489.0727	R	-	128	150
PSM	EGATTCGYLPQNAVVK	393	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=12582	29.609	2	1706.8298	1706.8298	K	I	352	368
PSM	EIVHLQAGQCGNQIGAK	394	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	10-UNIMOD:4	ms_run[2]:scan=9419	23.297	2	1821.9156	1821.9156	R	F	3	20
PSM	ELEQVCNPIISGLYQGAGGPGPGGFGAQGPK	395	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=23139	49.821	3	3054.4869	3054.4869	K	G	598	629
PSM	FIELEQEKNTELMDLR	396	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17690	39.299	3	2006.9983	2006.9983	R	Q	2037	2053
PSM	GPEPEQMGLAPCCTQALCGLALR	397	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4,13-UNIMOD:4,18-UNIMOD:4	ms_run[2]:scan=21123	45.91	3	2528.1644	2528.1644	R	H	703	726
PSM	GQAAVQQLQAEGLSPR	398	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=12754	29.911	2	1651.8642	1651.8642	R	F	43	59
PSM	HEVTICNYEASANPADHR	399	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=9188	22.893	3	2082.9178	2082.9178	R	V	181	199
PSM	HFQHQATIAELELEK	400	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11911	28.282	3	1792.9108	1792.9108	K	T	1444	1459
PSM	HQQEAATTQLEQLHQEAK	401	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8638	21.929	4	2089.0188	2089.0188	R	R	701	719
PSM	IGSLGLGTGEDDDYVDDFNSTSHR	402	sp|O95684-3|CEP43_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17663	39.25	3	2569.1205	2569.1205	K	S	75	99
PSM	IINEPTAAAIAYGLDR	403	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19742	43.269	3	1686.8941	1686.8941	R	T	172	188
PSM	IISLLSGKEEAIQVAIAELR	404	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=25687	54.942	3	2152.2467	2152.2467	K	Q	2389	2409
PSM	ILLAELEQLKGQGK	405	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17380	38.714	2	1538.9032	1538.9032	K	S	130	144
PSM	ITDIIGKEEGIGPENLR	406	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15005	34.371	3	1852.9894	1852.9894	K	G	1782	1799
PSM	IVYTACSHAAVDALCEK	407	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=18388	40.583	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	408	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=23446	50.421	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	409	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=24117	51.707	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	410	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=24441	52.355	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	411	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=26305	56.399	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	412	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=26786	57.654	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	413	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=27130	58.597	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	414	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=28141	61.101	2	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	415	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=16597	37.308	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	416	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22344	48.304	3	1906.8917	1906.8917	R	A	1227	1244
PSM	KAVFISPYNSQNAVASK	417	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=11149	26.836	3	1822.9577	1822.9577	R	I	1431	1448
PSM	KEGPYDVVVLPGGNLGAQNLSESAAVK	418	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=18592	40.967	3	2711.413	2711.4130	K	E	63	90
PSM	KFEEEGNPYYSSAR	419	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=8950	22.472	2	1675.7478	1675.7478	K	V	512	526
PSM	KSEIEYYAMLAK	420	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=15457	35.286	2	1444.7272	1444.7272	R	T	57	69
PSM	KVDGSVNAYAINVSQK	421	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=10222	24.857	2	1691.8842	1691.8842	K	R	119	135
PSM	LPAAGVGDMVMATVK	422	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19385	42.58	2	1458.7575	1458.7575	R	K	52	67
PSM	LQGAEEAAELQLAELER	423	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=20934	45.557	2	1868.948	1868.9480	R	N	1824	1841
PSM	LQQELDDLLVDLDHQR	424	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23482	50.489	3	1948.9854	1948.9854	R	Q	1418	1434
PSM	LSGLANVVLHELSGDDDTDQNMR	425	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24375	52.218	3	2498.1707	2498.1707	R	A	5	28
PSM	LVEALCAEHQINLIK	426	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=15780	35.863	3	1749.9447	1749.9447	K	V	64	79
PSM	MDEEENHYVSQLR	427	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=15252	34.911	2	1690.7257	1690.7257	-	E	1	14
PSM	MGGQPAFTDLEVITNRPK	428	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17778	39.452	3	1973.004	1973.0040	R	G	3735	3753
PSM	MNPVYSPGSSGVPYANAK	429	sp|A1KXE4-2|F168B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	1-UNIMOD:1	ms_run[2]:scan=17641	39.211	2	1879.8774	1879.8774	-	G	1	19
PSM	MREIVHLQAGQCGNQIGAK	430	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	12-UNIMOD:4	ms_run[2]:scan=9458	23.362	3	2109.0572	2109.0572	-	F	1	20
PSM	NTCVGSDNVTDFNALATCDWTNAGDYILANTCTER	431	cov|corona13076|ORF1b_SouthAfrica/KRISP-0113/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	3-UNIMOD:4,18-UNIMOD:4,32-UNIMOD:4	ms_run[2]:scan=26668	57.326	4	3938.6782	3938.6782	K	L	1018	1053
PSM	PGIVELPTLEELKVDEVK	432	sp|P51970|NDUA8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22164	47.858	3	2007.114	2007.1140	M	I	2	20
PSM	QITEEDLEGKTEEEIEMMK	433	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19586	42.961	3	2281.0341	2281.0341	R	L	87	106
PSM	QQILTHQQQLEEQDHLLEDYQK	434	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=13233	30.833	4	2763.3464	2763.3464	K	K	268	290
PSM	QQLAGCQEAVNLLQQQHDQWEEEGK	435	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4	ms_run[2]:scan=18877	41.495	3	2965.3624	2965.3624	R	A	407	432
PSM	RCPAEIVDTVSALVYDNK	436	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=22457	48.568	3	2049.0201	2049.0201	R	L	1366	1384
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	437	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=20048	43.852	3	3010.3875	3010.3875	K	F	396	424
PSM	SGNSDVYENEIPGGQYTNLHFQAHSMGLGSK	438	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=17083	38.165	4	3336.5106	3336.5106	K	F	856	887
PSM	SHKPPISFPLCANGQVFGLYK	439	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	11-UNIMOD:4	ms_run[2]:scan=19495	42.802	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHLLNCCPHDVLSGTR	440	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9639	23.679	3	1864.8672	1864.8672	K	M	38	54
PSM	SHLLNCCPHDVLSGTR	441	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9653	23.706	3	1864.8672	1864.8672	K	M	38	54
PSM	SKSEEAHAEDSVMDHHFR	442	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=7461	19.579	4	2110.9127	2110.9127	K	K	313	331
PSM	SQWEFEKDELTQECAEAQELLK	443	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	14-UNIMOD:4	ms_run[2]:scan=22880	49.347	3	2710.2432	2710.2432	K	E	856	878
PSM	SVTNEDVTQEELGGAK	444	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9868	24.203	2	1675.7901	1675.7901	K	T	233	249
PSM	TGQELQSACDALKDQNSK	445	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	9-UNIMOD:4	ms_run[2]:scan=10072	24.593	3	1991.9218	1991.9218	K	L	392	410
PSM	TIEDAIAVLSVAEEAADRHPER	446	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=23476	50.477	4	2391.203	2391.2030	R	R	146	168
PSM	TLSYLLPAIVHINHQPFLER	447	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=22427	48.509	4	2360.3005	2360.3005	K	G	145	165
PSM	TTTELFHSNEESGFFNELEALR	448	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=24532	52.528	3	2570.1925	2570.1925	K	A	2666	2688
PSM	VCIESEHSMDTLLATLKK	449	sp|O00244|ATOX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=18551	40.898	3	2074.0439	2074.0439	K	T	40	58
PSM	VEAVNMAEGIIHDTETK	450	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=19216	42.174	3	1855.8986	1855.8986	R	M	579	596
PSM	VGLLCIMSDRDLYDK	451	cov|corona06480|ORF1b_Norway/2505/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	5-UNIMOD:4	ms_run[2]:scan=20184	44.095	2	1796.8801	1796.8801	K	L	1493	1508
PSM	VYVGNLGNNGNKTELER	452	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9689	23.777	3	1875.9439	1875.9439	K	A	12	29
PSM	YCALAPNMMVTNNTFTLK	453	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0	2-UNIMOD:4	ms_run[2]:scan=21248	46.129	3	2087.9842	2087.9842	K	G	799	817
PSM	YMPAVTSTPTVNQHETSTSK	454	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	34.0		ms_run[2]:scan=9295	23.088	3	2178.0263	2178.0263	K	S	788	808
PSM	SHKPPISFPLCANGQVFGLYK	455	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	11-UNIMOD:4	ms_run[1]:scan=20170	44.071709	4	2360.199709	2359.214708	K	N	997	1018
PSM	ITGLYPTLNISDEFSSNVANYQK	456	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=27417	59.528429	3	2573.264636	2573.264949	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	457	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=25475	54.479348	3	2574.267107	2573.264949	R	V	1172	1195
PSM	IVYTACSHAAVDALCEK	458	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=12906	30.243248	3	1906.890537	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	459	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13580	31.516799	3	1906.890582	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	460	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=20102	43.950028	3	1906.889460	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	461	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=14548	33.43378	3	1906.890582	1906.891719	R	A	1227	1244
PSM	AKHYVYIGDPAQLPAPR	462	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=11965	28.373694	3	1895.008307	1895.005367	R	T	1316	1333
PSM	AYHEQLTVAEITNACFEPANQMVK	463	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	15-UNIMOD:4	ms_run[1]:scan=19507	42.823828	3	2764.299919	2763.299637	K	C	281	305
PSM	SYELPDGQVITIGNER	464	sp|P62736|ACTA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=19929	43.649631	2	1789.885391	1789.884643	K	F	241	257
PSM	ITAEEMSALIEER	465	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0		ms_run[1]:scan=20565	44.892443	2	1490.728490	1490.728660	R	D	258	271
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	466	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	34.0	32-UNIMOD:4	ms_run[1]:scan=27712	60.356475	4	4033.892806	4030.885455	K	F	1448	1484
PSM	AAITILDGISQYSLR	467	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=23643	50.808	2	1619.8883	1619.8883	K	L	565	580
PSM	AEAQQVEALPGPSLDQWHR	468	sp|Q66PJ3-7|AR6P4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15918	36.104	3	2131.0447	2131.0447	K	S	118	137
PSM	AQLEAHLGQVMESVR	469	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15636	35.611	2	1666.8461	1666.8461	R	Q	373	388
PSM	AQVVDLLQQELTAAEQR	470	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=24735	52.929	3	1911.0062	1911.0062	R	N	277	294
PSM	ASEELQKDLEEVK	471	sp|Q9HB71|CYBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=18808	41.367	2	1558.7726	1558.7726	M	V	2	15
PSM	AVCMLSNTTAIAEAWAR	472	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=22941	49.461	2	1863.8971	1863.8971	R	L	374	391
PSM	AVCMLSNTTAVAEAWAR	473	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	3-UNIMOD:4	ms_run[2]:scan=21138	45.936	2	1849.8815	1849.8815	R	L	374	391
PSM	CCYDHVISTSHK	474	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=5633	15.821	2	1505.6391	1505.6391	K	L	952	964
PSM	CPAEIVDTVSALVYDNK	475	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:4	ms_run[2]:scan=25174	53.774	3	1892.919	1892.9190	R	L	1367	1384
PSM	DKLESEMEDAYHEHQANLLR	476	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16164	36.544	4	2427.1125	2427.1125	K	Q	517	537
PSM	DLEAEHVEVEDTTLNR	477	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12558	29.563	3	1868.8752	1868.8752	R	C	15	31
PSM	DMAGLLKPTACTMLVSSLR	478	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=19677	43.129	3	2079.0527	2079.0527	K	D	742	761
PSM	DTLAGQTVDLQGEVDSLSK	479	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20030	43.822	2	1974.9746	1974.9746	R	E	445	464
PSM	DVDTDFVNEFYAYLR	480	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=27886	60.663	2	1865.8472	1865.8472	R	K	727	742
PSM	DYQDNKADVILK	481	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9858	24.177	2	1420.7198	1420.7198	R	Y	83	95
PSM	ECPSDECGAGVFMASHFDR	482	sp|P62979|RS27A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	2-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=15954	36.168	3	2170.8507	2170.8507	R	H	120	139
PSM	ELEGLAGQLQAQVQDNEGLSR	483	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20936	45.56	2	2254.119	2254.1190	K	L	475	496
PSM	ELLLGQLFLTEQEVSGEHLDGK	484	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=26162	56.017	3	2454.2642	2454.2642	R	T	801	823
PSM	EQEIVVLQQQLQEAR	485	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19127	41.943	2	1809.9585	1809.9585	R	E	1777	1792
PSM	GVITHDVSSAINRPQIGVVR	486	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12745	29.899	3	2117.1705	2117.1705	K	E	1401	1421
PSM	HGEISFLNEEVK	487	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=13445	31.218	2	1400.6936	1400.6936	K	S	970	982
PSM	HLYTLDGGDIINALCFSPNR	488	sp|P63244|RACK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:4	ms_run[2]:scan=23530	50.595	3	2275.1056	2275.1056	K	Y	226	246
PSM	HTPLVEFEEEESDKR	489	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11596	27.644	3	1843.8588	1843.8588	R	E	708	723
PSM	IHNANPELTDGQIQAMLR	490	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=16536	37.196	3	2020.016	2020.0160	K	R	2232	2250
PSM	IIQQAGQVWFPDSAFK	491	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21384	46.375	2	1833.9414	1833.9414	K	T	2010	2026
PSM	IMDQAITVGAPVIGLNDSGGAR	492	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=19675	43.126	3	2154.1103	2154.1103	K	I	144	166
PSM	ITGLYPTLNISDEFSSNVANYQK	493	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20198	44.121	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	494	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=28340	61.435	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	495	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=28751	62.136	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IYAEDPSNNFMPVAGPLVHLSTPR	496	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21485	46.555	3	2624.3057	2624.3057	R	A	386	410
PSM	KELEGLAGQLQAQVQDNEGLSR	497	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17959	39.774	3	2382.2139	2382.2139	R	L	474	496
PSM	LEMEENQLKNEMQDAK	498	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=12450	29.312	3	1948.887	1948.8870	R	D	573	589
PSM	LGPGQSEIAEELCQR	499	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	13-UNIMOD:4	ms_run[2]:scan=15359	35.114	2	1685.8043	1685.8043	K	L	768	783
PSM	LLEAISETSSQLEHAK	500	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14981	34.291	3	1754.905	1754.9050	K	V	1857	1873
PSM	LLHYLGHVMVNGPTTPIPVK	501	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=15506	35.37	3	2185.2082	2185.2082	K	A	500	520
PSM	LNRLPAAGVGDMVMATVK	502	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18606	40.991	3	1841.9856	1841.9856	R	K	49	67
PSM	LQVELDNVTGLLSQSDSK	503	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22112	47.762	2	1945.0004	1945.0004	K	S	1278	1296
PSM	MQQNIQELEEQLEEEESAR	504	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21316	46.25	3	2332.0489	2332.0489	K	Q	941	960
PSM	MREIVHLQAGQCGNQIGAK	505	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	12-UNIMOD:4	ms_run[2]:scan=9455	23.358	4	2109.0572	2109.0572	-	F	1	20
PSM	MSATFIGNSTAIQELFK	506	sp|P68371|TBB4B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=25207	53.845	2	1856.9342	1856.9342	K	R	363	380
PSM	NLDQEQLSQVLDAMFER	507	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=27632	60.182	2	2034.9681	2034.9681	K	I	142	159
PSM	NQEVDLQQEQIQELEK	508	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=14928	34.154	2	1969.9593	1969.9593	R	C	1469	1485
PSM	QAEAVTALEQQVASLDK	509	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22814	49.207	2	1799.9265	1799.9265	K	H	1456	1473
PSM	QLQDQQAAQILDLER	510	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17949	39.754	2	1767.9115	1767.9115	R	S	798	813
PSM	QLQDQQAAQILDLER	511	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17974	39.8	3	1767.9115	1767.9115	R	S	798	813
PSM	QLQQAAQEQAALREECTR	512	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4	ms_run[2]:scan=9670	23.736	3	2129.0284	2129.0284	R	L	1371	1389
PSM	SAGVQCFGPTAEAAQLESSKR	513	sp|P22102-2|PUR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	6-UNIMOD:4	ms_run[2]:scan=13285	30.93	3	2193.0484	2193.0484	R	F	88	109
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	514	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=20704	45.138	3	3010.3875	3010.3875	K	F	396	424
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	515	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	16-UNIMOD:4	ms_run[2]:scan=22452	48.558	4	2994.3925	2994.3926	K	F	396	424
PSM	SGDHLHNDSQIEADFR	516	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	1-UNIMOD:1	ms_run[2]:scan=11869	28.212	2	1881.8242	1881.8242	M	L	2	18
PSM	SLADVESQVSAQNK	517	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11950	28.348	2	1474.7264	1474.7264	K	E	1524	1538
PSM	SLSAVPDIGQCHQDELER	518	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	11-UNIMOD:4	ms_run[2]:scan=13029	30.456	3	2052.9535	2052.9535	K	L	676	694
PSM	SQEVIWGLQEQLQDTAR	519	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=21151	45.959	3	1999.9963	1999.9963	K	G	686	703
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	520	sp|P26038|MOES_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=11505	27.481	3	3311.412	3311.4120	K	A	465	496
PSM	TDQAQKAEGAGDAK	521	sp|P05204|HMGN2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=2118	8.6966	3	1388.6532	1388.6532	K	-	77	91
PSM	TVTNAVVTVPAYFNDSQR	522	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18168	40.166	3	1980.9905	1980.9905	K	Q	138	156
PSM	VEQLGAEGNVEESQK	523	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=7747	20.177	2	1615.7689	1615.7689	K	V	140	155
PSM	VINEPTAAALAYGLDK	524	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=18648	41.065	3	1644.8723	1644.8723	R	S	219	235
PSM	VINEPTAAALAYGLDKSEDK	525	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17028	38.066	3	2104.0688	2104.0688	R	V	219	239
PSM	VQIGEYTFEKGDYGDAVVYR	526	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=20534	44.84	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	527	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22157	47.845	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	528	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=22532	48.706	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQNLEDTVQNVNLQMSR	529	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17496	38.97	2	1986.9793	1986.9793	K	M	1768	1785
PSM	VRPCVVYGGADIGQQIR	530	sp|O00571-2|DDX3X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	4-UNIMOD:4	ms_run[2]:scan=12750	29.905	3	1886.9785	1886.9785	R	D	279	296
PSM	VSLPEDGQCPLHCEQIGEMK	531	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0	9-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=13962	32.395	3	2326.0392	2326.0392	R	A	1803	1823
PSM	VYVGNLGNNGNKTELER	532	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=9679	23.756	3	1875.9439	1875.9439	K	A	12	29
PSM	YQEDVQQLQQALAQR	533	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	33.0		ms_run[2]:scan=17369	38.681	2	1816.9068	1816.9068	R	D	2033	2048
PSM	CCYDHVISTSHK	534	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=5789	16.137614	2	1505.637112	1505.639133	K	L	952	964
PSM	TILGSALLEDEFTPFDVVR	535	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=27490	59.765063	3	2121.098660	2121.099387	R	Q	3543	3562
PSM	GHENVEAAQAEYIEK	536	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=8812	22.221346	2	1687.789464	1686.784929	K	F	475	490
PSM	TLSYLLPAIVHINHQPFLER	537	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=22499	48.648402	4	2360.301807	2360.300487	K	G	145	165
PSM	GPADSLSTAAGAAELSAEGAGK	538	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0		ms_run[1]:scan=16646	37.393714	3	1930.932527	1929.927964	R	S	268	290
PSM	LGEMWNNTAADDKQPYEK	539	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	33.0	4-UNIMOD:35	ms_run[1]:scan=10011	24.458166	3	2125.934286	2124.942235	K	K	129	147
PSM	AEYLASIFGTEKDK	540	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	33.0	1-UNIMOD:1	ms_run[1]:scan=26621	57.211579	2	1612.8002	1612.7979	M	V	2	16
PSM	AAVEWFDGKDFQGSK	541	sp|Q01844-6|EWS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15592	35.532	3	1683.7893	1683.7893	K	L	369	384
PSM	AGDPLDLVALAEQVQK	542	sp|Q9BV19|CA050_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=25419	54.363	2	1665.8938	1665.8938	R	A	50	66
PSM	AQASAAGILEEDLR	543	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17722	39.354	2	1442.7365	1442.7365	R	T	1369	1383
PSM	ASCTLSEQLDFIDTK	544	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=19270	42.307	2	1726.8084	1726.8084	K	R	211	226
PSM	ATEETFKLSYGIATVR	545	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16180	36.573	3	1784.9309	1784.9309	K	E	1063	1079
PSM	AVFISPYNSQNAVASK	546	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13606	31.59	2	1694.8628	1694.8628	K	I	1432	1448
PSM	DCDLQEDACYNCGR	547	sp|P62633-2|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9713	23.842	2	1774.6345	1774.6345	K	G	59	73
PSM	DFTATFGPLDSLNTR	548	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22585	48.798	2	1653.7999	1653.7999	K	L	1022	1037
PSM	DSQQAPLDGEVELLQQK	549	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=18428	40.653	3	1896.9429	1896.9429	R	L	1519	1536
PSM	ELEGLAGQLQAQVQDNEGLSR	550	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20878	45.457	3	2254.119	2254.1190	K	L	475	496
PSM	ELVFKEDGQEYAQVIK	551	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15434	35.246	3	1894.9676	1894.9676	R	M	25	41
PSM	ERQQFEGYGLEIPDILNASNLK	552	sp|Q96EY4|TMA16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=24146	51.759	3	2533.2813	2533.2813	R	T	120	142
PSM	ESTGAQVQVAGDMLPNSTER	553	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13752	31.879	3	2088.9746	2088.9746	R	A	125	145
PSM	FDSNNVVLIEDNGNPVGTR	554	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16549	37.219	3	2058.997	2058.9970	R	I	100	119
PSM	GALLLSSIELEELKAENEK	555	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20467	44.718	3	2085.1205	2085.1205	K	L	490	509
PSM	GANAVGYTNYPDNVVFK	556	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16358	36.883	3	1827.8792	1827.8792	R	F	645	662
PSM	GGSDDSSKDPIDVNYEK	557	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9228	22.965	3	1824.8014	1824.8014	R	L	780	797
PSM	GLTVDSILQTDDATLGK	558	sp|P78549-3|NTH_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20877	45.455	2	1745.9047	1745.9047	R	L	143	160
PSM	GVITHDVSSAINRPQIGVVR	559	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12734	29.879	4	2117.1705	2117.1705	K	E	1401	1421
PSM	HSQEIAQFQAELAEAR	560	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15938	36.142	2	1826.8911	1826.8911	K	A	1247	1263
PSM	IINEPTAAAIAYGLDKR	561	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17230	38.438	3	1814.989	1814.9890	R	E	198	215
PSM	IKGEHPGLSIGDVAK	562	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8916	22.398	3	1519.8358	1519.8358	K	K	113	128
PSM	ISVMGGEQAANVLATITK	563	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=23153	49.85	3	1801.9608	1801.9608	R	D	470	488
PSM	ITGLYPTLNISDEFSSNVANYQK	564	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=30051	64.693	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IVETEAYLGPEDEAAHSR	565	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11558	27.573	3	1985.933	1985.9330	R	G	104	122
PSM	IVYTACSHAAVDALCEK	566	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=20662	45.063	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	567	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=29937	64.419	3	1906.8917	1906.8917	R	A	1227	1244
PSM	KGDEVDGVDEVAK	568	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=6514	17.454	2	1359.6518	1359.6518	R	K	209	222
PSM	KPLPDHVSIVEPK	569	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9414	23.29	3	1457.8242	1457.8242	K	D	202	215
PSM	KSFNDDAMLIEK	570	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=11771	28.028	2	1409.6861	1409.6861	K	F	237	249
PSM	LDNASAFQGAVISPHYDSLLVK	571	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19636	43.053	3	2344.2063	2344.2063	R	V	407	429
PSM	LENVSLSQQLTETQHR	572	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12166	28.808	3	1881.9545	1881.9545	K	S	615	631
PSM	LITSNTDASDGDSVALVK	573	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12482	29.372	2	1804.9054	1804.9054	K	E	1130	1148
PSM	LKEQETTGILQTQLQEAQR	574	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13726	31.832	3	2213.1652	2213.1652	K	E	960	979
PSM	LLTQDEGPALVPGGR	575	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=13552	31.44	2	1521.8151	1521.8151	R	L	198	213
PSM	LQNELDNVSTLLEEAEKK	576	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22573	48.777	3	2072.0637	2072.0637	K	G	1285	1303
PSM	LTNENMEITSALQSEQHVK	577	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=12923	30.274	3	2187.0478	2187.0478	K	R	559	578
PSM	MDEPSPLAQPLELNQHSR	578	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=18904	41.544	2	2103.0055	2103.0055	-	F	1	19
PSM	NDSLLQTLSPDSEHVTLKR	579	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15060	34.508	4	2152.1124	2152.1124	R	I	3674	3693
PSM	NGPGFHNDIDSNSTIQEILIPASK	580	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19850	43.51	3	2566.2663	2566.2663	R	V	150	174
PSM	NLDSTTVAIHDEEIYCK	581	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	16-UNIMOD:4	ms_run[2]:scan=13283	30.928	3	2006.9255	2006.9255	K	S	43	60
PSM	NTDQASMPDNTAAQK	582	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5279	15.16	2	1590.6944	1590.6944	R	V	359	374
PSM	NTDQASMPDNTAAQK	583	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=5295	15.188	2	1590.6944	1590.6944	R	V	359	374
PSM	NVGTGLVGAPACGDVMK	584	sp|Q9H1K1-2|ISCU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=13366	31.079	2	1644.7964	1644.7964	K	L	33	50
PSM	QAEAVTALEQQVASLDK	585	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22818	49.215	3	1799.9265	1799.9265	K	H	1456	1473
PSM	QAHLCVLASNCDEPMYVK	586	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	5-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=13738	31.852	3	2133.9646	2133.9646	R	L	46	64
PSM	QAVTNPNNTFYATK	587	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9708	23.826	2	1567.7631	1567.7631	R	R	108	122
PSM	QGVHAAGAAEAGPLASVPAQSAK	588	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9985	24.414	3	2087.076	2087.0760	K	K	269	292
PSM	QHRDDLAALQEESSSLLQDK	589	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17619	39.176	3	2282.1139	2282.1139	R	M	986	1006
PSM	QVQSLTCEVDALKGTNESLER	590	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	7-UNIMOD:4	ms_run[2]:scan=16257	36.703	3	2376.1591	2376.1591	R	Q	322	343
PSM	RFDDAVVQSDMK	591	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=9744	23.917	2	1409.6609	1409.6609	R	H	77	89
PSM	RGPLLTALSAEAVASALHK	592	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20102	43.95	3	1904.0843	1904.0843	K	L	1229	1248
PSM	SECQDMSLSSPTSVLGGSR	593	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	3-UNIMOD:4	ms_run[2]:scan=15493	35.345	2	1996.883	1996.8830	K	H	2183	2202
PSM	SGDHLHNDSQIEADFR	594	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=11800	28.094	3	1881.8242	1881.8242	M	L	2	18
PSM	SHFAIGLALYYPSAR	595	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20400	44.53	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	596	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=19805	43.415	2	1664.8675	1664.8675	K	I	1212	1227
PSM	SHLLNCCPHDVLSGTR	597	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9657	23.712	4	1864.8672	1864.8672	K	M	38	54
PSM	SLQESDSINNLQAELNK	598	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16387	36.932	2	1901.933	1901.9330	K	I	570	587
PSM	SMMQDREDQSILCTGESGAGK	599	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=11857	28.189	3	2298.9879	2298.9879	R	T	160	181
PSM	SSEPPPPPQPPTHQASVGLLDTPR	600	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	1-UNIMOD:1	ms_run[2]:scan=15247	34.901	3	2546.2765	2546.2765	M	S	2	26
PSM	TGEAIVDAALSALR	601	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=25144	53.715	2	1385.7514	1385.7514	R	Q	116	130
PSM	TIGTGLVTNTLAMTEEEK	602	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20010	43.789	2	1906.9558	1906.9558	R	N	430	448
PSM	TQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAEVK	603	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17479	38.939	4	4081.9222	4081.9222	K	A	319	353
PSM	TTGFGMIYDSLDYAK	604	sp|P62847-2|RS24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22730	49.055	2	1680.7705	1680.7705	K	K	69	84
PSM	TVAIHSDVDASSVHVK	605	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8129	20.953	3	1663.8529	1663.8529	K	M	89	105
PSM	VEAVNMAEGIIHDTETK	606	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	6-UNIMOD:35	ms_run[2]:scan=13996	32.458	3	1871.8935	1871.8935	R	M	579	596
PSM	VEQLGAEGNVEESQK	607	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=7738	20.152	2	1615.7689	1615.7689	K	V	140	155
PSM	VEQLGAEGNVEESQK	608	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=8048	20.809	2	1615.7689	1615.7689	K	V	140	155
PSM	VGNLGLATSFFNER	609	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=21854	47.222	2	1523.7732	1523.7732	R	N	519	533
PSM	VIAINVDDPDAANYNDINDVKR	610	sp|Q15181|IPYR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=15419	35.22	3	2443.1979	2443.1979	K	L	156	178
PSM	VINEPTAAALAYGLDKSEDK	611	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17067	38.135	3	2104.0688	2104.0688	R	V	219	239
PSM	VPTANVSVVDLTCR	612	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	13-UNIMOD:4	ms_run[2]:scan=15350	35.101	2	1529.7872	1529.7872	R	L	235	249
PSM	VQNLEDTVQNVNLQMSR	613	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=17464	38.914	3	1986.9793	1986.9793	K	M	1768	1785
PSM	VRTDITYPAGFMDVISIDK	614	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22822	49.225	3	2140.0874	2140.0874	K	T	76	95
PSM	VSQMNSLEQELETIHLENEGLK	615	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=22440	48.533	3	2540.2428	2540.2428	K	K	1926	1948
PSM	VTVAGLAGKDPVQCSR	616	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	14-UNIMOD:4	ms_run[2]:scan=10496	25.508	3	1656.8617	1656.8617	K	D	33	49
PSM	VVHSYEELEENYTR	617	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=12294	29.037	2	1766.8111	1766.8111	R	A	206	220
PSM	VWAVLPSSPEACGAASLQER	618	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	12-UNIMOD:4	ms_run[2]:scan=18975	41.669	3	2127.0419	2127.0419	R	A	159	179
PSM	WFNGQPIHAELSPVTDFR	619	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20082	43.915	3	2113.0381	2113.0381	R	E	134	152
PSM	YDEALENNKELTAEVFR	620	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=16443	37.035	3	2039.98	2039.9800	R	L	1273	1290
PSM	YGDGGSTFQSTTGHCVHMR	621	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0	15-UNIMOD:4	ms_run[2]:scan=8270	21.203	4	2096.8793	2096.8793	R	G	276	295
PSM	YPSPPMGSVSAPNLPTAEDNLEYVR	622	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	32.0		ms_run[2]:scan=20378	44.485	3	2703.285	2703.2850	R	T	105	130
PSM	TDCNHIFLNFVPTVIMDPSKIEESVR	623	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:4	ms_run[1]:scan=25892	55.417106	4	3060.508480	3060.504879	R	S	1468	1494
PSM	ITDIIGKEEGIGPENLR	624	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=14914	34.127131	3	1852.987286	1852.989442	K	G	1782	1799
PSM	QHMADLEGHLQSAQK	625	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	32.0	1-UNIMOD:28	ms_run[1]:scan=11534	27.530025	3	1674.7793	1674.7779	R	E	913	928
PSM	NTCVGSDNVTDFNAIATCDWTNAGDYILANTCTER	626	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	3-UNIMOD:4,18-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=26868	57.858518	3	3938.678401	3938.678182	K	L	1018	1053
PSM	HYVYIGDPAQLPAPR	627	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13894	32.217205	2	1695.872185	1695.873290	K	T	1318	1333
PSM	RCPAEIVDTVSALVYDNK	628	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	2-UNIMOD:4	ms_run[1]:scan=16803	37.669948	3	2051.025756	2049.020091	R	L	1366	1384
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	629	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	32-UNIMOD:4	ms_run[1]:scan=25294	54.027472	3	4030.886782	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	630	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	32-UNIMOD:4	ms_run[1]:scan=27287	59.08078	3	4030.886131	4030.885455	K	F	1448	1484
PSM	VGILCIMSDRDLYDK	631	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=20259	44.239881	3	1812.871778	1812.875007	K	L	1493	1508
PSM	TILGSALLEDEFTPFDVVR	632	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=27502	59.808406	2	2121.102494	2121.099387	R	Q	3543	3562
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	633	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=24887	53.222174	3	3232.452204	3230.454500	R	C	257	285
PSM	VGTFFSEVKPAGPTVEQQGEMAR	634	sp|P54886|P5CS_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=15562	35.473317	3	2465.205239	2464.205660	K	S	349	372
PSM	HLLEGQNASVLAYGPTGAGK	635	sp|Q14807|KIF22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0		ms_run[1]:scan=13252	30.868962	3	1983.025315	1982.022140	R	T	114	134
PSM	DVVICPDASLEDAKK	636	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	5-UNIMOD:4	ms_run[1]:scan=12085	28.614549	2	1658.821348	1658.818537	R	E	49	64
PSM	SHKPPISFPLCANGQVFGLYK	637	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	32.0	11-UNIMOD:4	ms_run[1]:scan=20471	44.726569	3	2360.197867	2359.214708	K	N	997	1018
PSM	ADQLTEEQIAEFK	638	sp|P0DP25|CALM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=20614	44.979	2	1562.7464	1562.7464	M	E	2	15
PSM	AELVQGQSAPVGMK	639	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=15912	36.095	2	1455.7392	1455.7392	M	A	2	16
PSM	ALEELQEALAEKEELR	640	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18439	40.672	3	1869.9684	1869.9684	R	Q	141	157
PSM	AQIHDLVLVGGSTR	641	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12499	29.415	2	1464.8049	1464.8049	K	I	329	343
PSM	ASGAGGVGGGGGGK	642	sp|P49790-2|NU153_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=4242	13.068	2	1029.4839	1029.4839	M	I	2	16
PSM	CPAEIVDTVSALVYDNK	643	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:4	ms_run[2]:scan=25722	55.034	3	1892.919	1892.9190	R	L	1367	1384
PSM	DEPIHILNVAIK	644	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18073	39.984	2	1360.7715	1360.7715	R	T	1283	1295
PSM	DFSSHDEINNYLQQIDQLKER	645	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21103	45.877	4	2591.2252	2591.2252	K	I	1833	1854
PSM	DITHSYLEQETTGINK	646	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13286	30.932	2	1847.8901	1847.8901	K	S	7	23
PSM	DLEKPFLLPVEAVYSVPGR	647	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=24292	52.045	3	2128.1568	2128.1568	R	G	253	272
PSM	DQQLEALQQEHLDLMK	648	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17116	38.226	3	1937.9517	1937.9517	R	Q	709	725
PSM	DQQLEALQQEHLDLMK	649	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17152	38.292	2	1937.9517	1937.9517	R	Q	709	725
PSM	DVVICPDASLEDAKK	650	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	5-UNIMOD:4	ms_run[2]:scan=12029	28.497	2	1658.8185	1658.8185	R	E	49	64
PSM	EDALLDSVEVGLSCVGLEEKPEK	651	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:4	ms_run[2]:scan=25228	53.885	3	2515.2364	2515.2364	R	G	550	573
PSM	EHNSILETALAK	652	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12731	29.875	2	1324.6987	1324.6987	R	R	1133	1145
PSM	EIVHLQAGQCGNQIGAK	653	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	10-UNIMOD:4	ms_run[2]:scan=9398	23.262	3	1821.9156	1821.9156	R	F	3	20
PSM	ELQEVIALTSQELEESREK	654	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21881	47.268	3	2230.1329	2230.1329	K	V	1064	1083
PSM	EMEENFAVEAANYQDTIGR	655	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:35	ms_run[2]:scan=17854	39.584	3	2201.9535	2201.9535	R	L	346	365
PSM	EQESEKPSQELLEYNIQQK	656	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13359	31.068	3	2319.123	2319.1230	R	Q	3103	3122
PSM	FDTGNLCMVTGGANLGR	657	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=17843	39.564	2	1781.8189	1781.8189	K	I	175	192
PSM	FGIIRPGCALESTTAILQQK	658	sp|Q86U90|YRDC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	8-UNIMOD:4	ms_run[2]:scan=20362	44.46	3	2202.1831	2202.1831	K	Y	249	269
PSM	FHDPDSAVVAQHLTNTVFVDR	659	sp|Q05519-2|SRS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17030	38.069	4	2367.1608	2367.1608	K	A	83	104
PSM	FVDGLMIHSGDPVNYYVDTAVR	660	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:35	ms_run[2]:scan=19963	43.709	3	2483.1791	2483.1791	K	H	152	174
PSM	GAEEMETVIPVDVMR	661	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	14-UNIMOD:35	ms_run[2]:scan=17010	38.037	2	1690.7906	1690.7906	K	R	13	28
PSM	HQAALGELTASLESK	662	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14591	33.507	2	1553.8049	1553.8049	R	Q	923	938
PSM	HQAALGELTASLESK	663	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14599	33.522	3	1553.8049	1553.8049	R	Q	923	938
PSM	HSQALEALQQR	664	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7724	20.105	2	1279.6633	1279.6633	R	L	1813	1824
PSM	IAAQLQGIEADMLDQEAAFMQIQEAK	665	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27599	60.097	3	2861.3939	2861.3939	R	T	638	664
PSM	IAEFTTNLTEEEEK	666	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13983	32.434	2	1652.7781	1652.7781	R	S	1001	1015
PSM	IAEFTTNLTEEEEKSK	667	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12190	28.856	3	1867.9051	1867.9051	R	S	1001	1017
PSM	IEEIKDFLLTAR	668	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19339	42.454	2	1446.8082	1446.8082	K	R	5	17
PSM	INEKPQVIADYESGR	669	sp|O60869-2|EDF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10681	25.884	3	1717.8635	1717.8635	K	A	99	114
PSM	INETFVDKDFVPYQDIR	670	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18504	40.812	3	2098.0371	2098.0371	K	I	139	156
PSM	IQSATVLLNEDVSDEKTAEAAMQR	671	sp|Q8NEZ5|FBX22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=17623	39.182	3	2618.2858	2618.2858	R	L	285	309
PSM	ITAEEMSALIEER	672	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20490	44.76	2	1490.7287	1490.7287	R	D	258	271
PSM	ITGLYPTLNISDEFSSNVANYQK	673	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=26035	55.747	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITGLYPTLNISDEFSSNVANYQK	674	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=26535	57.007	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IVYTACSHAAVDALCEK	675	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=19631	43.045	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	676	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=21361	46.333	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	677	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=30359	65.757	3	1906.8917	1906.8917	R	A	1227	1244
PSM	KFGDPVVQSDMK	678	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9222	22.953	2	1349.6649	1349.6649	R	H	77	89
PSM	KHPDSSVNFAEFSK	679	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=10148	24.722	3	1591.7631	1591.7631	K	K	30	44
PSM	KISSIQSIVPALEIANAHR	680	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18708	41.175	4	2046.1586	2046.1586	K	K	250	269
PSM	LAAVDATVNQVLASR	681	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19125	41.94	2	1526.8417	1526.8417	K	Y	214	229
PSM	LADMHSTEISLQQR	682	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11094	26.739	3	1627.7988	1627.7988	R	L	1101	1115
PSM	LAETQEEISAEVAAK	683	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12593	29.63	2	1587.7992	1587.7992	R	A	108	123
PSM	LDMQNSQTAVSLR	684	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11735	27.941	2	1461.7246	1461.7246	K	E	1683	1696
PSM	LGEASDSELADADK	685	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9005	22.579	2	1419.6365	1419.6365	R	A	1108	1122
PSM	LKEQETTGILQTQLQEAQR	686	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13727	31.834	3	2213.1652	2213.1652	K	E	960	979
PSM	LLEQLQEIGQEKEQLTQELQEAR	687	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=23129	49.803	3	2752.4243	2752.4243	R	K	401	424
PSM	LNEQASEEILKVEQK	688	sp|Q01105-2|SET_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12751	29.907	3	1756.9207	1756.9207	R	Y	45	60
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	689	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=25258	53.95	4	3382.7384	3382.7384	K	I	1142	1172
PSM	LPGSGAVQAASPER	690	sp|Q86U90|YRDC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8703	22.036	2	1338.6892	1338.6892	R	A	50	64
PSM	LPLQQHETASQTSFPDVYNEGTQAVTEENIASLQK	691	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19989	43.752	3	3872.8705	3872.8705	R	R	446	481
PSM	LQGQLEQGDDTAAER	692	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=7325	19.265	2	1629.7594	1629.7594	R	L	359	374
PSM	LQQEGSENERIEELQEQLEQK	693	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16874	37.794	3	2556.2304	2556.2304	R	H	437	458
PSM	LQQELEAANQSLAELR	694	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18055	39.952	2	1811.9377	1811.9377	K	D	281	297
PSM	LSGSDLGGHSSLLER	695	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11381	27.254	3	1526.7689	1526.7689	R	L	2476	2491
PSM	LSLPMQETQLCSTDSPLPLEKEEQVR	696	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	11-UNIMOD:4	ms_run[2]:scan=19738	43.26	3	3027.4893	3027.4893	R	L	126	152
PSM	MHDLNTDQENLVGTHDAPIR	697	sp|O43684-2|BUB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11120	26.783	4	2275.0651	2275.0651	K	C	81	101
PSM	MISAAQLLDELMGR	698	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=27827	60.557	2	1620.7851	1620.7851	-	D	1	15
PSM	MLYDAQLSEEQGR	699	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12601	29.647	2	1538.7035	1538.7035	R	N	3274	3287
PSM	NADMSEEMQQDSVECATQALEK	700	sp|P63167|DYL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	4-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=16287	36.756	3	2529.0305	2529.0305	K	Y	10	32
PSM	NKDQGTYEDYVEGLR	701	sp|P60660|MYL6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14163	32.751	3	1785.817	1785.8170	K	V	80	95
PSM	NLDQEQLSQVLDAMFER	702	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27630	60.179	3	2034.9681	2034.9681	K	I	142	159
PSM	NQILSQQLQQMEAEHNTLR	703	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16705	37.498	3	2280.1281	2280.1281	R	N	294	313
PSM	NQQLDLENTELSQK	704	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12404	29.23	2	1658.8111	1658.8111	K	N	1586	1600
PSM	NQVAMNPTNTVFDAK	705	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13576	31.508	2	1648.7879	1648.7879	K	R	57	72
PSM	NSSYFVEWIPNNVK	706	sp|P04350|TBB4A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21905	47.312	2	1695.8257	1695.8257	K	T	337	351
PSM	NTQSNEDLKQEK	707	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=2319	9.0302	2	1432.6794	1432.6794	K	S	303	315
PSM	PASESPHHHTAPAK	708	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=1796	8.1937	4	1465.7062	1465.7062	R	S	59	73
PSM	QAQDTEATQSPAPAPAPASHGPSER	709	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5924	16.366	3	2500.1579	2500.1579	R	W	881	906
PSM	QLELENLQASYEDLK	710	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=20482	44.746	2	1791.8891	1791.8891	K	A	446	461
PSM	QNSLESELMELHETMASLQSR	711	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	9-UNIMOD:35	ms_run[2]:scan=25450	54.434	3	2448.1261	2448.1261	K	L	1308	1329
PSM	QQDAQEFFLHLVNLVER	712	sp|Q92995-2|UBP13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=27747	60.418	3	2085.0643	2085.0643	R	N	380	397
PSM	QQMTALQSQLQQVQLER	713	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18056	39.954	2	2028.0422	2028.0422	R	T	538	555
PSM	QQNQEITDQLEEEKK	714	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8871	22.318	3	1858.8909	1858.8908	K	E	189	204
PSM	RCPAEIVDTVSALVYDNK	715	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=22874	49.333	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	716	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=19524	42.852	5	3558.7566	3558.7566	R	L	228	261
PSM	SEDEAGCSSVDEESYK	717	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	7-UNIMOD:4	ms_run[2]:scan=7296	19.195	2	1790.6789	1790.6789	K	T	328	344
PSM	SELEMAQEDLSMTQK	718	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16266	36.719	2	1738.7754	1738.7754	K	D	1330	1345
PSM	SETAPAAPAAAPPAEK	719	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=9141	22.813	2	1519.7518	1519.7518	M	A	2	18
PSM	SGALDVLQMKEEDVLK	720	sp|P08865|RSSA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	1-UNIMOD:1	ms_run[2]:scan=22417	48.486	2	1815.9288	1815.9288	M	F	2	18
PSM	SGGGGGGGLGSGGSIR	721	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5783	16.126	2	1231.5905	1231.5905	R	S	14	30
PSM	SHSGPSSLPEAPLKPPGPLVPPDQQDK	722	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=14268	32.936	4	2774.4239	2774.4239	R	V	16	43
PSM	SKAEAESLYQSK	723	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=5655	15.861	2	1339.662	1339.6620	K	Y	365	377
PSM	SLMSISNAGSGLLSHSSTLTGSPIMEEK	724	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=21105	45.88	3	2833.3838	2833.3838	K	R	787	815
PSM	SPASDTYIVFGEAK	725	sp|Q13765|NACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=16341	36.851	2	1483.7195	1483.7195	K	I	114	128
PSM	SQIFSTASDNQPTVTIK	726	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=13972	32.415	2	1835.9265	1835.9265	K	V	448	465
PSM	SQVFSTAADGQTQVEIK	727	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12918	30.264	3	1807.8952	1807.8952	K	V	469	486
PSM	STNGDTFLGGEDFDQALLR	728	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=22645	48.901	2	2054.9545	2054.9545	K	H	266	285
PSM	TANKDHLVTAYNHLFETK	729	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=12628	29.697	4	2101.0593	2101.0593	K	R	53	71
PSM	THINIVVIGHVDSGK	730	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=11521	27.508	3	1587.8733	1587.8733	K	S	6	21
PSM	TNIQNLNQLREDELGSDISALTLR	731	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=22603	48.829	3	2712.4042	2712.4042	R	I	2576	2600
PSM	TNQEHAALEAENSKGEVETLK	732	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=8653	21.957	4	2297.1135	2297.1135	R	A	2350	2371
PSM	TSLAALEQIQTAK	733	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15212	34.819	2	1372.7562	1372.7562	R	T	340	353
PSM	VCTLAIIDPGDSDIIR	734	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0	2-UNIMOD:4	ms_run[2]:scan=20906	45.506	2	1756.9029	1756.9029	R	S	91	107
PSM	VGEVIVTKDDAMLLK	735	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=15062	34.51	3	1629.9011	1629.9011	K	G	345	360
PSM	VLDAPGGGSVLVMEHMDMR	736	sp|Q9HA64|KT3K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18669	41.103	3	2012.9482	2012.9482	K	H	76	95
PSM	VRTDITYPAGFMDVISIDK	737	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=22858	49.301	3	2140.0874	2140.0874	K	T	76	95
PSM	VSFELFADKVPK	738	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=18148	40.13	2	1378.7497	1378.7497	R	T	20	32
PSM	VVDRDSEEAEIIR	739	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	31.0		ms_run[2]:scan=9035	22.631	3	1529.7686	1529.7686	K	K	803	816
PSM	TQAESALCQMQLETEKER	740	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	8-UNIMOD:4	ms_run[1]:scan=13944	32.359004	3	2150.990677	2150.993618	R	V	910	928
PSM	EASFEYLQNEGER	741	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=13553	31.441704	2	1572.697117	1570.689966	K	L	1436	1449
PSM	IIQQAGQVWFPDSAFK	742	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=21403	46.408288	3	1834.943918	1833.941370	K	T	2010	2026
PSM	IAEFTTNLTEEEEKSK	743	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=12229	28.925643	3	1869.907540	1867.905104	R	S	1001	1017
PSM	HSQAVEELAEQLEQTKR	744	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=15113	34.603663	3	1997.008001	1995.002132	K	V	1194	1211
PSM	SHKPPISFPLCANGQVFGLYK	745	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:4	ms_run[1]:scan=21158	45.972021	4	2360.199709	2359.214708	K	N	997	1018
PSM	IVYTACSHAAVDALCEK	746	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=26028	55.729114	3	1906.891457	1906.891719	R	A	1227	1244
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	747	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	32-UNIMOD:4	ms_run[1]:scan=24975	53.393266	3	4030.886782	4030.885455	K	F	1448	1484
PSM	VGILCIMSDRDLYDK	748	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=15779	35.861996	3	1812.874528	1812.875007	K	L	1493	1508
PSM	QSHAASAAPQASSPPDYTMAWAEYYR	749	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=19262	42.28984	3	2856.262448	2855.260943	K	Q	527	553
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	750	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=20844	45.395599	4	3182.612923	3182.607035	R	L	148	178
PSM	NQLTSNPENTVFDAK	751	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=13171	30.714059	2	1677.802212	1676.800579	K	R	82	97
PSM	LAETQEEISAEVAAK	752	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=12979	30.370972	2	1588.803684	1587.799182	R	A	108	123
PSM	FNEVAAQYSEDKAR	753	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=8387	21.401314	3	1627.765893	1626.763799	R	Q	64	78
PSM	TVQDLTSVVQTLLQQMQDK	754	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=28052	60.949192	2	2174.121748	2174.125284	K	F	8	27
PSM	KGTGIAAQTAGIAAAAR	755	sp|P82912|RT11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=9832	24.123566	3	1527.852967	1526.852889	K	A	122	139
PSM	KAVFISPYNSQNAVASK	756	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0		ms_run[1]:scan=11802	28.09929	3	1823.943956	1822.957748	R	I	1431	1448
PSM	SHKPPISFPLCANGQVFGLYK	757	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	31.0	11-UNIMOD:4	ms_run[1]:scan=20812	45.337275	4	2360.199709	2359.214708	K	N	997	1018
PSM	AAAAAWEEPSSGNGTAR	758	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9121	22.778	2	1644.7492	1644.7492	K	A	6	23
PSM	AAVEEGIVLGGGCALLR	759	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=19970	43.72	2	1683.8978	1683.8978	R	C	430	447
PSM	AEAGAGSATEFQFR	760	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13076	30.536	2	1440.6634	1440.6634	K	G	140	154
PSM	AEEGIAAGGVMDVNTALQEVLK	761	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1,11-UNIMOD:35	ms_run[2]:scan=27848	60.594	3	2272.1257	2272.1257	M	T	2	24
PSM	AEQSIAELSSSENTLKTEVADLR	762	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20587	44.931	3	2490.2449	2490.2449	R	A	573	596
PSM	AFVAIGDYNGHVGLGVK	763	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16656	37.412	3	1715.8995	1715.8995	K	C	126	143
PSM	ASAGLNSSATSTANNSR	764	sp|Q8N3C7-3|CLIP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4807	14.297	2	1607.7499	1607.7499	R	C	464	481
PSM	ATELQEQLSSEK	765	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9954	24.358	2	1361.6674	1361.6674	R	M	3139	3151
PSM	ATGANATPLDFPSK	766	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:1	ms_run[2]:scan=16739	37.559	2	1430.7042	1430.7042	M	K	2	16
PSM	AVFISPYNSQNAVASK	767	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13478	31.282	3	1694.8628	1694.8628	K	I	1432	1448
PSM	AYVWDNNKDLAEWLEK	768	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=22367	48.366	3	1992.9581	1992.9581	K	Q	2261	2277
PSM	CCLTYCFNKPEDK	769	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10954	26.466	3	1733.7211	1733.7211	K	-	144	157
PSM	CCVETSALGHEWR	770	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=11744	27.965	3	1603.6871	1603.6871	R	L	624	637
PSM	CPAEIVDTVSALVYDNK	771	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=25437	54.406	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	772	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	1-UNIMOD:4	ms_run[2]:scan=26001	55.671	3	1892.919	1892.9190	R	L	1367	1384
PSM	DALLSETAFSMNSTEENSLSHLEK	773	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21258	46.147	3	2652.2225	2652.2225	R	L	2787	2811
PSM	DITHSYLEQETTGINK	774	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=13240	30.846	3	1847.8901	1847.8901	K	S	7	23
PSM	DKLNNLVLFDK	775	sp|P62851|RS25_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16243	36.682	2	1317.7293	1317.7293	R	A	42	53
PSM	ECEQECELAITDLESGREDEAGLHQSQAVHGLELEALR	776	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=20395	44.515	5	4320.9863	4320.9863	K	L	214	252
PSM	EHALLAYTLGVK	777	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15184	34.748	2	1313.7343	1313.7343	R	Q	135	147
PSM	EILGTAQSVGCNVDGR	778	sp|P30050|RL12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=11917	28.291	2	1674.7995	1674.7995	K	H	131	147
PSM	ELAQQVQQVADDYGK	779	sp|Q92841-1|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16517	37.164	2	1690.8162	1690.8162	R	C	176	191
PSM	ELEDATETADAMNR	780	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10133	24.697	2	1564.6675	1564.6675	R	E	1899	1913
PSM	EVYSSCDTTGTGFLDR	781	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=14026	32.514	2	1806.773	1806.7730	R	Q	14	30
PSM	GAEEMETVIPVDVMR	782	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:35	ms_run[2]:scan=17361	38.666	2	1690.7906	1690.7906	K	R	13	28
PSM	GHENVEAAQAEYIEK	783	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8766	22.144	3	1686.7849	1686.7849	K	F	475	490
PSM	GHGDSVDQLCWHPSNPDLFVTASGDK	784	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=17627	39.188	4	2838.2668	2838.2668	R	T	97	123
PSM	GISLNPEQWSQLKEQISDIDDAVR	785	sp|P53999|TCP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=25103	53.64	3	2740.3668	2740.3668	K	K	102	126
PSM	GLDVDSLVIEHIQVNK	786	sp|P18621-3|RL17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20352	44.441	3	1777.9574	1777.9574	K	A	106	122
PSM	GVVDSEDLPLNISR	787	sp|P07900|HS90A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17182	38.344	2	1512.7784	1512.7784	R	E	387	401
PSM	GWEEGVAQMSVGQR	788	sp|P62942|FKB1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15389	35.167	2	1532.7042	1532.7042	R	A	59	73
PSM	HEVTICNYEASANPADHR	789	sp|Q9GZP4-2|PITH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=9164	22.849	3	2082.9178	2082.9178	R	V	181	199
PSM	HLDTLTEHYDIPK	790	sp|Q9Y421|FA32A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11070	26.699	3	1580.7835	1580.7835	R	V	95	108
PSM	HLESFYEKPPPGLIK	791	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12884	30.199	3	1753.9403	1753.9403	K	E	47	62
PSM	HLLVSNVGGDGEEIER	792	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11106	26.76	3	1722.8537	1722.8537	R	F	522	538
PSM	HQGVMVGMGQK	793	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=5830	16.205	2	1170.5638	1170.5638	R	D	40	51
PSM	HQLEALESPLCIQHEGHVSDR	794	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=11888	28.241	5	2454.171	2454.1710	R	C	603	624
PSM	HQSEMEDLQNQFQK	795	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12073	28.593	3	1760.7788	1760.7788	K	E	369	383
PSM	HQSHTAEAGPR	796	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=1803	8.2058	3	1189.5588	1189.5588	R	K	2202	2213
PSM	HYVYIGDPAQLPAPR	797	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15418	35.219	3	1695.8733	1695.8733	K	T	1318	1333
PSM	IAELEEELVCVQK	798	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=17585	39.118	2	1558.7913	1558.7913	R	E	2660	2673
PSM	IAQLEEQLDNETKER	799	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11970	28.381	3	1814.901	1814.9010	K	Q	1816	1831
PSM	IINEPTAAAIAYGLDK	800	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19256	42.278	3	1658.8879	1658.8879	R	K	172	188
PSM	IINEPTAAAIAYGLDKK	801	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16752	37.582	2	1786.9829	1786.9829	R	V	172	189
PSM	IISNASCTTNCLAPLAK	802	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=13002	30.41	2	1832.9125	1832.9125	K	V	146	163
PSM	ILDSVGIEADDDRLNK	803	sp|P05387|RLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12766	29.935	3	1771.8952	1771.8952	K	V	26	42
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	804	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	32-UNIMOD:4	ms_run[2]:scan=29831	64.175	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	805	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	32-UNIMOD:4	ms_run[2]:scan=32048	73.199	3	4030.8855	4030.8855	K	F	1448	1484
PSM	INALTAASEAACLIVSVDETIKNPR	806	sp|Q99832|TCPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=27857	60.608	3	2655.3902	2655.3902	R	S	500	525
PSM	ISLGLPVGAVINCADNTGAK	807	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	13-UNIMOD:4	ms_run[2]:scan=21562	46.693	3	1969.0303	1969.0303	R	N	16	36
PSM	ITGLYPTLNISDEFSSNVANYQK	808	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=29437	63.421	3	2573.2649	2573.2649	R	V	1172	1195
PSM	ITNLTQQLEQASIVK	809	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18734	41.224	2	1684.9359	1684.9359	K	K	1612	1627
PSM	IVGDLAQFMVQNGLSR	810	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=23599	50.725	3	1746.9087	1746.9087	K	A	913	929
PSM	IYCPACHNSEVGPEHSLAEYHNESGLK	811	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10770	26.14	4	3097.3658	3097.3658	K	T	368	395
PSM	KAEAAVVAVAEK	812	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=6126	16.773	2	1184.6765	1184.6765	R	R	9	21
PSM	KAVFISPYNSQNAVASK	813	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11496	27.465	3	1822.9577	1822.9577	R	I	1431	1448
PSM	KCGYPGHLTFECR	814	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	2-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9320	23.132	4	1623.7286	1623.7286	K	N	17	30
PSM	KDSLHQTILTQELEK	815	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11635	27.71	3	1781.9523	1781.9523	K	L	1004	1019
PSM	KELEGLQQLLQNVK	816	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20433	44.633	3	1638.9305	1638.9305	R	S	1316	1330
PSM	KQELEEICHDLEAR	817	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4	ms_run[2]:scan=13170	30.713	4	1768.8414	1768.8414	K	V	910	924
PSM	KTAEAGGVTGK	818	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=2016	8.5282	2	1017.5455	1017.5455	K	G	87	98
PSM	LALSQNQQSSGAAGPTGK	819	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7197	18.991	2	1713.8646	1713.8646	R	N	107	125
PSM	LLYSMTFQNVDAADTK	820	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18831	41.411	2	1815.8713	1815.8713	R	S	2080	2096
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	821	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	15-UNIMOD:35	ms_run[2]:scan=23292	50.13	5	3398.7333	3398.7333	K	I	1142	1172
PSM	LPCIYLVDSGGAYLPR	822	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	3-UNIMOD:4	ms_run[2]:scan=22513	48.672	2	1792.9182	1792.9182	R	Q	165	181
PSM	LQDEIQNMKEEMAR	823	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:35	ms_run[2]:scan=12935	30.294	3	1749.8026	1749.8026	R	H	365	379
PSM	LQDEIQNMKEEMAR	824	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12888	30.208	3	1733.8077	1733.8077	R	H	365	379
PSM	LQELEAEQQQIQEER	825	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=12314	29.072	3	1869.9068	1869.9068	R	E	1959	1974
PSM	LQQELDDLTVDLDHQR	826	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17318	38.587	3	1936.949	1936.9490	R	Q	1425	1441
PSM	LQVEHPVTECITGLDLVQEMIR	827	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	10-UNIMOD:4	ms_run[2]:scan=25081	53.59	3	2579.3087	2579.3087	R	V	354	376
PSM	LSSEMNTSTVNSAR	828	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=7511	19.665	2	1495.6937	1495.6937	R	E	277	291
PSM	MQAHIQDLEEQLDEEEGAR	829	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16523	37.173	3	2240.0015	2240.0015	K	Q	948	967
PSM	NASLASSNNDLQVAEEQYQR	830	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14432	33.226	3	2236.0356	2236.0356	K	L	495	515
PSM	NEITTLNEEDSISNLK	831	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=15590	35.53	2	1818.8847	1818.8847	R	L	1528	1544
PSM	NIILEEGKEILVGDVGQTVDDPYATFVK	832	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=25254	53.941	3	3061.5859	3061.5859	K	M	46	74
PSM	NISHYEEQLVK	833	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=10132	24.696	2	1358.683	1358.6830	R	M	381	392
PSM	NKEQEEQLGEMIQAYEK	834	sp|A7MCY6|TBKB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=18541	40.881	3	2065.9626	2065.9626	K	L	120	137
PSM	QASHAQLGDAYDQEIR	835	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9664	23.725	3	1800.8391	1800.8391	K	E	140	156
PSM	QAVTNPNNTFYATKR	836	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=8219	21.113	3	1723.8642	1723.8642	R	L	108	123
PSM	QSSGASSSSFSSSR	837	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=4201	12.988	2	1360.5855	1360.5855	R	A	588	602
PSM	QTLENERGELANEVK	838	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9919	24.298	3	1728.8642	1728.8642	K	V	1220	1235
PSM	QVQSLTCEVDALK	839	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=15188	34.759	2	1489.7446	1489.7446	R	G	322	335
PSM	RADVILSDMAPNATGFR	840	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16423	36.997	3	1832.9203	1832.9203	R	D	147	164
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	841	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19512	42.831	4	3558.7566	3558.7566	R	L	228	261
PSM	RVDGPSLEAEMQALPK	842	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17216	38.409	3	1739.8876	1739.8876	K	D	816	832
PSM	SAPAQAPTSGADLSAHLWAR	843	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14865	34.043	3	2005.997	2005.9970	R	Y	49	69
PSM	SAVVDSVCLESVGFCR	844	sp|Q9BYB4|GNB1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	8-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=18797	41.339	2	1783.8233	1783.8233	R	S	102	118
PSM	SELEMAQEDLSMTQK	845	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16265	36.718	3	1738.7754	1738.7754	K	D	1330	1345
PSM	SHFAIGLALYYPSAR	846	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21414	46.43	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	847	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21772	47.073	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	848	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=22078	47.7	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	849	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=22714	49.026	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	850	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20295	44.315	2	1664.8675	1664.8675	K	I	1212	1227
PSM	SHKPPISFPLCANGQVFGLYK	851	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	11-UNIMOD:4	ms_run[2]:scan=19814	43.439	4	2359.2147	2359.2147	K	N	997	1018
PSM	SLSSSPQAQPPRPAELSDEEVAELFQR	852	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20961	45.607	3	2967.4574	2967.4574	R	L	688	715
PSM	SLSTVEDLKAEIVSASESR	853	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20898	45.49	3	2020.0324	2020.0324	K	K	564	583
PSM	STNFQIISSYPDDESVYCTTEK	854	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	18-UNIMOD:4	ms_run[2]:scan=18796	41.338	3	2583.1323	2583.1323	R	Y	61	83
PSM	SVEMHHEALSEALPGDNVGFNVK	855	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=14849	34.013	4	2479.1802	2479.1802	K	N	291	314
PSM	THINIVVIGHVDSGK	856	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=11833	28.151	3	1587.8733	1587.8733	K	S	6	21
PSM	THNLEPYFESFINNLR	857	sp|P04264|K2C1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=25075	53.579	3	1992.9694	1992.9694	R	R	224	240
PSM	TNEKVELQELNDR	858	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=9678	23.754	3	1586.79	1586.7900	R	F	101	114
PSM	TSQIEAQFQSDCQK	859	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	12-UNIMOD:4	ms_run[2]:scan=10117	24.672	2	1668.7413	1668.7413	R	V	811	825
PSM	VAEHHVATLSGHSQEVCGLR	860	sp|Q12834|CDC20_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	17-UNIMOD:4	ms_run[2]:scan=7180	18.961	4	2186.0651	2186.0651	R	W	297	317
PSM	VDEFPLCGHMVSDEYEQLSSEALEAAR	861	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	7-UNIMOD:4	ms_run[2]:scan=24852	53.154	3	3081.3696	3081.3696	K	I	43	70
PSM	VEAVNMAEGIIHDTETK	862	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19081	41.866	3	1855.8986	1855.8986	R	M	579	596
PSM	VFSCLDDGMGHASVER	863	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=12172	28.819	3	1778.7716	1778.7716	R	I	294	310
PSM	VGINYQPPTVVPGGDLAK	864	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=16776	37.624	2	1823.9781	1823.9781	K	V	353	371
PSM	VGLLCIMSDRDLYDK	865	cov|corona06480|ORF1b_Norway/2505/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	5-UNIMOD:4	ms_run[2]:scan=20182	44.092	3	1796.8801	1796.8801	K	L	1493	1508
PSM	VLGVPIIVQASQAEK	866	sp|Q14498-2|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=19138	41.965	3	1550.9032	1550.9032	R	N	218	233
PSM	VQIGEYTFEKGDYGDAVVYR	867	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=20044	43.846	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	868	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21839	47.194	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	869	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=21227	46.092	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VRPCVVYGGADIGQQIR	870	sp|O00571-2|DDX3X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	4-UNIMOD:4	ms_run[2]:scan=12726	29.865	3	1886.9785	1886.9785	R	D	279	296
PSM	VSGVECMIIANDATVK	871	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0	6-UNIMOD:4	ms_run[2]:scan=17024	38.06	2	1705.8379	1705.8379	R	G	126	142
PSM	YSSAGTVEFLVDSK	872	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	30.0		ms_run[2]:scan=17628	39.189	2	1501.73	1501.7300	K	K	329	343
PSM	QLQDQQAAQILDLER	873	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=23043	49.642178	2	1750.8820	1750.8845	R	S	798	813
PSM	TQAESALCQMQLETEK	874	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	8-UNIMOD:4	ms_run[1]:scan=15047	34.478726	2	1866.850437	1865.849914	R	E	910	926
PSM	IGSFGPQEDLLFLR	875	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=24358	52.190195	2	1590.840134	1590.840593	R	A	1688	1702
PSM	MDEVEQDQHEAR	876	sp|Q8N4C6|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	1-UNIMOD:1	ms_run[1]:scan=9862	24.185797	2	1528.627269	1527.625986	-	L	1	13
PSM	YQQLAVALDSSYVTNK	877	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=17108	38.209238	2	1799.912905	1798.910129	R	Q	163	179
PSM	FLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAR	878	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	32-UNIMOD:4	ms_run[1]:scan=20186	44.098082	4	4789.253311	4789.252570	R	E	903	951
PSM	IAQLEEQLDNETK	879	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=12552	29.55244	2	1531.759983	1529.757317	K	E	1816	1829
PSM	ITGLYPTLNISDEFSSNVANYQK	880	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=27003	58.267563	3	2574.268682	2573.264949	R	V	1172	1195
PSM	HYVYIGDPAQLPAPR	881	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=13775	31.919188	3	1696.874024	1695.873290	K	T	1318	1333
PSM	HYVYIGDPAQLPAPR	882	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14088	32.623146	3	1696.874024	1695.873290	K	T	1318	1333
PSM	HYVYIGDPAQLPAPR	883	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14814	33.949013	3	1696.878491	1695.873290	K	T	1318	1333
PSM	CPAEIVDTVSALVYDNK	884	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=28423	61.571646	3	1875.8893	1875.8919	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	885	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=28291	61.352373	2	1875.8897	1875.8919	R	L	1367	1384
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	886	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	32-UNIMOD:4	ms_run[1]:scan=27290	59.094282	4	4030.885229	4030.885455	K	F	1448	1484
PSM	DMAGLLKPTACTMLVSSLR	887	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:4	ms_run[1]:scan=22618	48.85664	3	2063.057922	2063.057739	K	D	742	761
PSM	SVVEFLQGYIGVPHGGFPEPFR	888	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=26261	56.276733	3	2431.231700	2431.232467	R	S	943	965
PSM	VEAVNMAEGIIHDTETK	889	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=19154	41.999846	2	1856.900730	1855.898578	R	M	579	596
PSM	NTHATTHNAYDLEVIDIFK	890	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=20104	43.953039	3	2201.075629	2201.075297	K	I	820	839
PSM	LLTQMESEKENLQSK	891	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=10035	24.510526	3	1777.894186	1776.892765	K	I	629	644
PSM	ISSIQSIVPALEIANAHR	892	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=21275	46.177423	3	1918.063479	1918.063610	K	K	251	269
PSM	LQQELEAANQSLAELR	893	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=17980	39.808824	3	1811.936842	1811.937741	K	D	281	297
PSM	CQHAAHIISELILTAQER	894	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=25193	53.818588	3	2072.0450	2072.0468	R	D	310	328
PSM	QFSSADEAALKEPIIK	895	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	30.0	1-UNIMOD:28	ms_run[1]:scan=18299	40.416385	2	1728.8933	1728.8929	K	K	496	512
PSM	QLFHPEQLITGKEDAANNYAR	896	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14937	34.173054	3	2414.198274	2414.197872	R	G	85	106
PSM	QISNLQQSISDAEQR	897	sp|P04264|K2C1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14000	32.466816	2	1717.853090	1715.843841	K	G	418	433
PSM	VMTIPYQPMPASSPVICAGGQDR	898	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	2-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=16708	37.502603	3	2491.168932	2490.170537	R	C	178	201
PSM	AMQAAGQIPATALLPTMTPDGLAVTPTPVPVVGSQMTR	899	sp|P26368|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=26068	55.812274	4	3788.971983	3787.967474	K	Q	109	147
PSM	EADIDGDGQVNYEEFVQMMTAK	900	sp|P0DP23|CALM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=25870	55.370034	3	2489.076097	2489.072656	R	-	128	150
PSM	DLEAEHVEVEDTTLNR	901	sp|Q9H3K6|BOLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=12668	29.769189	3	1868.876605	1868.875201	R	C	15	31
PSM	GPDGLTAFEATDNQAIK	902	sp|P58546|MTPN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=15747	35.80409	2	1746.846463	1746.842444	K	A	98	115
PSM	HYVYIGDPAQLPAPR	903	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0		ms_run[1]:scan=14447	33.252916	3	1696.863881	1695.873290	K	T	1318	1333
PSM	SHKPPISFPLCANGQVFGLYK	904	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	30.0	11-UNIMOD:4	ms_run[1]:scan=20458	44.701619	4	2360.199709	2359.214708	K	N	997	1018
PSM	ADALQGALEQAHMTLK	905	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18249	40.317	3	1695.8614	1695.8614	K	E	1840	1856
PSM	AEAEAQAEELSFPR	906	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14037	32.536	3	1546.7264	1546.7264	R	S	929	943
PSM	AEQMHQSFVAETSQR	907	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8119	20.936	3	1747.7948	1747.7948	K	I	870	885
PSM	AFVHWYVGEGMEEGEFSEAR	908	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20279	44.278	3	2329.011	2329.0110	R	E	403	423
PSM	AGTGVDNVDLEAATR	909	sp|O43175|SERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11843	28.169	2	1487.7216	1487.7216	R	K	76	91
PSM	AHVQEVAQHNLK	910	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=3821	12.146	3	1372.7211	1372.7211	K	E	909	921
PSM	AILVDLEPGTMDSVR	911	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:35	ms_run[2]:scan=16983	37.99	2	1630.8236	1630.8236	R	S	63	78
PSM	AILVDLEPGTMDSVR	912	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19529	42.862	2	1614.8287	1614.8287	R	S	63	78
PSM	AKVDEFPLCGHMVSDEYEQLSSEALEAAR	913	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	9-UNIMOD:4	ms_run[2]:scan=23053	49.662	4	3280.5016	3280.5016	K	I	41	70
PSM	ALTVPELTQQVFDAK	914	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=22811	49.202	3	1658.8879	1658.8879	R	N	283	298
PSM	ALTVPELTQQVFDAK	915	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=22489	48.631	2	1658.8879	1658.8879	R	N	283	298
PSM	AMTDTFTLQAHDQFSPFSSSSGR	916	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:35	ms_run[2]:scan=17581	39.112	3	2533.118	2533.1180	K	R	521	544
PSM	APTIETVVLYTGETPSEQDQGKR	917	sp|Q9BYC8|RM32_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17049	38.103	3	2518.2551	2518.2551	K	I	151	174
PSM	ASNGDAWVEAHGK	918	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6724	17.989	2	1340.6109	1340.6109	R	L	147	160
PSM	CDHCGETSWQTGDFVK	919	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=12401	29.226	3	1925.7672	1925.7672	K	A	323	339
PSM	CEAPDANQQLQQAMEER	920	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=14177	32.776	3	2016.8629	2016.8629	R	A	356	373
PSM	CPAEIVDTVSALVYDNK	921	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=26273	56.304	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	922	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=27595	60.086	3	1892.919	1892.9190	R	L	1367	1384
PSM	CVSELEEEKQQLVK	923	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4	ms_run[2]:scan=10914	26.39	3	1717.8557	1717.8557	K	E	1969	1983
PSM	CYSCGEFGHIQK	924	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8908	22.383	2	1484.6177	1484.6177	K	D	112	124
PSM	DCDLQEDEACYNCGR	925	sp|P62633-8|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=10420	25.342	2	1903.6771	1903.6771	K	G	59	74
PSM	DGFIDKEDLHDMLASLGK	926	sp|P19105|ML12A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23088	49.728	4	2002.967	2002.9670	R	N	45	63
PSM	DHANEELDELKR	927	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8009	20.74	3	1467.6954	1467.6954	R	K	2753	2765
PSM	DLDPNNVIIEQEER	928	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15613	35.571	2	1682.8111	1682.8111	K	R	73	87
PSM	DLYANTVLSGGTTMYPGIADR	929	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21580	46.723	2	2214.0627	2214.0627	K	M	292	313
PSM	DRQDLAEQLQGLSSAK	930	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15648	35.631	3	1757.8908	1757.8908	R	E	751	767
PSM	EALESSHLEGELLR	931	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14038	32.537	2	1581.7999	1581.7999	R	Q	547	561
PSM	EKLDEFNELAIQK	932	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14457	33.271	2	1575.8144	1575.8144	R	E	1538	1551
PSM	ETVEILETNHTELMEHEASLSR	933	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15414	35.21	3	2567.2173	2567.2173	R	N	311	333
PSM	FENAFLSHVVSQHQALLGTIR	934	sp|P25705-2|ATPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21210	46.061	4	2366.2495	2366.2495	K	A	457	478
PSM	GAEEMETVIPVDVMR	935	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20312	44.362	3	1674.7957	1674.7957	K	R	13	28
PSM	GDWSVGAPGGVQEITYTVPADK	936	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19220	42.187	3	2246.0855	2246.0855	R	C	344	366
PSM	GEHPGLSIGDVAK	937	sp|P09429|HMGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10006	24.452	2	1278.6568	1278.6568	K	K	115	128
PSM	GLEDNQGGQYESWNYYR	938	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16335	36.842	2	2077.8766	2077.8766	K	Y	103	120
PSM	GQALQGELEAALEAK	939	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20241	44.201	2	1526.794	1526.7940	R	E	1785	1800
PSM	GSFGELALMYNTPR	940	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20943	45.575	2	1554.7501	1554.7501	R	A	204	218
PSM	HAADLGALETR	941	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8329	21.301	2	1152.5887	1152.5887	K	H	953	964
PSM	HASAPSHVQPSDSEK	942	sp|O60343|TBCD4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=2326	9.0426	3	1575.7277	1575.7277	R	N	339	354
PSM	HHEEEIVHHKK	943	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=1805	8.2082	3	1421.7164	1421.7164	K	E	73	84
PSM	HIADLAGNSEVILPVPAFNVINGGSHAGNK	944	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21431	46.459	4	3010.5625	3010.5625	R	L	133	163
PSM	HKELAPYDENWFYTR	945	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15736	35.787	3	1967.9166	1967.9166	K	A	42	57
PSM	HSQAVEELAEQLEQTKR	946	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15149	34.67	4	1995.0021	1995.0021	K	V	1194	1211
PSM	HTGPNSPDTANDGFVR	947	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7335	19.288	3	1683.7601	1683.7601	K	L	99	115
PSM	HVINFDLPSDIEEYVHR	948	sp|O00571-2|DDX3X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21776	47.079	3	2082.0171	2082.0171	K	I	496	513
PSM	HYVYIGDPAQLPAPR	949	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15105	34.589	3	1695.8733	1695.8733	K	T	1318	1333
PSM	HYVYIGDPAQLPAPR	950	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15922	36.113	3	1695.8733	1695.8733	K	T	1318	1333
PSM	IDQYQGADAVGLEEK	951	sp|O43396|TXNL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11914	28.286	2	1634.7788	1634.7788	R	I	88	103
PSM	IEINFPAEYPFKPPK	952	sp|P68036-2|UB2L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20309	44.355	3	1788.9451	1788.9451	R	I	21	36
PSM	IFGYPVGIVGNNGVLFSESAK	953	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=24503	52.471	3	2167.1314	2167.1314	R	K	362	383
PSM	IFSGSSHQDLSQK	954	sp|P60891|PRPS1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5788	16.136	2	1432.6947	1432.6947	K	I	6	19
PSM	IHYLDTTTLIEPAPR	955	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15485	35.333	3	1738.9254	1738.9254	K	Y	90	105
PSM	IIEEAPATIATPAVFEHMEQCAVK	956	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	21-UNIMOD:4	ms_run[2]:scan=21289	46.202	3	2654.3084	2654.3084	K	L	387	411
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	957	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	32-UNIMOD:4	ms_run[2]:scan=25573	54.663	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGPLAPEMIDSR	958	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18823	41.394	2	1410.7541	1410.7541	K	V	1185	1198
PSM	IQALEAELQAVSHSK	959	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16617	37.344	3	1622.8628	1622.8628	R	T	1044	1059
PSM	ITGLYPTLNISDEFSSNVANYQK	960	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=20727	45.182	3	2573.2649	2573.2649	R	V	1172	1195
PSM	KCGYPGHLTFECR	961	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9270	23.042	3	1623.7286	1623.7286	K	N	17	30
PSM	KIAPYVAHNFSK	962	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7281	19.168	3	1373.7456	1373.7456	K	L	589	601
PSM	KTQEQLALEMAELTAR	963	sp|P26038|MOES_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18982	41.682	3	1830.9509	1830.9509	K	I	412	428
PSM	LAAVAQGEEENASR	964	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=6547	17.506	2	1443.6954	1443.6954	K	S	1656	1670
PSM	LEAATQQNQQLR	965	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5799	16.154	2	1398.7215	1398.7215	R	A	675	687
PSM	LGEENKGHQMLVK	966	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=5204	15.028	3	1481.766	1481.7660	R	M	839	852
PSM	LGGLTQAPGNPVLAVQINQDK	967	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18207	40.239	3	2132.159	2132.1590	R	N	175	196
PSM	LGTIQSGSTTQFHAGMR	968	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=10068	24.588	3	1790.8734	1790.8734	R	R	3882	3899
PSM	LLAEMDIQTQEAPSSTSQELGTK	969	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16012	36.274	3	2476.2003	2476.2003	R	G	1747	1770
PSM	LQAVEVVITHLAPGTK	970	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19378	42.557	3	1674.9669	1674.9669	K	H	121	137
PSM	LQEACKDILLFK	971	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=15446	35.267	3	1476.801	1476.8010	R	N	130	142
PSM	LQHELSLMGPVVHEVSDSQAGSLQSELLCSQAGGPR	972	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	29-UNIMOD:4	ms_run[2]:scan=21541	46.654	4	3815.8571	3815.8571	K	G	1749	1785
PSM	LSNGADILFEPK	973	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=16530	37.187	2	1302.682	1302.6820	K	L	611	623
PSM	LTNENMEITSALQSEQHVK	974	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14152	32.732	3	2171.0528	2171.0528	K	R	559	578
PSM	MEEFKDQLPADECNK	975	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=9247	22.996	3	1868.7921	1868.7921	K	L	596	611
PSM	MGAEGGALSTAGHLQR	976	sp|Q16587-5|ZNF74_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9134	22.8	3	1554.7573	1554.7573	R	R	87	103
PSM	NADNNSSAFTALSEER	977	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=13374	31.094	2	1724.7602	1724.7602	K	D	736	752
PSM	NLDIERPTYTNLNR	978	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12361	29.157	3	1717.8747	1717.8747	R	L	216	230
PSM	NLQQQYLQINQEITELHPLK	979	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23089	49.73	3	2449.2965	2449.2965	K	A	2904	2924
PSM	NMITGTAPLDGCILVVAANDGPMPQTR	980	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	12-UNIMOD:4	ms_run[2]:scan=23857	51.204	3	2811.3718	2811.3718	K	E	136	163
PSM	NSMHVDMADEAYSIGPAPSQQSYLSMEK	981	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18360	40.528	3	3085.3467	3085.3467	R	I	85	113
PSM	NVLEHQLLELEKK	982	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15316	35.042	3	1591.8934	1591.8934	R	D	1522	1535
PSM	NVSETQQSLLSDQILELK	983	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21615	46.785	2	2044.0688	2044.0688	R	S	924	942
PSM	QLTEEDGVHSVIEENIK	984	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14190	32.798	3	1938.9535	1938.9535	K	C	2277	2294
PSM	QNAELTGHISQLTEEK	985	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11832	28.149	3	1796.8905	1796.8905	R	N	3583	3599
PSM	QNAELTGHISQLTEEKNDLR	986	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12611	29.667	4	2295.1455	2295.1455	R	N	3583	3603
PSM	QQPPDLVEFAVEYFTR	987	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=28037	60.923	3	1937.9523	1937.9523	R	L	24	40
PSM	RCPAEIVDTVSALVYDNK	988	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=23535	50.605	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RPLDDGVGNQLGALVHQR	989	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14563	33.461	4	1944.029	1944.0290	K	T	58	76
PSM	SDAYYCTGDVTAWTK	990	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=16124	36.476	2	1736.7352	1736.7352	K	C	306	321
PSM	SEEVATKEELVADAK	991	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8966	22.509	3	1617.8097	1617.8097	K	V	592	607
PSM	SPLDSHGEESSLDVNVLK	992	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=14725	33.773	3	1924.9378	1924.9378	R	D	416	434
PSM	SQIHDIVLVGGSTR	993	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=11741	27.956	2	1480.7998	1480.7998	K	I	329	343
PSM	SQMACPDENVSSGELR	994	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	5-UNIMOD:4	ms_run[2]:scan=9920	24.299	2	1778.7563	1778.7563	K	G	245	261
PSM	SSQSSSQQFSGIGR	995	sp|Q92841-1|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8509	21.71	2	1454.675	1454.6750	R	S	592	606
PSM	STELVNEITCENTEWPGQR	996	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	10-UNIMOD:4	ms_run[2]:scan=18880	41.5	3	2262.0223	2262.0223	K	S	42	61
PSM	TEWETAAPAVAETPDIK	997	sp|P46782|RS5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	1-UNIMOD:1	ms_run[2]:scan=20330	44.404	2	1869.8996	1869.8996	M	L	2	19
PSM	TIAFGGCVFSYVGCHNK	998	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=18779	41.307	3	1915.8709	1915.8709	R	C	403	420
PSM	TIGPDMFLGTCR	999	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	11-UNIMOD:4	ms_run[2]:scan=19761	43.31	2	1366.6373	1366.6373	K	R	1354	1366
PSM	TLNDELEIIEGMKFDR	1000	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=23469	50.464	3	1921.9455	1921.9455	K	G	206	222
PSM	TLYDFPGNDAEDLPFKK	1001	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18550	40.896	3	1968.9469	1968.9469	R	G	130	147
PSM	TPLSEAEFEEIMNR	1002	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=21180	46.008	2	1664.7716	1664.7716	R	N	334	348
PSM	TPVEPEVAIHR	1003	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8634	21.923	3	1246.667	1246.6670	K	I	9	20
PSM	TVAIYSEQDTGQMHR	1004	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=9108	22.754	2	1734.7995	1734.7995	R	Q	63	78
PSM	VDEFPLCGHMVSDEYEQLSSEALEAAR	1005	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	7-UNIMOD:4	ms_run[2]:scan=24775	53.007	3	3081.3696	3081.3696	K	I	43	70
PSM	VEEQEPELTSTPNFVVEVIK	1006	sp|Q07021|C1QBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=22882	49.35	3	2286.1631	2286.1631	K	N	155	175
PSM	VFQSLPHENKPLTLSNYQTNK	1007	sp|P04080|CYTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=12307	29.059	4	2457.2652	2457.2652	R	A	69	90
PSM	VGVGTCGIADKPMTQYQDTSK	1008	sp|O75940|SPF30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	6-UNIMOD:4	ms_run[2]:scan=11028	26.625	3	2255.0562	2255.0562	K	Y	209	230
PSM	VINEPTAAALAYGLDK	1009	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=18617	41.008	2	1644.8723	1644.8723	R	S	219	235
PSM	VLQLGQEASTHQAQNEEHR	1010	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=7187	18.974	4	2174.0465	2174.0465	R	V	1156	1175
PSM	VNDTIQIDLETGK	1011	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=15007	34.378	2	1444.7409	1444.7409	K	I	156	169
PSM	VQIGEYTFEKGDYGDAVVYR	1012	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=19472	42.76	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VTVAGLAGKDPVQCSR	1013	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	14-UNIMOD:4	ms_run[2]:scan=10558	25.633	2	1656.8617	1656.8617	K	D	33	49
PSM	VVQVSAGDSHTAALTDDGR	1014	sp|P18754|RCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=8776	22.161	3	1897.913	1897.9130	K	V	121	140
PSM	YCALAPNMMVTNNTFTLK	1015	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	2-UNIMOD:4	ms_run[2]:scan=21255	46.142	2	2087.9842	2087.9842	K	G	799	817
PSM	YPGTPADFNPGSLACSQLQNYDPDR	1016	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0	15-UNIMOD:4	ms_run[2]:scan=21395	46.394	3	2782.2293	2782.2293	R	A	3842	3867
PSM	YQEDVQQLQQALAQR	1017	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	29.0		ms_run[2]:scan=17390	38.744	3	1816.9068	1816.9068	R	D	2033	2048
PSM	QELSELHEQLLAR	1018	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	29.0	1-UNIMOD:28	ms_run[1]:scan=18513	40.828202	2	1547.7924	1547.7938	R	T	482	495
PSM	NQEVDLQQEQIQELEK	1019	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=14963	34.235122	3	1970.965205	1969.959265	R	C	1469	1485
PSM	AYVWDNNKDLAEWLEK	1020	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=22372	48.375772	3	1992.957187	1992.958142	K	Q	2261	2277
PSM	DFSSHDEINNYLQQIDQLK	1021	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=23150	49.840193	3	2306.088763	2306.081505	K	E	1828	1847
PSM	RCPAEIVDTVSALVYDNK	1022	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	2-UNIMOD:4	ms_run[1]:scan=24482	52.431608	3	2050.015940	2049.020091	R	L	1366	1384
PSM	VGILCIMSDRDLYDK	1023	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=20274	44.267591	2	1814.878594	1812.875007	K	L	1493	1508
PSM	TMIQSPSGVILQEAADVHAR	1024	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=18487	40.775255	3	2122.089087	2122.084088	R	Y	983	1003
PSM	QQVAFYGQTLGQAQAHSQEQ	1025	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=13949	32.373402	3	2219.041790	2218.040309	R	-	553	573
PSM	ALEELQEALAEKEELR	1026	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=18468	40.73278	3	1869.967894	1869.968373	R	Q	183	199
PSM	IHFPLATYAPVISAEK	1027	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=19425	42.66446	3	1755.958459	1755.955957	R	A	265	281
PSM	IHFPLATYAPVISAEK	1028	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=19842	43.495625	3	1755.958459	1755.955957	R	A	265	281
PSM	GNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACK	1029	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	29.0	41-UNIMOD:4,48-UNIMOD:4	ms_run[1]:scan=21506	46.592327	6	5112.4699	5112.4639	R	F	323	372
PSM	DITHSYLEQETTGINK	1030	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=13246	30.85741	3	1847.897587	1847.890122	K	S	7	23
PSM	STELVNEITCENTEWPGQR	1031	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	10-UNIMOD:4	ms_run[1]:scan=18922	41.574072	3	2262.014961	2262.022276	K	S	42	61
PSM	IHYLDTTTLIEPAPR	1032	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=15620	35.582675	3	1738.926022	1738.925386	K	Y	90	105
PSM	VIISAPSADAPMFVMGVNHEK	1033	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=19320	42.417918	3	2213.101607	2212.102046	R	Y	119	140
PSM	LVEALCAEHQINLIK	1034	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	6-UNIMOD:4	ms_run[1]:scan=15806	35.907685	3	1749.945396	1749.944741	K	V	64	79
PSM	TIAECLADELINAAK	1035	sp|P46782|RS5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	5-UNIMOD:4	ms_run[1]:scan=26424	56.682285	2	1630.823126	1630.823623	K	G	168	183
PSM	VKEGMNIVEAMER	1036	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=14371	33.119819	2	1504.738288	1504.737784	K	F	132	145
PSM	TNHIGHTGYLNTVTVSPDGSLCASGGK	1037	sp|P63244|RACK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	22-UNIMOD:4	ms_run[1]:scan=12413	29.245786	4	2743.315083	2742.303142	K	D	186	213
PSM	LPGSGAVQAASPER	1038	sp|Q86U90|YRDC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=8645	21.943088	2	1338.689550	1338.689178	R	A	50	64
PSM	ENVSDLTLGPGNSPITR	1039	sp|Q6DCA0|AMERL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=15591	35.531163	2	1768.886248	1768.895542	R	M	62	79
PSM	ISSLLEEQFQQGK	1040	sp|P62241|RS8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=15527	35.409901	2	1506.775461	1505.772573	K	L	158	171
PSM	TYDPSGDSTLPTCSK	1041	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0	13-UNIMOD:4	ms_run[1]:scan=9227	22.963187	2	1628.704075	1627.703567	K	K	427	442
PSM	SPAFVQLAPLSSK	1042	sp|P51610|HCFC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=17411	38.798833	2	1344.746700	1343.744902	R	V	1205	1218
PSM	IGSLGLGTGEDDDYVDDFNSTSHR	1043	sp|O95684|CEP43_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=17611	39.161223	3	2569.118149	2569.120469	K	S	324	348
PSM	SQIHDIVLVGGSTR	1044	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	29.0		ms_run[1]:scan=11776	28.039516	2	1482.806858	1480.799791	K	I	329	343
PSM	AAVPSGASTGIYEALELR	1045	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21164	45.981	2	1803.9367	1803.9367	R	D	33	51
PSM	AAVSQQGEQLQTER	1046	sp|Q9BQS8|FYCO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6506	17.439	2	1543.759	1543.7590	R	E	265	279
PSM	ADAGKEGNNPAENGDAK	1047	sp|P05204|HMGN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2248	8.91	3	1656.734	1656.7340	K	T	60	77
PSM	ADRDESSPYAAMLAAQDVAQR	1048	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17236	38.447	3	2264.0492	2264.0492	K	C	64	85
PSM	AEAGPVEQQLLQETEK	1049	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15591	35.531	2	1768.8843	1768.8843	K	L	1985	2001
PSM	AEYLASIFGTEK	1050	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1	ms_run[2]:scan=28056	60.958	2	1369.6765	1369.6765	M	D	2	14
PSM	AFVHWYVGEGMEEGEFSEAR	1051	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20223	44.165	3	2329.011	2329.0110	R	E	403	423
PSM	AGQSVIGLQMGTNK	1052	sp|Q15417-3|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12688	29.804	2	1402.7238	1402.7238	K	C	113	127
PSM	AINQQTGAFVEISR	1053	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13422	31.177	2	1532.7947	1532.7947	K	Q	449	463
PSM	ALEHSALAINHK	1054	sp|P17812|PYRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5606	15.772	3	1302.7044	1302.7044	K	L	320	332
PSM	ALQSQLEEEQLR	1055	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11765	28.015	2	1442.7365	1442.7365	R	H	2664	2676
PSM	AMMHDLQITCSEMQQK	1056	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	10-UNIMOD:4	ms_run[2]:scan=13147	30.664	3	1949.8468	1949.8468	K	V	1493	1509
PSM	APASVLPAATPR	1057	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9967	24.382	2	1149.6506	1149.6506	R	Q	45	57
PSM	AQGGSSDSSLALHER	1058	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5890	16.302	2	1513.7121	1513.7121	R	I	1029	1044
PSM	AQQIHSQTSQQYPLYDLDLGK	1059	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16767	37.607	3	2432.1972	2432.1972	K	F	835	856
PSM	AQQMVEILSDENR	1060	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14694	33.711	2	1531.7301	1531.7301	R	N	434	447
PSM	ASCTLSEQLDFIDTKR	1061	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=16932	37.898	3	1882.9095	1882.9095	K	G	211	227
PSM	AVESLAEAGGSEIQR	1062	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11273	27.052	2	1515.7529	1515.7529	K	V	130	145
PSM	AVTEQGAELSNEER	1063	sp|P27348|1433T_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7503	19.653	2	1531.7114	1531.7114	K	N	28	42
PSM	CCLTYCFNKPEDK	1064	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10952	26.459	3	1733.7211	1733.7211	K	-	144	157
PSM	CESLAEVNTQLR	1065	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=12137	28.747	2	1418.6824	1418.6824	R	L	110	122
PSM	CPAEIVDTVSALVYDNK	1066	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=24847	53.144	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	1067	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:4	ms_run[2]:scan=29672	63.87	3	1892.919	1892.9190	R	L	1367	1384
PSM	DDDIAALVVDNGSGMCK	1068	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=23762	51.031	2	1820.7921	1820.7921	M	A	2	19
PSM	DFFNYLPLSSQDPAPVR	1069	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=24687	52.83	3	1964.9632	1964.9632	R	E	273	290
PSM	DKPHVNVGTIGHVDHGK	1070	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5610	15.78	4	1808.9282	1808.9282	R	T	54	71
PSM	DLLHPSPEEEKR	1071	sp|P42677|RS27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7674	19.966	3	1448.726	1448.7260	K	K	6	18
PSM	DLYANTVLSGGTTMYPGIADR	1072	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21578	46.72	3	2214.0627	2214.0627	K	M	292	313
PSM	DNTCVVEFQFMLPTSHPNR	1073	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4	ms_run[2]:scan=21983	47.484	3	2291.0463	2291.0463	K	G	1173	1192
PSM	DSLHQTILTQELEK	1074	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14648	33.613	2	1653.8574	1653.8574	K	L	1005	1019
PSM	DVVICPDASLEDAK	1075	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=14424	33.21	2	1530.7236	1530.7236	R	K	49	63
PSM	EALESSHLEGELLRQEQTEVTAALAR	1076	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21594	46.747	4	2879.4625	2879.4625	R	A	547	573
PSM	EETPGQRPAVTETHQLAELNEK	1077	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9944	24.341	4	2476.2194	2476.2194	K	K	109	131
PSM	EKGTEPPFSGIYLNNK	1078	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14533	33.406	3	1792.8996	1792.8996	R	E	68	84
PSM	EQLEEEEEAKHNLEK	1079	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7692	20.004	4	1853.8643	1853.8643	R	Q	1343	1358
PSM	EQQIVIQSSGGLSKDDIENMVK	1080	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:35	ms_run[2]:scan=13309	30.978	3	2433.2057	2433.2057	R	N	542	564
PSM	EQQIVIQSSGGLSKDDIENMVK	1081	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	20-UNIMOD:35	ms_run[2]:scan=17232	38.441	3	2433.2057	2433.2057	R	N	542	564
PSM	EQSLDALQTHYDELQAR	1082	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14815	33.951	3	2015.9548	2015.9548	R	L	737	754
PSM	ERHPGSFDVVHVK	1083	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6804	18.174	3	1505.7739	1505.7739	R	D	199	212
PSM	EVDEQMLNVQNK	1084	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35	ms_run[2]:scan=11055	26.675	2	1461.677	1461.6770	K	N	325	337
PSM	EVDEQMLNVQNK	1085	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	6-UNIMOD:35	ms_run[2]:scan=7772	20.236	2	1461.677	1461.6770	K	N	325	337
PSM	EVIDLLKPDQVEGIQK	1086	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17169	38.322	3	1823.004	1823.0040	R	S	250	266
PSM	FDQLFDDESDPFEVLK	1087	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25306	54.051	2	1942.8836	1942.8836	R	A	17	33
PSM	FLALCADSIIIGGAK	1088	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=22376	48.384	2	1547.8381	1547.8382	K	L	685	700
PSM	FNEVAAQYSEDK	1089	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9532	23.487	2	1399.6256	1399.6256	R	A	64	76
PSM	FSYEQLETDLQASR	1090	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20897	45.489	2	1685.7897	1685.7897	K	E	2359	2373
PSM	GADFLVTEVENGGSLGSK	1091	sp|P14618-2|KPYM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20013	43.793	2	1778.8687	1778.8687	K	K	189	207
PSM	GFGYGQGAGALVHAQ	1092	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13858	32.125	2	1431.6895	1431.6895	K	-	179	194
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIR	1093	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8380	21.388	3	2269.0584	2269.0584	R	K	41	71
PSM	GHYTEGAELVDSVLDVVR	1094	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=24463	52.395	2	1957.9745	1957.9745	K	K	104	122
PSM	GKVEIDQQQLTQQQLNGN	1095	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11626	27.694	2	2040.0236	2040.0236	R	-	314	332
PSM	GMFTVSDHPPEQHGMFTVSDHPPEQR	1096	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13754	31.881	5	2962.3127	2962.3127	R	G	144	170
PSM	GQMQKPFEDASFALR	1097	sp|Q13526|PIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15461	35.291	3	1723.8352	1723.8352	R	T	128	143
PSM	GQYFGELALVTNKPR	1098	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16618	37.345	3	1691.8995	1691.8995	K	A	333	348
PSM	GQYFGELALVTNKPR	1099	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16691	37.472	2	1691.8995	1691.8995	K	A	333	348
PSM	GSDEVQILEMPSK	1100	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15395	35.176	2	1431.6915	1431.6915	R	T	136	149
PSM	GTLEPEYFNSVCR	1101	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	12-UNIMOD:4	ms_run[2]:scan=15025	34.428	2	1570.7086	1570.7086	K	L	1338	1351
PSM	GYGYGQGAGTLNMDR	1102	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12083	28.612	2	1558.6834	1558.6834	K	G	70	85
PSM	HSGNITFDEIVNIAR	1103	sp|P30050|RL12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20088	43.924	3	1684.8533	1684.8533	K	Q	100	115
PSM	HSGPNSADSANDGFVR	1104	sp|P52597|HNRPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6090	16.711	3	1629.7132	1629.7132	K	L	99	115
PSM	HWPFQVINDGDKPK	1105	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13434	31.198	3	1679.842	1679.8420	K	V	89	103
PSM	HWPFQVINDGDKPK	1106	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13725	31.831	3	1679.842	1679.8420	K	V	89	103
PSM	IINEPTAAAIAYGLDK	1107	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19223	42.196	2	1658.8879	1658.8879	R	K	172	188
PSM	INQHLQEELENR	1108	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9571	23.557	3	1521.7536	1521.7536	R	T	2007	2019
PSM	IPASQTSVPFDHLGK	1109	sp|P49674|KC1E_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12444	29.3	3	1595.8308	1595.8308	R	-	402	417
PSM	IPGMLIIDTPGHESFSNLR	1110	sp|O60841|IF2P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20095	43.935	3	2096.0725	2096.0725	R	N	695	714
PSM	IQEGEIQDQDLR	1111	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9827	24.114	2	1442.7001	1442.7001	R	Y	2021	2033
PSM	ISSLLEEQFQQGK	1112	sp|P62241|RS8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15552	35.453	2	1505.7726	1505.7726	K	L	158	171
PSM	ITGLYPTLNISDEFSSNVANYQK	1113	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=29775	64.062	3	2573.2649	2573.2649	R	V	1172	1195
PSM	KASAQASLASK	1114	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=2346	9.0811	2	1060.5877	1060.5877	R	D	1281	1292
PSM	KAVFISPYNSQNAVASK	1115	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=10910	26.382	4	1822.9577	1822.9577	R	I	1431	1448
PSM	KESSEVYFLATQYHGR	1116	sp|Q9UI43|MRM2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13116	30.606	3	1913.9272	1913.9272	R	K	225	241
PSM	LAAEEQFQALVK	1117	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17323	38.594	2	1345.7242	1345.7242	K	Q	1089	1101
PSM	LDQLDGSFDDPNTVVAK	1118	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15254	34.914	2	1832.8792	1832.8792	K	K	187	204
PSM	LEQMPSKEDAIEHFMK	1119	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14272	32.944	3	1931.9121	1931.9121	K	L	601	617
PSM	LGENDKTDLDVIR	1120	sp|Q70Z53-2|F10C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11218	26.957	3	1486.7627	1486.7627	R	E	98	111
PSM	LGGIPVGVVAVETR	1121	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17314	38.581	2	1365.798	1365.7980	R	T	1978	1992
PSM	LGLEFFDQPAVPLAR	1122	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=24383	52.235	2	1671.8984	1671.8984	R	A	69	84
PSM	LHPDKNPNNPNAHGDFLK	1123	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=6013	16.571	4	2026.9973	2026.9973	K	I	62	80
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	1124	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13975	32.42	5	3381.587	3381.5870	K	G	211	242
PSM	LLEQLQEIGQEK	1125	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16383	36.927	2	1426.7668	1426.7668	R	E	401	413
PSM	LLGELQEQIVQK	1126	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15550	35.45	2	1396.7926	1396.7926	K	N	358	370
PSM	LPAAGVGDMVMATVK	1127	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19230	42.215	3	1458.7575	1458.7575	R	K	52	67
PSM	LPCIYLVDSGGAYLPR	1128	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=22531	48.704	3	1792.9182	1792.9182	R	Q	165	181
PSM	LQQLEQDLTSDDALHCSQCGREPPTAQDGELAALHVK	1129	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	16-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=16269	36.724	5	4129.9433	4129.9433	R	E	821	858
PSM	LSHSDEKPYQCPVCQQR	1130	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5520	15.62	4	2130.9575	2130.9575	K	F	299	316
PSM	LYTLVTYVPVTTFK	1131	sp|P62899|RL31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23040	49.638	2	1643.9174	1643.9174	K	N	102	116
PSM	MGGGSIEVSVPR	1132	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12188	28.853	2	1187.5969	1187.5969	R	F	251	263
PSM	MNLLNQQIQEELSR	1133	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20370	44.471	2	1714.8672	1714.8672	K	V	1899	1913
PSM	MSATFIGNSTAIQELFK	1134	sp|P68371|TBB4B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25241	53.914	3	1856.9342	1856.9342	K	R	363	380
PSM	MVSLLSVLLSMQGAVDINK	1135	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:35	ms_run[2]:scan=27752	60.425	3	2033.0901	2033.0901	K	L	3911	3930
PSM	NADNNSSAFTALSEERDQLLSQVK	1136	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22012	47.558	3	2636.2678	2636.2678	K	E	736	760
PSM	NASTFEDVTQVSSAYQK	1137	sp|Q14247-3|SRC8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14817	33.954	2	1873.8694	1873.8694	K	T	283	300
PSM	NFINNPLAQADWAAK	1138	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20778	45.273	2	1671.8369	1671.8369	K	K	15	30
PSM	NLPLADQGSSHHITVK	1139	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8662	21.972	3	1715.8955	1715.8955	K	I	690	706
PSM	NVSETQQSLLSDQILELK	1140	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21598	46.753	3	2044.0688	2044.0688	R	S	924	942
PSM	PGASLPPLDLQALEK	1141	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21242	46.118	3	1547.8559	1547.8559	R	E	978	993
PSM	PGPSMTDGVSSGFLNR	1142	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15738	35.79	2	1620.7566	1620.7566	K	S	324	340
PSM	QAHLCVLASNCDEPMYVK	1143	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4,11-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=12215	28.9	3	2149.9595	2149.9595	R	L	46	64
PSM	QGIETPEDQNDLRK	1144	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=7473	19.6	3	1641.7958	1641.7958	K	M	228	242
PSM	QISQAYEVLSDAK	1145	sp|P31689-2|DNJA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14579	33.486	2	1450.7304	1450.7304	K	K	47	60
PSM	QVGYENAGTVEFLVDR	1146	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19466	42.749	2	1795.8741	1795.8741	K	H	301	317
PSM	QVLGQMVIDEELLGDGHSYSPR	1147	sp|P28070|PSB4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21461	46.51	3	2442.1849	2442.1849	K	A	110	132
PSM	QYQEQLEEEVAK	1148	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11689	27.805	2	1492.7046	1492.7046	K	V	1435	1447
PSM	RCPAEIVDTVSALVYDNK	1149	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	2-UNIMOD:4	ms_run[2]:scan=23906	51.295	3	2049.0201	2049.0201	R	L	1366	1384
PSM	SDIGEVILVGGMTR	1150	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20288	44.298	2	1445.7548	1445.7548	K	M	378	392
PSM	SETITEEELVGLMNK	1151	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=21844	47.204	2	1691.8288	1691.8288	R	F	160	175
PSM	SGDSEVYQLGDVSQK	1152	sp|Q04837|SSBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=12406	29.233	2	1610.7424	1610.7424	R	T	67	82
PSM	SGVSDHWALDDHHALHLTR	1153	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11879	28.228	5	2166.0355	2166.0355	K	K	270	289
PSM	SHFAIGLALYYPSAR	1154	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=20716	45.162	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHKPPISFPLCANGQVFGLYK	1155	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	11-UNIMOD:4	ms_run[2]:scan=23327	50.198	4	2359.2147	2359.2147	K	N	997	1018
PSM	SLMASEVDDHHAAIER	1156	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9126	22.786	3	1779.821	1779.8210	K	R	398	414
PSM	SLQADTTNTDTALTTLEEALAEKER	1157	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23773	51.051	3	2720.3352	2720.3352	K	T	603	628
PSM	SMPGKPPGMDPIASALR	1158	sp|Q04726-3|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15044	34.474	3	1723.8749	1723.8749	R	T	339	356
PSM	SQELQAQSSQIHDLESHSTVLAR	1159	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13435	31.2	3	2563.2627	2563.2627	R	E	1601	1624
PSM	SQGGEPTYNVAVGR	1160	sp|P35080-2|PROF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9521	23.469	2	1433.6899	1433.6899	K	A	92	106
PSM	SSLPGAKPGPSMTDGVSSGFLNR	1161	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14874	34.059	3	2261.111	2261.1110	K	S	317	340
PSM	SSQQPVSEVSTIPCPR	1162	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4	ms_run[2]:scan=11840	28.161	2	1770.857	1770.8570	R	I	1572	1588
PSM	STLGDLDTVAGLEK	1163	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17848	39.575	2	1417.73	1417.7300	R	E	903	917
PSM	STNGDTFLGGEDFDQALLR	1164	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22646	48.902	3	2054.9545	2054.9545	K	H	266	285
PSM	SYELPDGQVITIGNER	1165	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=19815	43.441	2	1789.8846	1789.8846	K	F	239	255
PSM	TDCNHIFLNFVPTVIMDPSK	1166	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	3-UNIMOD:4	ms_run[2]:scan=25267	53.969	3	2347.1341	2347.1341	R	I	1468	1488
PSM	TGSQYDIQDAIDK	1167	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13009	30.42	2	1452.6733	1452.6733	K	G	2524	2537
PSM	TKPADMVIEAYGHGQR	1168	sp|O94903|PLPHP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=11599	27.649	3	1771.8676	1771.8676	K	T	48	64
PSM	TNQIDLLQAEISENQAIIQK	1169	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=23130	49.805	3	2268.1961	2268.1961	K	L	1110	1130
PSM	TSETNTPQGNQEQLVTVMEER	1170	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16279	36.742	3	2390.102	2390.1020	R	M	2019	2040
PSM	TTTSSAMTSTIGFR	1171	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13340	31.035	2	1459.6977	1459.6977	R	V	280	294
PSM	TVAIYSEQDTGQMHR	1172	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=9057	22.669	3	1734.7995	1734.7995	R	Q	63	78
PSM	VAPSKWEAVDESELEAQAVTTSK	1173	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16501	37.138	3	2474.2177	2474.2177	K	W	756	779
PSM	VEVERDNLAEDIMR	1174	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=14616	33.552	3	1687.8199	1687.8199	R	L	171	185
PSM	VFSATLGLVDIVK	1175	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=22997	49.561	2	1360.7966	1360.7966	K	G	552	565
PSM	VGETSLLLSQR	1176	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=13222	30.81	2	1201.6667	1201.6667	K	E	1766	1777
PSM	VGGTSDVEVNEK	1177	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5449	15.469	2	1232.5885	1232.5885	K	K	406	418
PSM	VGINYQPPTVVPGGDLAK	1178	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=16811	37.684	3	1823.9781	1823.9781	K	V	353	371
PSM	VGLLCIMSDRDLYDK	1179	cov|corona06480|ORF1b_Norway/2505/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	5-UNIMOD:4	ms_run[2]:scan=20472	44.728	3	1796.8801	1796.8801	K	L	1493	1508
PSM	VRQELEAAESTHDAQR	1180	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=5303	15.202	3	1838.8871	1838.8871	R	K	1103	1119
PSM	VSYGIGDEEHDQEGR	1181	sp|P27695|APEX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=8020	20.758	3	1689.7231	1689.7231	K	V	142	157
PSM	VTVAGLAGKDPVQCSR	1182	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	14-UNIMOD:4	ms_run[2]:scan=10772	26.146	3	1656.8617	1656.8617	K	D	33	49
PSM	VTYGTEGLQQLQEFEAAIK	1183	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=25238	53.905	3	2124.0739	2124.0739	R	Q	183	202
PSM	VVSEDFLQDVSASTK	1184	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=18366	40.54	2	1623.7992	1623.7992	R	S	453	468
PSM	YLGINSDGLVVGR	1185	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=17717	39.343	2	1361.7303	1361.7303	K	S	116	129
PSM	YLYTLVITDKEK	1186	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15173	34.722	2	1484.8126	1484.8126	R	A	41	53
PSM	YLYTLVITDKEK	1187	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0		ms_run[2]:scan=15448	35.27	2	1484.8126	1484.8126	R	A	41	53
PSM	YVDNNFCGPDGYPLECIK	1188	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=19107	41.91	3	2159.9292	2159.9292	R	D	185	203
PSM	YYLCGFCPAELFTNTR	1189	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	28.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=25671	54.896	2	2010.8968	2010.8968	K	S	37	53
PSM	SLCEVQQEVLQLR	1190	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	3-UNIMOD:4	ms_run[1]:scan=19878	43.562287	2	1600.820937	1600.824292	R	S	2626	2639
PSM	CEAPDANQQLQQAMEER	1191	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=18218	40.260809	2	1999.8348	1999.8359	R	A	356	373
PSM	FLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAR	1192	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	32-UNIMOD:4	ms_run[1]:scan=20199	44.122654	5	4789.252257	4789.252570	R	E	903	951
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	1193	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	32-UNIMOD:4	ms_run[1]:scan=23440	50.409691	5	4030.884543	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	1194	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	32-UNIMOD:4	ms_run[1]:scan=29505	63.54714	4	4030.883277	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	1195	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=27290	59.094282	4	4029.882414	4027.852775	K	F	1448	1484
PSM	QTDQGSMQIPSRDDSTSLTAK	1196	sp|Q5VU43|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10078	24.604017	3	2267.059015	2265.054304	K	E	712	733
PSM	NQVAMNPTNTVFDAK	1197	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=13803	31.980896	2	1648.788755	1648.787906	K	R	57	72
PSM	LGVQTVAVYSEADR	1198	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=13807	31.989157	2	1507.767429	1506.767822	K	N	71	85
PSM	QGDEVSVHYDPMIAK	1199	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=15094	34.56802	2	1671.7632	1670.7602	R	L	422	437
PSM	VGEVIVTKDDAMLLK	1200	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0	12-UNIMOD:35	ms_run[1]:scan=13216	30.798173	3	1646.899985	1645.896060	K	G	345	360
PSM	RPLDDGVGNQLGALVHQR	1201	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=14592	33.508612	3	1946.035107	1944.028956	K	T	58	76
PSM	LDQLDGSFDDPNTVVAK	1202	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=15236	34.878572	2	1833.879774	1832.879223	K	K	229	246
PSM	QEYDESGPSIVHR	1203	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:28	ms_run[1]:scan=11116	26.776914	2	1498.6683	1498.6683	K	K	360	373
PSM	THINIVVIGHVDSGK	1204	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=12003	28.439659	3	1588.877256	1587.873290	K	S	6	21
PSM	TVEELLETGLIQVATKEEELNAIR	1205	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=27804	60.516197	3	2698.453575	2697.443641	K	T	746	770
PSM	IESIQLMMDSETGR	1206	sp|Q14498|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=18721	41.201635	2	1610.753637	1608.748743	R	S	276	290
PSM	CYSCGEFGHIQK	1207	sp|P62633-4|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=13616	31.616111	2	1468.5932	1467.5902	K	D	120	132
PSM	CGETGHVAINCSK	1208	sp|P62633-4|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	28.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=7886	20.522306	2	1414.5963	1414.5964	R	T	141	154
PSM	AGGDAEPRPAEPPAWAGGAR	1209	sp|Q96HS1|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=10307	25.064837	3	1932.933311	1931.923822	R	P	33	53
PSM	VFDKDGNGYISAAELR	1210	sp|P0DP23|CALM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=13730	31.83852	2	1754.864421	1753.863514	R	H	92	108
PSM	GLEHVTVDDLVAEITPK	1211	sp|Q9NPA8|ENY2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	28.0		ms_run[1]:scan=23106	49.758037	3	1836.963082	1834.967644	K	G	58	75
PSM	AAASLAAVSGTAAASLGSAQPTDLGAHK	1212	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16489	37.117	3	2493.2823	2493.2823	R	R	209	237
PSM	AAESVSKPDVSEEAPGPSK	1213	sp|Q9BY42|RTF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6791	18.15	3	1883.9113	1883.9113	K	V	204	223
PSM	AAFTAFEEAQLPR	1214	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18462	40.722	2	1449.7252	1449.7252	R	L	171	184
PSM	AEAGDNLGALVR	1215	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12889	30.209	2	1184.6149	1184.6149	R	G	316	328
PSM	AEEGIAAGGVMDVNTALQEVLK	1216	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=28015	60.887	3	2256.1308	2256.1308	M	T	2	24
PSM	AEEIEQLHEVIEK	1217	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13132	30.64	3	1565.7937	1565.7937	K	L	1736	1749
PSM	AEQLGAEGNVDESQK	1218	sp|Q9NQ29-2|LUC7L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6492	17.415	2	1573.722	1573.7220	K	I	140	155
PSM	AILVDLEPGTMDSVR	1219	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19588	42.964	3	1614.8287	1614.8287	R	S	63	78
PSM	AITGASLADIMAK	1220	sp|P83731|RL24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18501	40.808	2	1260.6748	1260.6748	R	R	81	94
PSM	ALNLGETFVTHSK	1221	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13573	31.499	2	1415.7409	1415.7409	K	G	702	715
PSM	AMLDQLMGTSR	1222	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:35	ms_run[2]:scan=11979	28.398	2	1237.5795	1237.5795	R	D	9	20
PSM	AMLDQLMGTSR	1223	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17227	38.431	2	1221.5846	1221.5846	R	D	9	20
PSM	AQAVHPGYGFLSENK	1224	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11784	28.057	3	1616.7947	1616.7947	R	E	136	151
PSM	AQDQGEKENPMR	1225	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1	ms_run[2]:scan=6029	16.605	2	1443.6412	1443.6412	M	E	2	14
PSM	AQLEAHLGQVMESVR	1226	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15619	35.581	3	1666.8461	1666.8461	R	Q	373	388
PSM	AQRPTATYCAVTDGIPAASEGK	1227	sp|Q6P087|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:4	ms_run[2]:scan=11839	28.16	3	2263.0903	2263.0903	R	I	164	186
PSM	AQTQEFQGSEDYETALSGK	1228	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14124	32.682	2	2087.9284	2087.9284	K	E	358	377
PSM	AQVQLDSDHLEEDIHR	1229	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11852	28.181	4	1903.9024	1903.9024	K	L	169	185
PSM	AQVVDLLQQELTAAEQR	1230	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24786	53.029	2	1911.0062	1911.0062	R	N	277	294
PSM	ARFEELCSDLFR	1231	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=17944	39.747	2	1541.7297	1541.7297	R	S	300	312
PSM	ASGPPVSELITK	1232	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13124	30.623	2	1197.6605	1197.6605	K	A	35	47
PSM	ATSNVFAMFDQSQIQEFK	1233	sp|P19105|ML12A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24580	52.623	3	2089.9779	2089.9779	R	E	17	35
PSM	AYIAYELNSVQHR	1234	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12909	30.248	2	1562.7841	1562.7841	R	Q	1157	1170
PSM	CGGAGHIASDCK	1235	sp|Q15637-6|SF01_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2338	9.0643	3	1231.5074	1231.5074	K	F	282	294
PSM	CGHTNNLRPK	1236	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=1995	8.4984	2	1195.588	1195.5880	K	K	115	125
PSM	CIKDEETGLCLLPLK	1237	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=17933	39.727	3	1787.9161	1787.9161	R	E	2433	2448
PSM	CPAEIVDTVSALVYDNK	1238	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=26509	56.938	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	1239	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=23934	51.345	3	1892.919	1892.9190	R	L	1367	1384
PSM	CQHAAHIISELILTAQER	1240	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4	ms_run[2]:scan=19627	43.037	4	2089.0739	2089.0739	R	D	310	328
PSM	CYSCGEFGHIQK	1241	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=8862	22.303	3	1484.6177	1484.6177	K	D	112	124
PSM	DANSSFFDNSSSPHLLDQLK	1242	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20126	43.989	3	2221.0287	2221.0287	R	A	265	285
PSM	DATSKDQLISELK	1243	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12714	29.844	2	1446.7566	1446.7566	R	A	858	871
PSM	DFSASYFSGEQEVTPSR	1244	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17043	38.092	2	1905.8381	1905.8381	R	S	240	257
PSM	DGIITQLTANLQQAR	1245	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22900	49.384	3	1640.8846	1640.8846	R	R	204	219
PSM	DIQEEKEEIQK	1246	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6552	17.513	2	1387.6831	1387.6831	R	K	684	695
PSM	DKECGQLLISENQK	1247	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=9284	23.07	2	1660.809	1660.8090	R	V	25	39
PSM	DLGSLNGTFVNDVR	1248	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18573	40.934	2	1505.7474	1505.7474	K	I	59	73
PSM	DLPTIPGVTSPSSDEPPMEASQSHLR	1249	sp|Q13541|4EBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18579	40.943	3	2747.3072	2747.3072	R	N	74	100
PSM	DLTLELEEPPQGPLPR	1250	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20779	45.275	3	1802.9414	1802.9414	R	G	756	772
PSM	DLYDKLQFTSLEIPR	1251	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22898	49.379	3	1836.9622	1836.9622	R	R	1503	1518
PSM	DNPTAQQIMQLLR	1252	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24397	52.261	2	1526.7875	1526.7875	R	E	956	969
PSM	DQMQQQLNDYEQLLDVK	1253	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24494	52.452	3	2106.9892	2106.9892	R	L	351	368
PSM	DQVLSLSHEIEECR	1254	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=15224	34.849	3	1713.7992	1713.7992	K	S	1107	1121
PSM	DVQIGDIVTVGECRPLSK	1255	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=17823	39.531	3	1985.0252	1985.0252	R	T	119	137
PSM	EDSALCGGGDICK	1256	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8307	21.267	2	1380.565	1380.5650	K	S	59	72
PSM	EEEIAALVIDNGSGMCK	1257	sp|P63261|ACTG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,16-UNIMOD:4	ms_run[2]:scan=26793	57.672	2	1876.8547	1876.8547	M	A	2	19
PSM	ELLESSLFEAQQQNSVIEVTK	1258	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21845	47.206	3	2391.2169	2391.2169	K	G	767	788
PSM	ELQEVIALTSQELEESR	1259	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24213	51.893	3	1972.9953	1972.9953	K	E	1064	1081
PSM	ELSNAKEELELMAK	1260	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14400	33.172	3	1603.8127	1603.8127	K	K	917	931
PSM	ENNVDAVHPGYGFLSER	1261	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14589	33.504	3	1902.886	1902.8860	K	A	108	125
PSM	EQHLLEQAELSR	1262	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10442	25.39	3	1451.7369	1451.7369	K	S	1981	1993
PSM	EQQIVIQSSGGLSKDDIENMVK	1263	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17135	38.26	3	2417.2108	2417.2108	R	N	542	564
PSM	EREEVLCQAGASEQLASQR	1264	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=10574	25.662	3	2160.0229	2160.0229	R	L	950	969
PSM	ERPGLGSNPCIPFFYR	1265	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	10-UNIMOD:4	ms_run[2]:scan=19314	42.406	3	1908.9305	1908.9305	R	A	975	991
PSM	ESLCDSPHQNLSR	1266	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=6148	16.809	3	1541.6893	1541.6893	R	P	62	75
PSM	ETGVDLTKDNMALQR	1267	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:35	ms_run[2]:scan=9443	23.339	3	1705.8305	1705.8305	R	V	293	308
PSM	ETGVDLTKDNMALQR	1268	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11756	27.991	3	1689.8356	1689.8356	R	V	293	308
PSM	EVDEQMLNVQNK	1269	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10994	26.557	2	1445.682	1445.6820	K	N	325	337
PSM	EVEIDQLNEQVTK	1270	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13018	30.436	2	1543.773	1543.7730	K	L	2283	2296
PSM	FCQDNQTISSEPER	1271	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=7852	20.459	2	1709.7315	1709.7315	K	T	2562	2576
PSM	FLFENQTPAHVYYR	1272	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15972	36.202	3	1783.8682	1783.8682	R	W	461	475
PSM	FQRPGDPQSAQDK	1273	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5016	14.701	3	1472.7008	1472.7008	K	A	294	307
PSM	FSSELEQIELHNSIR	1274	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15924	36.116	3	1800.9006	1800.9006	R	D	85	100
PSM	FVINYDYPNSSEDYIHR	1275	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16873	37.793	3	2130.9647	2130.9647	K	I	412	429
PSM	GAGSIAGASASPK	1276	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=4776	14.242	2	1072.5513	1072.5513	R	E	2014	2027
PSM	GFQFVSSSLPDICYR	1277	sp|P62633-2|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:4	ms_run[2]:scan=22047	47.638	2	1774.8349	1774.8349	R	C	35	50
PSM	GLAPVQAYLHIPDIIK	1278	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23341	50.224	3	1747.0032	1747.0032	R	V	89	105
PSM	GLEVEQLSTTCQNLQWLKEEMETK	1279	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=23719	50.951	3	2893.3838	2893.3838	K	F	708	732
PSM	GLIAAICAGPTALLAHEIGFGSK	1280	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=25808	55.235	3	2266.2144	2266.2144	K	V	100	123
PSM	HDAQQLQQLK	1281	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5539	15.659	2	1207.6309	1207.6309	R	H	37	47
PSM	HFYWYLTNEGIQYLR	1282	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22527	48.698	3	2001.9737	2001.9737	R	D	66	81
PSM	HGYIGEFEIIDDHR	1283	sp|P62244|RS15A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14947	34.194	3	1699.7954	1699.7954	K	A	44	58
PSM	HIEIQVLGDK	1284	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11597	27.646	2	1150.6346	1150.6346	R	H	269	279
PSM	HTHVQDGEAGGITQQIGATNVPLEAINEQTK	1285	sp|O60841|IF2P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15839	35.966	4	3255.612	3255.6120	R	M	653	684
PSM	HYVYIGDPAQLPAPR	1286	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13935	32.335	4	1695.8733	1695.8733	K	T	1318	1333
PSM	HYVYIGDPAQLPAPR	1287	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17110	38.215	3	1695.8733	1695.8733	K	T	1318	1333
PSM	IACHEEPVMDLDFDSQK	1288	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4	ms_run[2]:scan=15449	35.271	3	2032.887	2032.8870	R	A	204	221
PSM	IAECSSQLAEEEEKAK	1289	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=8448	21.558	3	1820.8462	1820.8462	R	N	1008	1024
PSM	IDFYFDENPYFENK	1290	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23244	50.022	2	1839.7992	1839.7992	R	V	124	138
PSM	IEEIKDFLLTAR	1291	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19269	42.306	3	1446.8082	1446.8082	K	R	5	17
PSM	IESIQLMMDSETGR	1292	sp|Q14498-2|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18802	41.354	3	1608.7487	1608.7487	R	S	276	290
PSM	IGQLEEQLEQEAK	1293	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14605	33.534	2	1513.7624	1513.7624	K	E	1823	1836
PSM	IINEPTAAAIAYGLDR	1294	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19716	43.203	2	1686.8941	1686.8941	R	T	172	188
PSM	ILAGLGFDPEMQNRPTQK	1295	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16052	36.346	3	2014.0306	2014.0306	R	F	396	414
PSM	ILSEVTPDQSKPEN	1296	sp|O43482|MS18B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8848	22.278	2	1555.773	1555.7730	K	-	216	230
PSM	IMNTFSVVPSPK	1297	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15239	34.886	2	1318.6955	1318.6955	R	V	163	175
PSM	IMNTFSVVPSPK	1298	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15618	35.58	2	1318.6955	1318.6955	R	V	163	175
PSM	IQTEIIEQEDLIK	1299	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=16830	37.717	2	1570.8454	1570.8454	K	A	1430	1443
PSM	ISLPLPNFSSLNLR	1300	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25434	54.399	2	1569.8879	1569.8879	R	E	411	425
PSM	ISVMGGEQAANVLATITK	1301	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:35	ms_run[2]:scan=20744	45.211	3	1817.9557	1817.9557	R	D	470	488
PSM	ITQELSDLQQER	1302	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11372	27.238	2	1458.7314	1458.7314	K	E	404	416
PSM	IVYTACSHAAVDALCEK	1303	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=15306	35.025	2	1906.8917	1906.8917	R	A	1227	1244
PSM	KFDQLLAEEK	1304	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10668	25.842	2	1219.6449	1219.6449	K	T	1445	1455
PSM	KGISLNPEQWSQLK	1305	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17371	38.688	3	1626.873	1626.8730	R	E	101	115
PSM	KGISLNPEQWSQLK	1306	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17405	38.784	3	1626.873	1626.8730	R	E	101	115
PSM	KGLIAAICAGPTALLAHEIGFGSK	1307	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=23593	50.714	3	2394.3093	2394.3093	R	V	99	123
PSM	KLEEEQIILEDQNCK	1308	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=12053	28.56	3	1887.9248	1887.9248	K	L	975	990
PSM	KLEEHEESLVGR	1309	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5973	16.476	3	1424.726	1424.7260	R	A	265	277
PSM	KLEVEANNAFDQYR	1310	sp|P47756-2|CAPZB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12562	29.572	3	1695.8216	1695.8216	R	D	95	109
PSM	KPLPDHVSIVEPK	1311	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9047	22.652	3	1457.8242	1457.8242	K	D	202	215
PSM	KPPLLNNADSVQAK	1312	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7720	20.096	3	1493.8202	1493.8202	K	V	748	762
PSM	LCSQMEQLEQENQQLK	1313	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=13891	32.21	3	2004.9245	2004.9245	K	E	103	119
PSM	LDHKFDLMYAK	1314	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11831	28.148	3	1379.6908	1379.6908	R	R	391	402
PSM	LETLTNQFSDSK	1315	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12165	28.807	2	1381.6725	1381.6725	K	Q	489	501
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	1316	sp|Q15366-4|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13927	32.312	5	3381.587	3381.5870	K	G	211	242
PSM	LIDLHSPSEIVK	1317	sp|P60866|RS20_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13153	30.676	3	1349.7555	1349.7555	R	Q	88	100
PSM	LIQLMEEIMAEKENK	1318	sp|Q92841-1|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21206	46.054	3	1817.9267	1817.9267	K	T	327	342
PSM	LLASANLEEVTMK	1319	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15951	36.164	2	1417.7487	1417.7487	K	Q	332	345
PSM	LLEEQLQHEISNK	1320	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13085	30.552	3	1579.8206	1579.8206	R	M	684	697
PSM	LNDLEDALQQAK	1321	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15709	35.737	2	1356.6885	1356.6885	K	E	444	456
PSM	LNDSILQATEQR	1322	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13293	30.945	2	1386.7103	1386.7103	R	R	1256	1268
PSM	LPAAGVGDMVMATVK	1323	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	9-UNIMOD:35	ms_run[2]:scan=14621	33.562	2	1474.7524	1474.7524	R	K	52	67
PSM	LQDEIQNMKEEMAR	1324	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=5515	15.61	3	1765.7975	1765.7975	R	H	365	379
PSM	LQDEIQNMKEEMAR	1325	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:35	ms_run[2]:scan=7773	20.237	3	1749.8026	1749.8026	R	H	365	379
PSM	LQDEIQNMKEEMAR	1326	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	12-UNIMOD:35	ms_run[2]:scan=8905	22.376	3	1749.8026	1749.8026	R	H	365	379
PSM	LQGEMAHIQVGQMTQAGLLEHLK	1327	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18757	41.268	4	2531.2988	2531.2988	R	L	592	615
PSM	LQVLEQQHVIDDLSLER	1328	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18491	40.786	3	2034.0746	2034.0746	R	E	400	417
PSM	LSALNEALALDK	1329	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=17956	39.77	2	1256.6976	1256.6976	K	V	601	613
PSM	LSSQITLLEAQNR	1330	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14933	34.168	2	1471.7995	1471.7995	K	T	509	522
PSM	LVSGGGACSDTGACTPAR	1331	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5884	16.294	2	1735.7618	1735.7618	R	S	643	661
PSM	MADEAVCVGPAPTSK	1332	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=9481	23.399	2	1531.7011	1531.7011	K	S	105	120
PSM	MDPNCSCSPVGSCACAGSCK	1333	sp|P80297|MT1X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	1-UNIMOD:1,5-UNIMOD:4,7-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=11892	28.251	3	2245.7989	2245.7989	-	C	1	21
PSM	MMNGGHYTYSENR	1334	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6644	17.693	3	1558.6293	1558.6293	K	V	133	146
PSM	NALQVDLAEAEK	1335	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14775	33.874	2	1299.667	1299.6670	R	R	641	653
PSM	NGSDGEEMTFSSLHQVR	1336	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12595	29.635	3	1892.8323	1892.8323	K	Y	1162	1179
PSM	NHIILQENAQHATR	1337	sp|Q69YN2-3|C19L1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5366	15.306	3	1643.8492	1643.8492	R	F	72	86
PSM	NIADLMTQAGVEELESENKIPATQK	1338	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35	ms_run[2]:scan=17553	39.062	3	2744.3538	2744.3538	K	S	51	76
PSM	NQDEESQEAPELLK	1339	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11460	27.398	2	1628.753	1628.7530	K	R	552	566
PSM	NSTHSSTAADLLQAK	1340	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8970	22.519	3	1542.7638	1542.7638	R	Q	253	268
PSM	NSVSNFLHSLER	1341	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19614	43.014	2	1401.7001	1401.7001	R	G	646	658
PSM	NTHLEAQLQK	1342	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=5443	15.457	2	1180.62	1180.6200	K	A	661	671
PSM	QDHPSSMGVYGQESGGFSGPGENR	1343	sp|Q01844-6|EWS_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11284	27.073	3	2479.0459	2479.0459	R	S	213	237
PSM	QEGIIFIGPPPSAIR	1344	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20551	44.868	2	1593.8879	1593.8879	K	D	144	159
PSM	QELSELHEQLLAR	1345	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=13396	31.134	2	1564.8209	1564.8209	R	T	482	495
PSM	QEQTEVTAALAR	1346	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10107	24.653	2	1315.6732	1315.6732	R	A	561	573
PSM	QFQGHTDGASCIDISHDGTK	1347	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4	ms_run[2]:scan=8229	21.13	3	2172.9494	2172.9494	R	L	613	633
PSM	QGPLHGMLINTPYVTK	1348	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15505	35.369	3	1767.9342	1767.9342	K	D	1565	1581
PSM	QISDLKNEIAELQGQAAVLK	1349	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22371	48.375	3	2167.1848	2167.1848	K	E	668	688
PSM	QKADEAYLIGR	1350	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9373	23.219	2	1262.6619	1262.6619	R	G	78	89
PSM	QLMLNEEQLEDMR	1351	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18130	40.096	2	1647.7596	1647.7596	R	Q	1579	1592
PSM	QLQQAAQEQAALR	1352	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8770	22.149	3	1453.7637	1453.7637	R	E	1371	1384
PSM	QNLGQEREEEEIR	1353	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6826	18.219	3	1628.7754	1628.7754	K	G	2078	2091
PSM	QQVPSGESAILDR	1354	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11377	27.248	2	1398.7103	1398.7103	K	V	270	283
PSM	QTIAHQQQQLTNLQMAAQR	1355	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11611	27.669	3	2207.1229	2207.1229	K	Q	43	62
PSM	QTSSTPSSLALTSASR	1356	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10349	25.168	2	1592.8006	1592.8006	K	I	859	875
PSM	QVTITGSAASISLAQYLINAR	1357	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=25656	54.863	3	2176.1852	2176.1852	R	L	326	347
PSM	QYQEHQQATELLR	1358	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8910	22.386	3	1642.8063	1642.8063	R	Q	1597	1610
PSM	RCPAEIVDTVSALVYDNK	1359	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	2-UNIMOD:4	ms_run[2]:scan=22302	48.188	4	2049.0201	2049.0201	R	L	1366	1384
PSM	SEHPGLSIGDTAK	1360	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7568	19.774	2	1310.6466	1310.6466	K	K	115	128
PSM	SFYPEEVSSMVLTK	1361	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20694	45.123	2	1615.7804	1615.7804	K	M	113	127
PSM	SGLEELVLSEMNSPSR	1362	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23836	51.165	2	1746.8458	1746.8458	R	T	643	659
PSM	SHFAIGLALYYPSAR	1363	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20072	43.897	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1364	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21057	45.794	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1365	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24036	51.558	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1366	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24474	52.417	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1367	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=27379	59.375	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1368	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23378	50.293	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SQVHTELQDLQR	1369	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=9194	22.905	2	1452.7321	1452.7321	K	Q	1281	1293
PSM	SREDAGDNDDTEGAIGVR	1370	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7028	18.642	3	1875.8195	1875.8195	R	N	375	393
PSM	STTSTIESFAAQEK	1371	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14002	32.47	2	1498.7151	1498.7151	R	Q	174	188
PSM	SVHSSVPLLNSKDPIDR	1372	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=11361	27.219	3	1862.985	1862.9850	K	I	1905	1922
PSM	SVYPVASPNECNQMCLSTLMK	1373	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4,15-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=16449	37.046	3	2444.0844	2444.0844	R	C	302	323
PSM	TAALVEEVYFAQK	1374	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=18582	40.947	3	1467.7609	1467.7609	K	E	163	176
PSM	TFAPEEISAMVLTK	1375	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=22670	48.949	2	1535.7905	1535.7905	K	M	139	153
PSM	TFQVLGNLYSEGDCTYLK	1376	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	14-UNIMOD:4	ms_run[2]:scan=22080	47.703	3	2106.9932	2106.9932	K	C	582	600
PSM	TFYNQAIMSSK	1377	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12689	29.806	2	1288.6122	1288.6122	R	N	194	205
PSM	TGDKECPFFIK	1378	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=12425	29.268	3	1340.6435	1340.6435	R	G	115	126
PSM	TGEMSGPVFTDSGIHIILR	1379	sp|Q13526|PIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20869	45.441	3	2029.0303	2029.0303	R	T	143	162
PSM	TGEPCVAELTEENFQR	1380	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=16761	37.598	2	1878.8418	1878.8418	R	L	254	270
PSM	TGEPCVAELTEENFQR	1381	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	5-UNIMOD:4	ms_run[2]:scan=16821	37.702	3	1878.8418	1878.8418	R	L	254	270
PSM	TIEDAIAVLSVAEEAADRHPER	1382	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23489	50.502	4	2391.203	2391.2030	R	R	146	168
PSM	TIGPDMFLGTCR	1383	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=16015	36.282	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TILSNQTVDIPENVDITLK	1384	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21028	45.737	3	2112.1314	2112.1314	K	G	3	22
PSM	TIQFVDWCPTGFK	1385	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	8-UNIMOD:4	ms_run[2]:scan=22467	48.59	2	1597.7599	1597.7599	R	V	305	318
PSM	TLYDFPGNDAEDLPFK	1386	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=21921	47.339	2	1840.8519	1840.8519	R	K	130	146
PSM	TPIIGSCGTQEQALLIDLTSNSCR	1387	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4,23-UNIMOD:4	ms_run[2]:scan=24015	51.513	3	2633.2789	2633.2789	R	R	3201	3225
PSM	TQLATLTSSLATVTQEK	1388	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=20153	44.041	2	1790.9626	1790.9626	K	S	163	180
PSM	TSAAQAIHPGCGFLSENMEFAELCK	1389	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	11-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=20545	44.86	3	2767.2404	2767.2404	K	Q	119	144
PSM	TSEEISLNDAGVELK	1390	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15864	36.009	2	1603.7941	1603.7941	R	S	653	668
PSM	TTEENPIFVVSR	1391	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15322	35.051	2	1390.7092	1390.7092	K	E	373	385
PSM	TYHYHCALHDK	1392	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	6-UNIMOD:4	ms_run[2]:scan=3644	11.765	3	1443.6354	1443.6354	R	A	68	79
PSM	VDCTANTNTCNK	1393	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=2489	9.3303	2	1396.5711	1396.5711	K	Y	83	95
PSM	VEVERDNLAEDIMR	1394	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	13-UNIMOD:35	ms_run[2]:scan=11191	26.91	3	1703.8148	1703.8148	R	L	171	185
PSM	VHELNEEIGK	1395	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=6289	17.054	2	1166.5932	1166.5932	R	L	126	136
PSM	VKEGMNIVEAMER	1396	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14287	32.971	2	1504.7378	1504.7378	K	F	132	145
PSM	VLDCGAAPGAWSQVAVQK	1397	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	4-UNIMOD:4	ms_run[2]:scan=15492	35.344	3	1855.9251	1855.9251	R	V	76	94
PSM	VLLESEQFLTELTR	1398	sp|P37108|SRP14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=24590	52.645	2	1676.8985	1676.8985	M	L	2	16
PSM	VLQDQVDELQSELEEYR	1399	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=23080	49.711	3	2091.996	2091.9960	R	A	546	563
PSM	VLSRPNAQELPSMYQR	1400	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=12279	29.013	3	1887.9625	1887.9625	R	L	108	124
PSM	VQALEEANNDLENK	1401	sp|P35527|K1C9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=10786	26.172	2	1585.7584	1585.7584	K	I	171	185
PSM	VQQAELHTGSLPR	1402	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=8166	21.019	2	1434.7579	1434.7579	K	I	826	839
PSM	VSEWEVIQESGTK	1403	sp|Q92995-2|UBP13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15045	34.476	2	1490.7253	1490.7253	R	L	249	262
PSM	VSVMGTDQSESINTSNETEYLK	1404	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=15474	35.314	3	2431.1061	2431.1061	K	Q	1092	1114
PSM	VTDDLVCLVYK	1405	sp|P49458|SRP09_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0	7-UNIMOD:4	ms_run[2]:scan=19218	42.181	2	1323.6744	1323.6744	K	T	42	53
PSM	VVDNSALGNSPYHR	1406	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=7849	20.452	3	1527.743	1527.7430	R	A	40	54
PSM	VVEEAPSIFLDAETR	1407	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=19535	42.873	2	1674.8465	1674.8465	K	R	299	314
PSM	VVEIAPAAHLDPQLR	1408	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	27.0		ms_run[2]:scan=14104	32.649	2	1627.9046	1627.9046	K	T	274	289
PSM	CCVETSALGHEWR	1409	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=11725	27.899206	3	1604.693991	1603.687146	R	L	624	637
PSM	HQELLECLKEESAAK	1410	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=11998	28.429938	3	1784.880174	1783.877449	K	A	1309	1324
PSM	QEGVMSVLTVCQR	1411	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:4	ms_run[1]:scan=16812	37.685535	2	1505.726169	1505.733034	K	Q	2016	2029
PSM	KELEGLQQLLQNVK	1412	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=20408	44.559699	3	1639.930380	1638.930471	R	S	1316	1330
PSM	VQIGEYTFEKGDYGDAVVYR	1413	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=23488	50.500353	3	2309.105517	2308.101178	K	G	1116	1136
PSM	SHFAIGLALYYPSAR	1414	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=27172	58.744781	3	1664.867371	1664.867477	K	I	1212	1227
PSM	CPAEIVDTVSALVYDNK	1415	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4	ms_run[1]:scan=26980	58.195455	3	1892.908198	1892.918980	R	L	1367	1384
PSM	FWEVISDEHGIDPTGTYHGDSDLQLER	1416	sp|P04350|TBB4A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19530	42.863342	4	3117.416772	3115.415923	K	I	20	47
PSM	IMQSSSEVGYDAMAGDFVNMVEK	1417	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	2-UNIMOD:35	ms_run[1]:scan=24222	51.908729	3	2524.100762	2523.096763	K	G	494	517
PSM	RPLDDGVGNQLGALVHQR	1418	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=14423	33.208792	3	1946.035107	1944.028956	K	T	58	76
PSM	GQYFGELALVTNKPR	1419	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=16644	37.390702	2	1691.901150	1691.899505	K	A	333	348
PSM	IHFPLATYAPVISAEK	1420	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19778	43.353689	2	1757.967747	1755.955957	R	A	265	281
PSM	THINIVVIGHVDSGK	1421	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12212	28.892762	3	1588.879142	1587.873290	K	S	6	21
PSM	VETGVLKPGMVVTFAPVNVTTEVK	1422	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=20907	45.507192	3	2514.376177	2514.376748	R	S	267	291
PSM	VDCQAYAQTCQK	1423	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=5727	16.022623	2	1471.624522	1470.623149	K	A	726	738
PSM	SVTNEDVTQEELGGAK	1424	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=9970	24.386939	2	1675.790706	1675.790074	K	T	233	249
PSM	AQQMVEILSDENR	1425	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=14665	33.647818	2	1531.728595	1531.730056	R	N	434	447
PSM	TGTITTFEHAHNMR	1426	sp|P13639|EF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=8404	21.435431	3	1615.759732	1614.757274	K	V	482	496
PSM	HFYWYLTNEGIQYLR	1427	sp|P46783|RS10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=22620	48.859673	3	2001.972984	2001.973733	R	D	66	81
PSM	GSYGDLGGPIITTQVTIPK	1428	sp|P61978|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=19826	43.462303	2	1918.030125	1916.025494	R	D	378	397
PSM	IITITGTQDQIQNAQYLLQNSVK	1429	sp|P61978|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=23990	51.460342	3	2588.381263	2588.380982	R	Q	434	457
PSM	FDSPESHVGVAWR	1430	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=12894	30.219475	3	1486.703997	1485.700077	R	L	197	210
PSM	GISLNPEQWSQLK	1431	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=20691	45.115622	2	1498.777954	1498.777993	K	E	102	115
PSM	NAIDDGCVVPGAGAVEVAMAEALIK	1432	sp|P40227|TCPZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	7-UNIMOD:4	ms_run[1]:scan=27686	60.306874	3	2470.225785	2469.224347	K	H	400	425
PSM	CGYPGHLTFECR	1433	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=11714	27.870658	3	1497.642857	1495.633654	K	N	18	30
PSM	PGGLLLGDVAPNFEANTTVGR	1434	sp|P30041|PRDX6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	27.0		ms_run[1]:scan=22105	47.748298	3	2098.0902	2097.0852	M	I	2	23
PSM	ETAENYLGHTAK	1435	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=7349	19.325577	2	1334.639134	1332.630994	K	N	176	188
PSM	LPAAGVGDMVMATVK	1436	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0	11-UNIMOD:35	ms_run[1]:scan=15528	35.411414	2	1475.741745	1474.752372	R	K	52	67
PSM	NFILDQTNVSAAAQR	1437	sp|Q00839|HNRPU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	27.0		ms_run[1]:scan=15455	35.282698	2	1647.828806	1646.837633	R	R	576	591
PSM	AAELIANSLATAGDGLIELR	1438	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24923	53.292	3	1997.0793	1997.0793	K	K	220	240
PSM	AAHSAELEAVLLALAR	1439	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24773	53.004	3	1633.9152	1633.9152	K	I	1885	1901
PSM	AALQELESEQGK	1440	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10683	25.891	2	1301.6463	1301.6463	K	G	2650	2662
PSM	ADVNLSHSER	1441	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4058	12.711	2	1126.5367	1126.5367	K	G	1146	1156
PSM	AFYPEEISSMVLTK	1442	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22879	49.345	3	1613.8011	1613.8011	K	M	113	127
PSM	AGAASLDVIQEVEYVKEEAK	1443	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21264	46.159	3	2148.095	2148.0950	R	M	401	421
PSM	AGTVVLDDVELR	1444	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=22853	49.291	2	1327.6983	1327.6983	M	E	2	14
PSM	AITIAGVPQSVTECVK	1445	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	14-UNIMOD:4	ms_run[2]:scan=16719	37.525	2	1671.8866	1671.8866	R	Q	145	161
PSM	AIVAIENPADVSVISSR	1446	sp|P08865|RSSA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18003	39.849	2	1739.9418	1739.9418	R	N	64	81
PSM	AKHYVYIGDPAQLPAPR	1447	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11956	28.357	4	1895.0054	1895.0054	R	T	1316	1333
PSM	ALKEEIGNVQLEK	1448	sp|Q86UP2|KTN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11141	26.822	3	1469.809	1469.8090	K	A	840	853
PSM	ALTVPELTQQVFDAK	1449	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22842	49.267	2	1658.8879	1658.8879	R	N	283	298
PSM	ASPSPTDPVVPAVPIGPPPAGFR	1450	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20494	44.769	3	2225.1845	2225.1845	K	D	520	543
PSM	ATAGDTHLGGEDFDNR	1451	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8495	21.684	3	1674.7234	1674.7234	K	L	221	237
PSM	ATEQHHTQPVLESNLCPDWPSHSEDASALQGGTSVAQIK	1452	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	16-UNIMOD:4	ms_run[2]:scan=15739	35.792	5	4224.9771	4224.9771	K	A	1275	1314
PSM	AVMSLLHTLEELK	1453	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23686	50.891	2	1482.8116	1482.8116	K	S	3011	3024
PSM	AYAAEQMEGFELQTK	1454	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16254	36.698	2	1714.7872	1714.7872	R	Q	279	294
PSM	CCYDHVISTSHK	1455	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=5820	16.189	3	1505.6391	1505.6391	K	L	952	964
PSM	CPAEIVDTVSALVYDNK	1456	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=27925	60.731	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	1457	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:4	ms_run[2]:scan=28401	61.535	2	1892.919	1892.9190	R	L	1367	1384
PSM	DACIIEKGEEHCGHLIEAHK	1458	sp|Q14061|COX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=8641	21.933	4	2345.0892	2345.0893	R	E	34	54
PSM	DAGVIAGLNVLR	1459	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19961	43.706	2	1196.6877	1196.6877	K	I	160	172
PSM	DAVSNTTNQLESK	1460	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9332	23.152	2	1405.6685	1405.6685	R	Q	431	444
PSM	DDLAALQEESSSLLQDK	1461	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22491	48.634	2	1860.8953	1860.8953	R	M	989	1006
PSM	DLNQLFQQDSSSR	1462	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17228	38.432	2	1536.7168	1536.7168	R	T	241	254
PSM	DRQDLAEQLQGLSSAK	1463	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15679	35.684	2	1757.8908	1757.8908	R	E	751	767
PSM	DTLFGPCGHIATCSLCSPR	1464	sp|Q86YT6|MIB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	7-UNIMOD:4,13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=16193	36.594	3	2147.9551	2147.9551	R	V	828	847
PSM	DTSYLFITGPDVVK	1465	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21535	46.645	2	1553.7977	1553.7977	K	S	219	233
PSM	EAGGGGVGGPGAK	1466	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2578	9.4766	2	1012.4938	1012.4938	K	S	40	53
PSM	EENKSDMNTVLNYIFSHAQVTK	1467	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24849	53.147	3	2567.2326	2567.2326	R	K	1015	1037
PSM	EGAAGAGVAQAGPLVDGELLR	1468	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19186	42.09	3	1950.0171	1950.0171	K	L	119	140
PSM	EHEHEIAWYTER	1469	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10135	24.7	2	1598.7114	1598.7114	R	S	233	245
PSM	ELEGLQQLLQNVK	1470	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24275	52.012	2	1510.8355	1510.8355	K	S	1317	1330
PSM	ELHAQLQSSDGTGQSRPPLPSEDLLK	1471	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14079	32.606	4	2802.4148	2802.4148	R	E	3313	3339
PSM	ELHLSWEVGK	1472	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14990	34.317	2	1196.619	1196.6190	R	P	1085	1095
PSM	ELHLSWEVGKPR	1473	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13036	30.466	3	1449.7728	1449.7728	R	P	1085	1097
PSM	ELVFKEDGQEYAQVIK	1474	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15791	35.883	3	1894.9676	1894.9676	R	M	25	41
PSM	EMEENFAVEAANYQDTIGR	1475	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:35	ms_run[2]:scan=17856	39.587	2	2201.9535	2201.9535	R	L	346	365
PSM	ENPEDVLSPTSVATYLSSK	1476	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23465	50.456	3	2035.995	2035.9950	K	S	1067	1086
PSM	EQCCYNCGKPGHLAR	1477	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4569	13.83	4	1848.7818	1848.7818	R	D	88	103
PSM	ESTGAQVQVAGDMLPNSTER	1478	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13703	31.791	2	2088.9746	2088.9746	R	A	125	145
PSM	EVEVIGGADKYHSVCR	1479	sp|P04183|KITH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4	ms_run[2]:scan=8833	22.255	3	1817.873	1817.8730	K	L	171	187
PSM	FEEEGNPYYSSAR	1480	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10484	25.486	2	1547.6529	1547.6529	K	V	513	526
PSM	FGDPVVQSDMK	1481	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:35	ms_run[2]:scan=8713	22.054	2	1237.5649	1237.5649	K	H	78	89
PSM	FGDPVVQSDMK	1482	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:35	ms_run[2]:scan=11124	26.791	2	1237.5649	1237.5649	K	H	78	89
PSM	FNADEFEDMVAEK	1483	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20093	43.931	2	1543.6501	1543.6501	K	R	176	189
PSM	FNADEFEDMVAEKR	1484	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18008	39.862	3	1699.7512	1699.7512	K	L	176	190
PSM	FSASGELGNGNIK	1485	sp|P12004|PCNA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10516	25.558	2	1292.6361	1292.6361	K	L	169	182
PSM	FVLALLSDLQDLK	1486	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=27696	60.325	2	1473.8443	1473.8443	R	W	4180	4193
PSM	GAQDVAGGSNPGAHNPSANLAR	1487	sp|O14654|IRS4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7297	19.197	3	2059.9784	2059.9784	R	G	1177	1199
PSM	GAVSAEQVIAGFNR	1488	sp|Q9UHV9|PFD2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18322	40.459	2	1417.7314	1417.7314	K	L	19	33
PSM	GHYTEGAELVDSVLDVVR	1489	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24404	52.279	3	1957.9745	1957.9745	K	K	104	122
PSM	GLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR	1490	sp|P00441|SODC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	21-UNIMOD:4	ms_run[2]:scan=16215	36.63	5	3518.6174	3518.6174	K	K	38	71
PSM	GLTQELEQFHQEQLTSLVEK	1491	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21613	46.782	3	2356.1911	2356.1911	R	H	757	777
PSM	GLYAAFDCTATMK	1492	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:4	ms_run[2]:scan=16338	36.847	2	1447.6476	1447.6476	R	S	843	856
PSM	GMGTVEGGDQSNPK	1493	sp|Q13428-2|TCOF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4806	14.295	2	1375.6038	1375.6038	K	S	1347	1361
PSM	GQALQGELEAALEAK	1494	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20284	44.288	3	1526.794	1526.7940	R	E	1785	1800
PSM	GSGGGSSGGSIGGR	1495	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2472	9.3042	2	1091.4956	1091.4956	R	G	603	617
PSM	GSTAPVGGGAFPTIVER	1496	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15825	35.943	2	1614.8366	1614.8366	R	E	390	407
PSM	GTLEPEYFNSVCR	1497	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=15325	35.058	2	1570.7086	1570.7086	K	L	1338	1351
PSM	GTLEQEVQELQLK	1498	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20228	44.177	2	1513.7988	1513.7988	K	T	739	752
PSM	GVITHDVSSAINR	1499	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9651	23.701	3	1367.7157	1367.7157	K	P	1401	1414
PSM	GVITHDVSSAINRPQIGVVR	1500	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13991	32.448	4	2117.1705	2117.1705	K	E	1401	1421
PSM	GVVTNGLDLSPADEK	1501	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13499	31.318	2	1513.7624	1513.7624	K	K	828	843
PSM	GYGFITFSDSECAK	1502	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	12-UNIMOD:4	ms_run[2]:scan=18297	40.413	2	1580.6817	1580.6817	K	K	292	306
PSM	HHEEEIVHHKK	1503	sp|Q9UII2|ATIF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1802	8.2046	4	1421.7164	1421.7164	K	E	73	84
PSM	HLNPSGTMNPTEQEK	1504	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6156	16.824	3	1681.773	1681.7730	K	L	1891	1906
PSM	HLPDQEQLNSLSQFK	1505	sp|Q9NSV4-1|DIAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15451	35.274	3	1782.8901	1782.8901	K	S	497	512
PSM	HLYTLDGGDIINALCFSPNR	1506	sp|P63244|RACK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	15-UNIMOD:4	ms_run[2]:scan=23512	50.559	3	2275.1056	2275.1056	K	Y	226	246
PSM	IDAFHYVQLGTAYR	1507	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18016	39.876	3	1652.8311	1652.8311	K	G	170	184
PSM	IHFPLATYAPVISAEK	1508	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19996	43.762	2	1755.956	1755.9560	R	A	265	281
PSM	IILDLISESPIK	1509	sp|P61978-3|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22887	49.36	2	1339.7963	1339.7963	K	G	184	196
PSM	IKDEFQFLQAQYHSLK	1510	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17310	38.576	3	1994.0262	1994.0262	R	V	29	45
PSM	ILESELEEQLSQHR	1511	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15438	35.252	3	1709.8584	1709.8584	K	G	1438	1452
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	1512	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	32-UNIMOD:4	ms_run[2]:scan=26377	56.554	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	1513	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	32-UNIMOD:4	ms_run[2]:scan=29608	63.749	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILHVNGFNGEGGEEDPQAAR	1514	sp|P63092|GNAS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11360	27.218	3	2108.9875	2108.9875	R	S	62	82
PSM	ILLAELEQLKGQGK	1515	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17296	38.552	3	1538.9032	1538.9032	K	S	130	144
PSM	ISNTAISISDHTALAQFCK	1516	sp|P22102-2|PUR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:4	ms_run[2]:scan=16478	37.098	3	2076.031	2076.0310	K	E	45	64
PSM	ITGLYPTLNISDEFSSNVANYQK	1517	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23424	50.378	4	2573.2649	2573.2649	R	V	1172	1195
PSM	ITLEAVLNTTCKK	1518	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=15872	36.023	3	1489.8174	1489.8174	K	C	99	112
PSM	IVQAEGEAEAAK	1519	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5400	15.363	2	1214.6143	1214.6143	K	M	225	237
PSM	IVYTACSHAAVDALCEK	1520	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=11948	28.345	3	1906.8917	1906.8917	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	1521	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=14686	33.696	2	1906.8917	1906.8917	R	A	1227	1244
PSM	IYVASVHQDLSDDDIK	1522	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12573	29.593	3	1816.8843	1816.8843	R	S	168	184
PSM	KAYVEANQMLGDLIK	1523	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18539	40.878	3	1691.8916	1691.8916	K	V	892	907
PSM	KFLDGIYVSEK	1524	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13348	31.049	2	1297.6918	1297.6918	R	G	174	185
PSM	KITQELSDLQQER	1525	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10896	26.356	3	1586.8264	1586.8264	K	E	403	416
PSM	KLASQGDSISSQLGPIHPPPR	1526	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11675	27.779	4	2184.1651	2184.1651	K	T	122	143
PSM	KSQVFSTAADGQTQVEIK	1527	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10587	25.683	3	1935.9902	1935.9902	K	V	468	486
PSM	KSTELVNEITCENTEWPGQR	1528	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=15919	36.105	3	2390.1172	2390.1172	R	S	41	61
PSM	KTSYAQHQQVR	1529	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2083	8.6416	3	1344.6898	1344.6898	R	Q	152	163
PSM	LALEQQQLICK	1530	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4	ms_run[2]:scan=13069	30.523	2	1342.7279	1342.7279	K	Q	60	71
PSM	LALHSGMDYAIMTGGDVAPMGR	1531	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18810	41.37	3	2262.0595	2262.0595	K	E	365	387
PSM	LDHKFDLMYAK	1532	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	8-UNIMOD:35	ms_run[2]:scan=9851	24.164	3	1395.6857	1395.6857	R	R	391	402
PSM	LDKAQIHDLVLVGGSTR	1533	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13698	31.781	4	1821.0108	1821.0108	K	I	326	343
PSM	LDKSQIHDIVLVGGSTR	1534	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12938	30.298	3	1837.0058	1837.0058	K	I	326	343
PSM	LDKSQIHDIVLVGGSTR	1535	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12956	30.331	4	1837.0058	1837.0058	K	I	326	343
PSM	LFIGGLPNYLNDDQVK	1536	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=22500	48.65	2	1804.9359	1804.9359	K	E	261	277
PSM	LLTSFTSQAVDR	1537	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13891	32.21	2	1336.6987	1336.6987	R	T	2988	3000
PSM	LNGTDPEDVIR	1538	sp|P19105|ML12A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11380	27.252	2	1227.6095	1227.6095	K	N	93	104
PSM	LQGAEEAAELQLAELER	1539	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20910	45.512	3	1868.948	1868.9480	R	N	1824	1841
PSM	LQSAQAQPFHQEEK	1540	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6012	16.57	3	1639.7954	1639.7954	R	E	1075	1089
PSM	LSELKETVELK	1541	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10398	25.293	3	1287.7286	1287.7286	K	S	591	602
PSM	LSSQEAASSFGDDR	1542	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9471	23.386	2	1468.643	1468.6430	R	L	244	258
PSM	LTEVHEELQK	1543	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5965	16.452	2	1224.635	1224.6350	K	K	515	525
PSM	LVQSPNSYFMDVK	1544	sp|P42677|RS27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16698	37.485	2	1526.7439	1526.7439	R	C	24	37
PSM	LYSILQGDSPTK	1545	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14148	32.726	2	1320.6925	1320.6925	K	W	477	489
PSM	MADSAASLEQQLEQVK	1546	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18968	41.656	2	1746.8458	1746.8458	R	L	687	703
PSM	MADSAASLEQQLEQVK	1547	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19067	41.838	3	1746.8458	1746.8458	R	L	687	703
PSM	MEEFKDQLPADECNK	1548	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:4	ms_run[2]:scan=10483	25.484	2	1852.7971	1852.7972	K	L	596	611
PSM	MIKPFFHSLSEK	1549	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12240	28.944	3	1462.7643	1462.7643	K	Y	37	49
PSM	MIKPFFHSLSEK	1550	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12260	28.981	2	1462.7643	1462.7643	K	Y	37	49
PSM	MKEIAEAYLGK	1551	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11207	26.938	2	1251.6533	1251.6533	K	T	127	138
PSM	MMNGGHYTYSENRVEK	1552	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6389	17.234	3	1914.8353	1914.8353	K	D	133	149
PSM	MSDLTPVHFTPLDSSVDR	1553	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17548	39.054	3	2015.9622	2015.9622	R	V	194	212
PSM	MSSYAFFVQTCR	1554	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=18304	40.426	2	1495.6588	1495.6588	K	E	13	25
PSM	MTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLR	1555	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21240	46.115	5	4146.9925	4146.9925	R	Q	104	145
PSM	NGIAFMGPPSQAMWALGDK	1556	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=24198	51.862	3	1989.9441	1989.9441	K	I	225	244
PSM	NPLDAGAAEPIASR	1557	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11126	26.794	2	1380.6997	1380.6997	R	A	10	24
PSM	NQGGYGGSSSSSSYGSGR	1558	sp|P09651-3|ROA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5112	14.879	2	1693.6928	1693.6928	R	R	248	266
PSM	NQNSWGTGEDVK	1559	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7844	20.444	2	1333.5899	1333.5899	K	V	517	529
PSM	NSVSNFLHSLER	1560	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19590	42.967	3	1401.7001	1401.7001	R	G	646	658
PSM	QAEEALSNCMQADK	1561	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	9-UNIMOD:4	ms_run[2]:scan=9224	22.956	2	1593.6763	1593.6763	K	T	164	178
PSM	QELEAAESTHDAQR	1562	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5010	14.689	3	1583.7176	1583.7176	R	K	1105	1119
PSM	QEPGSNEEIKEFAAGYNVK	1563	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14637	33.591	3	2109.0015	2109.0015	K	F	81	100
PSM	QEYDESGPSIVHR	1564	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8336	21.317	3	1515.6954	1515.6954	K	K	360	373
PSM	QGAPPAAGQGGALVELTPTPGGLALVSPYHTHR	1565	sp|Q9BV19|CA050_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19600	42.988	4	3219.6789	3219.6789	R	A	17	50
PSM	QGYVLSSIEGR	1566	sp|O43684-2|BUB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13682	31.752	2	1207.6197	1207.6197	K	V	192	203
PSM	QHRDDLAALQEESSSLLQDK	1567	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17605	39.152	4	2282.1139	2282.1139	R	M	986	1006
PSM	QLFHPEQLITGK	1568	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15424	35.228	2	1409.7667	1409.7667	R	E	85	97
PSM	QLFHPEQLITGKEDAANNYAR	1569	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14837	33.991	4	2414.1979	2414.1979	R	G	85	106
PSM	QLTLTQEALQSR	1570	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13347	31.047	2	1386.7467	1386.7467	K	E	725	737
PSM	QPAQELSPTPGGTAHQALK	1571	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8209	21.096	3	1929.9908	1929.9908	R	A	375	394
PSM	QQIQSIQQSIER	1572	sp|P55769|NH2L1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11473	27.423	2	1456.7634	1456.7634	K	L	114	126
PSM	QQNQHPEKPGGK	1573	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1835	8.2508	3	1346.6691	1346.6691	R	E	1085	1097
PSM	QTDQGSMQIPSRDDSTSLTAK	1574	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10060	24.571	3	2265.0543	2265.0543	K	E	875	896
PSM	RFGFPEGSVELYAEK	1575	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17042	38.09	3	1727.8519	1727.8519	K	V	76	91
PSM	RLEEELAVEGR	1576	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9408	23.279	2	1299.6783	1299.6783	R	R	1870	1881
PSM	SELEMAQEDLSMTQK	1577	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:35	ms_run[2]:scan=14756	33.833	2	1754.7703	1754.7703	K	D	1330	1345
PSM	SELVANNVTLPAGEQR	1578	sp|P42167-2|LAP2B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12738	29.885	2	1696.8744	1696.8744	K	K	18	34
PSM	SFYPEEVSSMVLTK	1579	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=20710	45.15	3	1615.7804	1615.7804	K	M	113	127
PSM	SGAEVEAGDAAER	1580	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=5160	14.956	2	1260.5582	1260.5582	K	R	17	30
PSM	SHFAIGLALYYPSAR	1581	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=25404	54.324	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1582	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=25698	54.968	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SINQQSGAHVELQR	1583	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=6596	17.585	2	1565.791	1565.7910	K	N	379	393
PSM	SIYGEKFEDENFILK	1584	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17861	39.597	3	1830.904	1830.9040	K	H	77	92
PSM	SKEGSSIPELAHSDAYQTR	1585	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9600	23.608	4	2074.992	2074.9920	R	E	2872	2891
PSM	SLCEVQQEVLQLR	1586	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=19821	43.452	2	1600.8243	1600.8243	R	S	2626	2639
PSM	SPPHCELMAGHLR	1587	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	5-UNIMOD:4	ms_run[2]:scan=8099	20.902	4	1503.7075	1503.7075	K	N	186	199
PSM	SSSAEESGQDVLENTFSQK	1588	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16138	36.499	3	2041.9076	2041.9076	R	H	542	561
PSM	STATPSPSPHAWDLQLLQQQACPMVPR	1589	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	22-UNIMOD:4	ms_run[2]:scan=21041	45.762	3	3015.4695	3015.4695	R	E	1965	1992
PSM	STNFQIISSYPDDESVYCTTEK	1590	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	18-UNIMOD:4	ms_run[2]:scan=18784	41.315	3	2583.1323	2583.1323	R	Y	61	83
PSM	STQPDEQLTMNSEK	1591	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8519	21.73	2	1606.7145	1606.7145	K	S	23	37
PSM	SVYPVASPNECNQMCLSTLMK	1592	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4,14-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=17325	38.597	3	2444.0844	2444.0844	R	C	302	323
PSM	SYGRPPPDVEGMTSLK	1593	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	1-UNIMOD:1	ms_run[2]:scan=15358	35.113	2	1774.856	1774.8560	M	V	2	18
PSM	SYSNITVNEDQIK	1594	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=11527	27.517	2	1509.7311	1509.7311	R	L	477	490
PSM	TALALEVGDIVK	1595	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=19274	42.316	2	1227.7075	1227.7075	K	V	254	266
PSM	TALHEKEETLR	1596	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=4019	12.607	3	1325.6939	1325.6939	K	L	1064	1075
PSM	TICSHVQNMIK	1597	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	3-UNIMOD:4	ms_run[2]:scan=10021	24.478	2	1329.6533	1329.6533	R	G	72	83
PSM	TIGPDMFLGTCR	1598	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=15656	35.645	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	1599	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=18855	41.457	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	1600	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=19080	41.865	2	1366.6373	1366.6373	K	R	1354	1366
PSM	TKDGQILPVPNVVVR	1601	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15216	34.829	3	1633.9515	1633.9515	K	D	319	334
PSM	TLTSQDDKPLNYGHALLPGEGAAMAEYVK	1602	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18331	40.475	4	3088.5176	3088.5176	K	A	298	327
PSM	TPYGASIFQSK	1603	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13494	31.308	2	1197.603	1197.6030	R	E	729	740
PSM	TSMNAHSLSEEADSLK	1604	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12191	28.857	3	1718.7781	1718.7781	K	H	2362	2378
PSM	TSVMVNSFSQDLLMEHIQEIR	1605	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23361	50.262	3	2476.209	2476.2090	K	T	1383	1404
PSM	TVAIYSEQDTGQMHR	1606	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=7427	19.515	3	1750.7944	1750.7944	R	Q	63	78
PSM	TVDNFVALATGEK	1607	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18449	40.692	2	1363.6983	1363.6983	K	G	72	85
PSM	TWGDLGAAAGGGTPSK	1608	sp|P31323|KAP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12604	29.651	2	1444.6947	1444.6947	R	G	57	73
PSM	VALTHLTLDLEER	1609	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=16969	37.966	3	1508.8199	1508.8199	R	S	1588	1601
PSM	VCIESEHSMDTLLATLKK	1610	sp|O00244|ATOX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	2-UNIMOD:4,9-UNIMOD:35	ms_run[2]:scan=18572	40.933	4	2090.0388	2090.0388	K	T	40	58
PSM	VESGGPGTSAASAR	1611	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=3654	11.79	2	1245.5949	1245.5949	R	R	153	167
PSM	VESLQEEIAFLK	1612	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21926	47.349	2	1404.75	1404.7500	K	K	224	236
PSM	VEVERDNLAEDIMR	1613	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	13-UNIMOD:35	ms_run[2]:scan=14672	33.664	3	1703.8148	1703.8148	R	L	171	185
PSM	VEVGTEVTDYR	1614	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=10893	26.352	2	1266.6092	1266.6092	K	F	1410	1421
PSM	VFGVDDNQDYNRPVINEK	1615	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13070	30.525	3	2121.0127	2121.0127	K	H	523	541
PSM	VGGTNLGAPGAFGQSPFSQPPAPPHQNTFPPR	1616	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17587	39.121	4	3227.5901	3227.5901	K	S	425	457
PSM	VGVKPVGSDPDFQPELSGAGSR	1617	sp|O43396|TXNL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=13041	30.476	3	2198.0968	2198.0968	M	L	2	24
PSM	VHSQGPHHVCELCNK	1618	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=2818	9.9856	4	1800.8148	1800.8148	K	G	412	427
PSM	VIAHGKDHPTAATK	1619	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=1958	8.446	4	1444.7787	1444.7787	K	M	429	443
PSM	VKEGMNIVEAMER	1620	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=14262	32.927	2	1504.7378	1504.7378	K	F	132	145
PSM	VLEQLTGQTPVFSK	1621	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=15905	36.081	2	1545.8403	1545.8403	K	A	39	53
PSM	VLGIELLEQAVEDAR	1622	sp|Q96GJ1-3|TRM2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=27785	60.484	2	1653.8938	1653.8938	R	W	324	339
PSM	VLIANNGIAAVK	1623	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12120	28.704	2	1181.7132	1181.7132	K	C	121	133
PSM	VLRHEEFEEGCK	1624	sp|Q9HC38-2|GLOD4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0	11-UNIMOD:4	ms_run[2]:scan=5086	14.832	3	1531.7089	1531.7089	K	A	31	43
PSM	VMLGETNPADSKPGTIR	1625	sp|P22392|NDKB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=9867	24.201	3	1784.9091	1784.9091	R	G	89	106
PSM	VQIGEYTFEKGDYGDAVVYR	1626	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=17868	39.608	2	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	1627	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=28382	61.504	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQQLTGEAENSNLQR	1628	sp|Q8N8E3|CE112_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=8589	21.849	2	1685.8333	1685.8333	R	Q	417	432
PSM	VQSSTLVSSLEAELSEVK	1629	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=26028	55.729	3	1904.9943	1904.9943	K	I	1649	1667
PSM	VSHLLGINVTDFTR	1630	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=18746	41.247	3	1570.8467	1570.8467	K	G	374	388
PSM	VVHSYEELEENYTR	1631	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12277	29.01	3	1766.8111	1766.8111	R	A	206	220
PSM	VVQEENQHMQMTIQALQDELR	1632	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=21052	45.781	3	2539.2159	2539.2159	R	I	217	238
PSM	VYNVTQHAVGIVVNK	1633	sp|P46778|RL21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=12267	28.993	3	1639.9046	1639.9046	R	Q	64	79
PSM	YHPDKNPNEGEK	1634	sp|P31689-2|DNJA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=2100	8.6693	3	1426.6477	1426.6477	K	F	33	45
PSM	YSTLQGPPGTGK	1635	cov|corona03981|ORF1b_Kazakhstan/26548/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=7599	19.831	2	1204.6088	1204.6088	K	S	1200	1212
PSM	YVASYLLAALGGNSSPSAK	1636	sp|P05387|RLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	26.0		ms_run[2]:scan=23586	50.703	2	1867.968	1867.9680	R	D	3	22
PSM	QEGVMSVLTVCQR	1637	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:4	ms_run[1]:scan=16754	37.585257	2	1505.726169	1505.733034	K	Q	2016	2029
PSM	VTELSALLTQSQK	1638	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17906	39.678338	2	1416.783893	1416.782410	R	Q	285	298
PSM	DIQEEKEEIQK	1639	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=6536	17.48799	2	1387.682911	1387.683090	R	K	684	695
PSM	QHRDDLAALQEESSSLLQDK	1640	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28	ms_run[1]:scan=19906	43.60932	3	2265.0853	2265.0868	R	M	986	1006
PSM	LQAVSESTVPPSLPVDSVVITESDAQR	1641	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=20517	44.808474	3	2825.467148	2823.450183	R	T	1372	1399
PSM	TCVFEKENDPSVMR	1642	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4,13-UNIMOD:35	ms_run[1]:scan=8118	20.934509	3	1726.765816	1726.765456	K	S	742	756
PSM	IAELEEELVCVQK	1643	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4	ms_run[1]:scan=17684	39.287065	2	1558.791784	1558.791260	R	E	2655	2668
PSM	SAAQPSTSPAEVQSLKK	1644	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7226	19.053179	3	1727.906379	1727.905378	R	A	2865	2882
PSM	VFSCLDDGMGHASVER	1645	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=12188	28.852681	3	1778.773090	1778.771604	R	I	294	310
PSM	NLPIYSEEIVEMYK	1646	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=22625	48.86724	2	1727.845887	1726.848775	K	G	126	140
PSM	DFSALESQLQDTQELLQEENR	1647	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=26267	56.288344	3	2492.164765	2492.166691	K	Q	1302	1323
PSM	EQNLNMQLFSEIHNLQNK	1648	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=21367	46.341516	3	2200.074916	2199.074251	K	F	1216	1234
PSM	QLLFVVEIVDKYFDCYDGGCINANQVIVNNLDK	1649	cov|corona12378|ORF1b_Latvia/023/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:28,15-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=27929	60.737087	4	3859.8752	3857.8642	R	S	459	492
PSM	CCYDHVISTSHK	1650	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=9816	24.093466	2	1489.6132	1488.6122	K	L	952	964
PSM	SHKPPISFPLCANGQVFGLYK	1651	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	11-UNIMOD:4	ms_run[1]:scan=21539	46.650822	4	2361.215687	2359.214708	K	N	997	1018
PSM	VQIGEYTFEKGDYGDAVVYR	1652	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=27424	59.552292	3	2309.103553	2308.101178	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	1653	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=22881	49.348034	3	2309.105065	2308.101178	K	G	1116	1136
PSM	SHFAIGLALYYPSAR	1654	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=24200	51.865283	3	1664.867966	1664.867477	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	1655	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=24797	53.051	3	1665.871582	1664.867477	K	I	1212	1227
PSM	HYVYIGDPAQLPAPR	1656	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=15208	34.810118	3	1697.891831	1695.873290	K	T	1318	1333
PSM	RCPAEIVDTVSALVYDNK	1657	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4	ms_run[1]:scan=24231	51.924881	3	2050.015940	2049.020091	R	L	1366	1384
PSM	CPAEIVDTVSALVYDNK	1658	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4	ms_run[1]:scan=26798	57.682305	3	1892.908198	1892.918980	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	1659	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4	ms_run[1]:scan=29945	64.439763	3	1893.920698	1892.918980	R	L	1367	1384
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	1660	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=29505	63.54714	4	4029.884851	4027.852775	K	F	1448	1484
PSM	TVAIYSEQDTGQMHR	1661	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:35	ms_run[1]:scan=7395	19.445468	3	1751.791220	1750.794448	R	Q	63	78
PSM	ASPSPTDPVVPAVPIGPPPAGFR	1662	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=20421	44.598266	3	2225.184155	2225.184454	K	D	520	543
PSM	GVIMHDVSSAINRPQIGVVR	1663	cov|corona04460|ORF1b_Brazil/L15_CD282/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=12790	29.973467	3	2148.154521	2147.163341	K	E	1401	1421
PSM	ITNLTQQLEQASIVK	1664	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=18711	41.179698	2	1684.933935	1684.935950	K	K	1612	1627
PSM	SLYASSPGGVYATR	1665	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=11434	27.348793	3	1427.705532	1427.704494	R	S	51	65
PSM	LYSPSQIGAFVLMK	1666	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	13-UNIMOD:35	ms_run[1]:scan=22447	48.548269	2	1570.832005	1568.827252	K	M	160	174
PSM	SDIGEVILVGGMTR	1667	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=20385	44.498281	2	1445.753534	1445.754815	K	M	378	392
PSM	REAEAELSGELSGLGALPAR	1668	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17754	39.408004	3	2026.050645	2025.049083	R	R	735	755
PSM	HWPFMVVNDAGRPK	1669	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14540	33.418521	3	1652.824873	1652.824566	K	V	89	103
PSM	DAGTIAGLNVLR	1670	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17898	39.66389	2	1198.667044	1198.666986	K	I	160	172
PSM	IMNTFSVVPSPK	1671	sp|Q13509|TBB3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:35	ms_run[1]:scan=13462	31.25076	2	1334.691015	1334.690424	R	V	163	175
PSM	LHFFMPGFAPLTSR	1672	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	5-UNIMOD:35	ms_run[1]:scan=19674	43.124953	3	1636.824239	1635.823169	R	G	263	277
PSM	CMLQDREDQSILCTGESGAGK	1673	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=12701	29.826374	3	2356.025110	2354.030080	R	T	164	185
PSM	KVDDDLGTIESLEEAK	1674	sp|P35580|MYH10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=16399	36.953709	3	1760.868855	1760.867990	K	K	1379	1395
PSM	MFESFIESVPLLK	1675	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=26335	56.465859	2	1538.804179	1538.805453	K	S	251	264
PSM	HVINFDLPSDIEEYVHR	1676	sp|O00571|DDX3X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=21907	47.315028	3	2082.017452	2082.017054	K	I	512	529
PSM	RFGFPEGSVELYAEK	1677	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17105	38.204731	3	1727.852293	1727.851886	K	V	76	91
PSM	LALEQQQLICK	1678	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4	ms_run[1]:scan=13158	30.685847	2	1342.727127	1342.727872	K	Q	60	71
PSM	CPVAQLEQDDQVSPSSTFCK	1679	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	1-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=14597	33.51956	2	2297.022556	2295.014748	K	V	252	272
PSM	LLMMAGIDDCYTSAR	1680	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	10-UNIMOD:4	ms_run[1]:scan=19164	42.026452	2	1716.772556	1715.768099	K	G	213	228
PSM	TYHGDVFSTSSESPSIISSESDFR	1681	sp|Q12923|PTN13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=17211	38.401988	3	2635.169472	2634.172171	K	Q	406	430
PSM	LPAAGVGDMVMATVK	1682	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19166	42.029432	2	1458.747654	1458.757457	R	K	52	67
PSM	QITEEDLEGKTEEEIEMMK	1683	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19699	43.172488	3	2281.032727	2281.034145	R	L	87	106
PSM	TGTAEMSSILEER	1684	sp|P25705|ATPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=15089	34.560642	2	1423.662782	1422.666059	K	I	46	59
PSM	CGYPGHLTFECR	1685	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	26.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=16017	36.284218	2	1478.6048	1478.6066	K	N	18	30
PSM	YPLISDFGEEHGFSLYEIK	1686	sp|A7MCY6|TBKB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=23657	50.834351	3	2244.088342	2243.078651	K	D	76	95
PSM	GCIGTFSAMNLHSGLR	1687	sp|Q6DCA0|AMERL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	2-UNIMOD:4	ms_run[1]:scan=15587	35.522596	3	1720.821113	1719.818495	R	E	152	168
PSM	AGAASLDVIQEVEYVKEEAK	1688	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=21290	46.203202	3	2150.100072	2148.095030	R	M	401	421
PSM	EGIAMDQLLSQSLPNDGDEKYEK	1689	sp|Q9BRP1|PDD2L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=19859	43.526329	3	2580.206281	2579.206113	R	T	218	241
PSM	NASTFEDVTQVSSAYQK	1690	sp|Q14247|SRC8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=14828	33.972063	2	1875.873997	1873.869387	K	T	320	337
PSM	GSLGSQGAKDEPEEELQK	1691	sp|Q13428|TCOF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0		ms_run[1]:scan=7887	20.523806	3	1901.904714	1900.901415	K	G	1406	1424
PSM	EAVCFIPGEGHTLQEHQIVLVEGGR	1692	sp|O15235|RT12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	26.0	4-UNIMOD:4	ms_run[1]:scan=17346	38.634287	3	2777.388875	2774.380999	R	T	90	115
PSM	AAELWGEQAEAR	1693	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12101	28.647	2	1329.6313	1329.6313	R	R	510	522
PSM	AEDKEWMPVTK	1694	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9808	24.067	3	1332.6384	1332.6384	K	L	55	66
PSM	AELQTALAHTQHAAR	1695	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7582	19.802	3	1616.8383	1616.8383	K	Q	231	246
PSM	AGNLGGGVVTIER	1696	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11650	27.737	2	1241.6728	1241.6728	K	S	53	66
PSM	ALDIAENEMPGLMR	1697	sp|P23526|SAHH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19430	42.674	2	1558.7483	1558.7483	K	M	21	35
PSM	ALEEETKNHEAQIQDMR	1698	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8838	22.265	3	2040.9535	2040.9535	K	Q	1182	1199
PSM	ALGQNPTNAEVLK	1699	sp|P60660|MYL6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9890	24.245	2	1353.7252	1353.7252	R	V	38	51
PSM	ALQDSWLQAQAVLK	1700	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20892	45.481	2	1569.8515	1569.8515	R	E	1923	1937
PSM	ALQQLQEELQNK	1701	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14149	32.728	2	1440.7573	1440.7573	K	S	566	578
PSM	AQALSEEEFQR	1702	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=16169	36.554	2	1348.6259	1348.6259	M	M	2	13
PSM	AQFEGIVTDLIR	1703	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=22800	49.18	2	1360.7351	1360.7351	R	R	349	361
PSM	AQGGSSDSSLALHER	1704	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5834	16.21	3	1513.7121	1513.7121	R	I	1029	1044
PSM	ARAEALQEALGK	1705	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9205	22.923	2	1255.6884	1255.6884	R	A	1961	1973
PSM	ARFEELNADLFR	1706	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17332	38.611	3	1479.747	1479.7470	R	G	300	312
PSM	ASANIGCNHTGVVGEGSEGLNDNLLEILQK	1707	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=22184	47.892	4	3108.5146	3108.5146	R	E	427	457
PSM	ATCEFCGTENLTK	1708	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10342	25.153	2	1529.649	1529.6490	K	E	339	352
PSM	ATENDIYNFFSPLNPVR	1709	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25686	54.94	3	1995.969	1995.9690	K	V	300	317
PSM	ATSSSSGSLSATGR	1710	sp|Q03252|LMNB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=4081	12.759	2	1267.6004	1267.6004	R	L	417	431
PSM	AVCMLSNTTAIAEAWAR	1711	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4	ms_run[2]:scan=22929	49.44	3	1863.8971	1863.8971	R	L	374	391
PSM	AVFVDLEPTVIDEVR	1712	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=22608	48.836	2	1700.8985	1700.8985	R	T	65	80
PSM	CGFCHVGEEENEAR	1713	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7068	18.729	3	1692.6621	1692.6621	K	G	178	192
PSM	CPAEIVDTVSALVYDNK	1714	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=26754	57.565	3	1892.919	1892.9190	R	L	1367	1384
PSM	CSSQQPPGSK	1715	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4	ms_run[2]:scan=2076	8.6301	2	1074.4764	1074.4764	K	T	528	538
PSM	CTKEEHLCTQR	1716	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=2333	9.0547	3	1460.65	1460.6500	K	M	226	237
PSM	DGGNQEVEIAR	1717	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7290	19.184	2	1186.5578	1186.5578	K	C	319	330
PSM	DILLQQQQQLGHGGPEAAPR	1718	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12530	29.503	3	2155.1134	2155.1134	K	A	90	110
PSM	DLYDKLQFTSLEIPR	1719	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=22829	49.238	3	1836.9622	1836.9622	R	R	1503	1518
PSM	DMQEQGQFETEMLQK	1720	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16061	36.362	2	1840.7971	1840.7971	K	K	2516	2531
PSM	DNHLLGTFDLTGIPPAPR	1721	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21362	46.334	3	1933.0058	1933.0058	K	G	475	493
PSM	DQLIQEAAAENNK	1722	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10166	24.753	2	1442.7001	1442.7001	K	L	2500	2513
PSM	DSSTCPGDYVLSVSENSR	1723	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=16620	37.348	3	1971.848	1971.8480	R	V	40	58
PSM	DTNGSQFFITTVK	1724	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17428	38.844	2	1456.7198	1456.7198	K	T	146	159
PSM	DVVICPDASLEDAKK	1725	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=11967	28.377	3	1658.8185	1658.8185	R	E	49	64
PSM	DYAAYNVLDDPELR	1726	sp|Q86SX6|GLRX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20158	44.051	2	1652.7682	1652.7682	R	Q	84	98
PSM	EEFLIPIYHQVAVQFADLHDTPGR	1727	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25248	53.927	4	2794.4079	2794.4079	R	M	2172	2196
PSM	EFHLNESGDPSSK	1728	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8109	20.918	2	1445.6423	1445.6423	K	S	142	155
PSM	EHASSLASSGLK	1729	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5214	15.046	2	1185.599	1185.5990	K	K	680	692
PSM	EKADALQGALEQAHMTLK	1730	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16118	36.465	4	1952.999	1952.9990	K	E	1838	1856
PSM	ELAEDGYSGVEVR	1731	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11522	27.509	2	1422.6627	1422.6627	R	V	28	41
PSM	ELNSNHDGADETSEKEQQEAIEHIDEVQNEIDR	1732	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17552	39.06	5	3820.6896	3820.6896	K	L	12	45
PSM	ELPPGIGDMVELMGVQDQHMDER	1733	sp|Q96N16|JKIP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25348	54.163	3	2595.1767	2595.1767	R	D	263	286
PSM	ENQQHYGDLLNHCAVLEK	1734	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	13-UNIMOD:4	ms_run[2]:scan=12541	29.525	4	2167.0117	2167.0117	R	Q	3083	3101
PSM	EPEPFGASAAGLEQPGAR	1735	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14466	33.287	2	1782.8537	1782.8537	K	E	922	940
PSM	EQEIVVLQQQLQEAR	1736	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19071	41.846	3	1809.9585	1809.9585	R	E	1777	1792
PSM	EQESIIQQLQTSLHDR	1737	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20835	45.379	3	1923.965	1923.9650	K	N	738	754
PSM	EQHLLEQAELSR	1738	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10503	25.525	2	1451.7369	1451.7369	K	S	1981	1993
PSM	EQLEEEEEAKHNLEK	1739	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7683	19.985	3	1853.8643	1853.8643	R	Q	1343	1358
PSM	EQQIVIQSSGGLSK	1740	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10384	25.256	2	1472.7835	1472.7835	R	D	542	556
PSM	EQQIVIQSSGGLSKDDIENMVK	1741	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	20-UNIMOD:35	ms_run[2]:scan=13287	30.934	3	2433.2057	2433.2057	R	N	542	564
PSM	EQSLQSQLDEAQR	1742	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10881	26.332	2	1530.7274	1530.7274	K	A	1798	1811
PSM	ERVEAVNMAEGIIHDTETK	1743	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17682	39.284	3	2141.0423	2141.0423	K	M	577	596
PSM	ERVEAVNMAEGIIHDTETK	1744	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17737	39.379	4	2141.0423	2141.0423	K	M	577	596
PSM	ESEEAAGAGPR	1745	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2892	10.175	2	1072.4785	1072.4785	R	R	868	879
PSM	EVLHNQLLLQTQLVDQLQQQEAQGK	1746	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21368	46.343	4	2900.5356	2900.5356	K	A	634	659
PSM	FLSDVYPDGFK	1747	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17633	39.2	2	1286.6183	1286.6183	K	G	503	514
PSM	GECQACDQLHFCR	1748	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	3-UNIMOD:4,6-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9663	23.723	3	1679.6603	1679.6603	R	R	97	110
PSM	GGFCNFMHLKPISR	1749	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4	ms_run[2]:scan=15411	35.206	4	1662.8123	1662.8123	R	E	166	180
PSM	GGGHVAQIYAIR	1750	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9475	23.391	2	1240.6677	1240.6677	K	Q	74	86
PSM	GPSYGLSAEVK	1751	sp|Q15417-3|CNN3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10192	24.798	2	1106.5608	1106.5608	K	N	7	18
PSM	GQLEVQIQTVTQAK	1752	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14462	33.281	2	1541.8413	1541.8413	K	E	788	802
PSM	GSFGELALMYNTPR	1753	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	9-UNIMOD:35	ms_run[2]:scan=17971	39.795	2	1570.745	1570.7450	R	A	204	218
PSM	GTQEQASEQQAR	1754	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2327	9.0441	2	1331.6066	1331.6066	R	A	989	1001
PSM	GVITHDVSSAINRPQIGVVR	1755	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12785	29.966	2	2117.1705	2117.1705	K	E	1401	1421
PSM	GVQVETISPGDGR	1756	sp|P62942|FKB1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9485	23.408	2	1313.6575	1313.6575	M	T	2	15
PSM	GYAYTFITEDQAR	1757	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16518	37.166	2	1533.71	1533.7100	K	Y	717	730
PSM	HENETHTLEK	1758	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2068	8.6131	3	1236.5735	1236.5735	R	Q	658	668
PSM	HGEPEEDIVGLQAFQER	1759	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16920	37.875	3	1952.9228	1952.9228	K	L	952	969
PSM	HGNALWLNER	1760	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10809	26.21	2	1208.6051	1208.6051	K	E	279	289
PSM	HLTESTNQK	1761	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1996	8.4996	2	1056.52	1056.5200	K	D	481	490
PSM	HNTTSQNVSK	1762	sp|Q96EV2|RBM33_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1811	8.2159	2	1114.5367	1114.5367	R	R	683	693
PSM	HQIEGNVSK	1763	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2243	8.9005	2	1010.5145	1010.5145	K	Q	1766	1775
PSM	HREEVAALQSHIEK	1764	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6355	17.174	3	1645.8536	1645.8536	R	N	695	709
PSM	HSEVETDSK	1765	sp|Q9NX58|LYAR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=1912	8.3665	2	1030.4567	1030.4567	R	K	275	284
PSM	HSQCSEAIITVLCGTEGAQDGLSKPK	1766	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=16605	37.32	3	2785.3375	2785.3375	K	N	1136	1162
PSM	HVLVTLGEK	1767	sp|P60660|MYL6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8135	20.964	2	994.58113	994.5811	R	M	111	120
PSM	IAEEFEVELER	1768	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17121	38.236	2	1362.6667	1362.6667	K	G	1044	1055
PSM	IAGQVAAANKK	1769	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=2372	9.121	2	1069.6244	1069.6244	R	H	134	145
PSM	IAQLEEQLDNETKER	1770	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12018	28.466	3	1814.901	1814.9010	K	Q	1816	1831
PSM	IDEPLEGSEDR	1771	sp|P61978-3|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8698	22.03	2	1258.5677	1258.5677	K	I	399	410
PSM	IEVEKPFAIAK	1772	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11986	28.407	2	1243.7176	1243.7176	K	E	205	216
PSM	IGADEEIDDFKGR	1773	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11442	27.362	3	1463.6892	1463.6892	R	S	191	204
PSM	IGSENPSDVFR	1774	sp|Q92995-2|UBP13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12261	28.982	2	1219.5833	1219.5833	R	F	399	410
PSM	IIGLDQVAGMSETALPGAFK	1775	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=24663	52.786	3	2017.0554	2017.0554	R	T	618	638
PSM	IINEVSKPLAHHIPVEK	1776	sp|P55145|MANF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9060	22.673	5	1923.0942	1923.0942	K	I	88	105
PSM	ILEDDKGAFQLYSK	1777	sp|Q9UKT4-2|FBX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14032	32.526	3	1625.8301	1625.8301	K	A	238	252
PSM	ILNVPQELYEK	1778	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16263	36.715	2	1344.7289	1344.7289	R	G	278	289
PSM	INISEGNCPER	1779	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	8-UNIMOD:4	ms_run[2]:scan=7672	19.963	2	1287.5877	1287.5877	R	I	47	58
PSM	INQQENSLTLEK	1780	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9085	22.719	2	1415.7256	1415.7256	K	L	544	556
PSM	ISVYYNEATGGK	1781	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10434	25.376	2	1300.6299	1300.6299	R	Y	47	59
PSM	ITANEDPPVISK	1782	sp|Q5VT06|CE350_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9159	22.842	2	1282.6769	1282.6769	K	R	576	588
PSM	ITGEAFVQFASQELAEK	1783	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=24879	53.208	2	1866.9363	1866.9363	K	A	151	168
PSM	KAEAGAGSATEFQFR	1784	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10464	25.439	3	1568.7583	1568.7583	K	G	139	154
PSM	KAYINTISSLK	1785	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10316	25.085	2	1236.7078	1236.7078	R	D	2977	2988
PSM	KHPDASVNFSEFSK	1786	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10426	25.357	3	1591.7631	1591.7631	K	K	30	44
PSM	KLEEEIQTLR	1787	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10171	24.762	2	1257.6929	1257.6929	K	V	331	341
PSM	KLGVQTVAVYSEADR	1788	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11562	27.581	3	1634.8628	1634.8628	K	N	70	85
PSM	KLYDIDVAK	1789	sp|P62750|RL23A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9900	24.262	2	1063.5914	1063.5914	K	V	115	124
PSM	KPEDVPPEILSNER	1790	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11206	26.936	3	1621.8312	1621.8312	R	Y	1708	1722
PSM	KVDGSVNAYAINVSQK	1791	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10174	24.766	3	1691.8842	1691.8842	K	R	119	135
PSM	KVESLLDELAFVR	1792	sp|Q16352|AINX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=23342	50.226	3	1517.8453	1517.8453	K	Q	216	229
PSM	KVNNADDFPNLFR	1793	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16405	36.965	3	1548.7685	1548.7685	R	Q	323	336
PSM	LAHLLASAQK	1794	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6515	17.455	2	1050.6186	1050.6186	R	E	768	778
PSM	LENELLENAEK	1795	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12651	29.736	2	1300.6511	1300.6511	R	L	483	494
PSM	LFSTLDPELMLNPENLPR	1796	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=26144	55.976	3	2098.0769	2098.0769	R	A	183	201
PSM	LLDFGSLSNLQVTQPTVGMNFK	1797	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	19-UNIMOD:35	ms_run[2]:scan=24145	51.757	3	2424.2359	2424.2359	K	T	108	130
PSM	LLDFGSLSNLQVTQPTVGMNFK	1798	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25422	54.372	3	2408.241	2408.2410	K	T	108	130
PSM	LLGQFTLIGIPPAPR	1799	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=24034	51.553	2	1591.945	1591.9450	K	G	499	514
PSM	LLTSFTSQAVDR	1800	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13782	31.932	2	1336.6987	1336.6987	R	T	2988	3000
PSM	LMGFASFDSTK	1801	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:35	ms_run[2]:scan=14092	32.631	2	1218.5591	1218.5591	K	G	106	117
PSM	LMQDLDNNSITVK	1802	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12934	30.293	2	1489.7446	1489.7446	K	Q	1689	1702
PSM	LNEQASEEILK	1803	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10947	26.448	2	1272.6561	1272.6561	R	V	45	56
PSM	LNEQHQLILSK	1804	sp|Q8IYB5-3|SMAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8497	21.687	3	1321.7354	1321.7354	K	L	13	24
PSM	LNQQLLSKDEQLLHLSSQLEDSYNQVQSFSK	1805	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=23660	50.839	4	3618.8166	3618.8166	K	A	2811	2842
PSM	LQGSCTSCPSSIITLK	1806	sp|Q9UMS0-2|NFU1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=14170	32.762	2	1750.8594	1750.8594	K	N	65	81
PSM	LQTLVSEQPNKDVVEQMEK	1807	sp|Q86UP2|KTN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=14031	32.524	3	2214.1202	2214.1202	K	C	717	736
PSM	LSFEDFVTMTASR	1808	sp|Q9UBV8|PEF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25176	53.777	2	1502.7075	1502.7075	R	M	270	283
PSM	LTEMETLQSQLMAEK	1809	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19956	43.696	2	1750.8481	1750.8481	R	L	868	883
PSM	LTESCCSSDAFER	1810	sp|P82094|TMF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=8763	22.14	2	1560.6185	1560.6185	K	I	313	326
PSM	LVQSPNSYFMDVK	1811	sp|P42677|RS27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:35	ms_run[2]:scan=14738	33.797	2	1542.7388	1542.7388	R	C	24	37
PSM	MATEVAADALGEEWK	1812	sp|P62753|RS6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18131	40.097	2	1619.7501	1619.7501	R	G	32	47
PSM	MFGSSVDLGNLGQ	1813	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21202	46.048	2	1323.6129	1323.6129	K	-	392	405
PSM	MQQMSEQVHTLREEK	1814	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7470	19.593	3	1872.8822	1872.8822	R	E	411	426
PSM	MTLSYAEYLAHR	1815	sp|Q9Y4X0-3|AMMR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16056	36.352	3	1453.7024	1453.7024	K	Q	265	277
PSM	NALESYAFNMK	1816	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17047	38.1	2	1286.5965	1286.5965	K	S	540	551
PSM	NAVITVPAYFNDSQR	1817	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17941	39.742	2	1693.8424	1693.8424	K	Q	188	203
PSM	NCLTNFHGMDLTR	1818	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=14576	33.482	3	1577.7079	1577.7079	K	D	95	108
PSM	NDAPTPGTSTTPGLR	1819	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8252	21.169	2	1483.7267	1483.7267	R	S	324	339
PSM	NEISGTLEDDFLK	1820	sp|Q6ZUT1-3|NKAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20064	43.882	2	1479.7093	1479.7093	K	A	48	61
PSM	NGDLDEVKDYVAK	1821	sp|P58546|MTPN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12467	29.34	3	1464.7096	1464.7096	K	G	12	25
PSM	NGIAFMGPPSQAMWALGDK	1822	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=24151	51.771	2	1989.9441	1989.9441	K	I	225	244
PSM	NKLNDLEDALQQAK	1823	sp|P04264|K2C1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16789	37.647	2	1598.8264	1598.8264	K	E	442	456
PSM	NLDAQYEMAR	1824	sp|Q7L4I2-2|RSRC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10191	24.796	2	1209.5448	1209.5448	R	S	354	364
PSM	NPDDITQEEYGEFYK	1825	sp|P08238|HS90B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16130	36.485	2	1846.7897	1846.7897	R	S	292	307
PSM	NSLESYAFNMK	1826	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16599	37.311	2	1302.5914	1302.5914	K	A	540	551
PSM	PGPTPSGTNVGSSGR	1827	sp|P60468|SC61B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5046	14.76	2	1369.6586	1369.6586	M	S	2	17
PSM	PSSLLGAAMPASTSAAALQEALENAGR	1828	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=25706	54.987	3	2583.2963	2583.2963	M	L	2	29
PSM	QAASSLQQASLK	1829	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7379	19.404	2	1230.6568	1230.6568	R	L	635	647
PSM	QADVFPDRDHFGR	1830	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9855	24.173	3	1558.7277	1558.7277	R	T	181	194
PSM	QDSLSSEVDTLK	1831	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12948	30.317	2	1320.6409	1320.6409	R	Q	463	475
PSM	QGTIFLAGPPLVK	1832	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19395	42.6	2	1339.7864	1339.7864	K	A	236	249
PSM	QITVNDLPVGR	1833	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13787	31.945	2	1210.667	1210.6670	R	S	141	152
PSM	QLEEAEEEAQR	1834	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6359	17.18	2	1330.6001	1330.6001	R	A	1878	1889
PSM	QLFDVVIVQADKPSFFTDR	1835	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=23545	50.623	3	2224.1528	2224.1528	R	R	326	345
PSM	QQLEVLEQEAWR	1836	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18396	40.598	2	1527.7682	1527.7682	R	L	477	489
PSM	QQQVEAVELEAK	1837	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10160	24.741	2	1370.7042	1370.7042	R	E	1062	1074
PSM	QSESLSELITLR	1838	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=20655	45.05	2	1374.7355	1374.7355	K	E	535	547
PSM	QTLENERGELANEVK	1839	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9891	24.247	3	1728.8642	1728.8642	K	V	1220	1235
PSM	QVLIASHLPSYELR	1840	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15812	35.92	3	1624.8937	1624.8937	R	H	1083	1097
PSM	RPGAALDPGCVLAK	1841	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	10-UNIMOD:4	ms_run[2]:scan=10957	26.471	2	1423.7606	1423.7606	K	M	804	818
PSM	SDALETLGFLNHYQMK	1842	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=21429	46.456	3	1865.8982	1865.8982	K	N	420	436
PSM	SDIGEVILVGGMTR	1843	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	12-UNIMOD:35	ms_run[2]:scan=17155	38.296	2	1461.7497	1461.7497	K	M	378	392
PSM	SDQQLDCALDLMR	1844	sp|P47756-2|CAPZB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1,7-UNIMOD:4	ms_run[2]:scan=24853	53.156	2	1605.7127	1605.7127	M	R	2	15
PSM	SEHTQTVSQLTSQNEVLR	1845	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10971	26.5	3	2056.0185	2056.0185	K	N	1423	1441
PSM	SGGASHSELIHNLR	1846	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6512	17.451	4	1476.7433	1476.7433	K	K	5	19
PSM	SGNYPSSLSNETDR	1847	sp|Q9NS86|LANC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8553	21.79	2	1525.6645	1525.6645	R	L	303	317
PSM	SHFAIGLALYYPSAR	1848	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=27879	60.65	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHKPPISFPLCANGQVFGLYK	1849	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=22499	48.648	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHKPPISFPLCANGQVFGLYK	1850	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4	ms_run[2]:scan=21517	46.614	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHTILLVQPTK	1851	sp|P84090|ERH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	1-UNIMOD:1	ms_run[2]:scan=13666	31.72	2	1277.7343	1277.7343	M	R	2	13
PSM	SLKDQLTDLSNSLEK	1852	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19447	42.712	3	1689.8785	1689.8785	K	C	2321	2336
PSM	SPPHCELMAGHLR	1853	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=8057	20.825	3	1503.7075	1503.7075	K	N	186	199
PSM	SQGDLEKAELQDR	1854	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7856	20.464	3	1487.7216	1487.7216	K	V	272	285
PSM	SQVHTELQDLQR	1855	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=9275	23.052	3	1452.7321	1452.7321	K	Q	1281	1293
PSM	SREDAGDNDDTEGAIGVR	1856	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=6985	18.557	3	1875.8195	1875.8195	R	N	375	393
PSM	SSGVPVDGFYTEEVR	1857	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=15690	35.703	2	1640.7682	1640.7682	K	Q	28	43
PSM	STGSATSLASQGER	1858	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5757	16.077	2	1350.6375	1350.6375	R	R	627	641
PSM	SVYPVASPNECNQMCLSTLMK	1859	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4,15-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=16437	37.024	3	2444.0844	2444.0844	R	C	302	323
PSM	SVYPVASPNECNQMCLSTLMK	1860	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=19915	43.623	2	2428.0895	2428.0895	R	C	302	323
PSM	TAVVVGTITDDVR	1861	sp|Q07020-2|RL18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13728	31.835	2	1344.7249	1344.7249	K	V	50	63
PSM	TIFDLSCMGFQGNGFPDR	1862	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	7-UNIMOD:4	ms_run[2]:scan=24812	53.076	2	2060.9084	2060.9084	K	L	677	695
PSM	TIGPDMFLGTCR	1863	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=16373	36.909	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	1864	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=16728	37.541	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TKEEALELINGYIQK	1865	sp|Q13526|PIN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=18953	41.631	3	1747.9356	1747.9356	R	I	81	96
PSM	TLSECAEMSSVAEISSHMR	1866	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	5-UNIMOD:4	ms_run[2]:scan=18198	40.221	3	2123.9286	2123.9286	R	E	1221	1240
PSM	TPVEPEVAIHR	1867	sp|P60866|RS20_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8665	21.976	2	1246.667	1246.6670	K	I	9	20
PSM	TTTAAAVASTGPSSR	1868	sp|P27816|MAP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5609	15.779	2	1376.6896	1376.6896	K	S	810	825
PSM	TVAATNMNETSSR	1869	sp|O60333-3|KIF1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=5120	14.89	2	1380.6303	1380.6303	R	S	204	217
PSM	VAAENALSVAEEQIR	1870	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17812	39.511	2	1598.8264	1598.8264	R	R	3175	3190
PSM	VADIGLAAWGR	1871	sp|P23526|SAHH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17645	39.221	2	1127.6087	1127.6087	K	K	9	20
PSM	VAGQDGSVVQFK	1872	sp|P61956-2|SUMO2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10195	24.802	2	1233.6354	1233.6354	K	I	22	34
PSM	VAYMNPIAMAR	1873	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=16092	36.421	2	1235.6155	1235.6155	R	S	8	19
PSM	VCEEIAIIPSKK	1874	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0	2-UNIMOD:4	ms_run[2]:scan=10966	26.49	3	1385.7588	1385.7588	R	L	34	46
PSM	VGEFSGANKEK	1875	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=3687	11.862	2	1164.5775	1164.5775	K	L	86	97
PSM	VHVGDEDFVHLR	1876	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=11823	28.134	3	1421.7052	1421.7052	K	V	57	69
PSM	VLEGNEQFINAAK	1877	sp|P35030-5|TRY3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=12374	29.18	2	1431.7358	1431.7358	K	I	73	86
PSM	VQALEEVLGDLR	1878	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=23009	49.581	2	1340.73	1340.7300	R	A	1882	1894
PSM	VQELETSLAELR	1879	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=17098	38.192	2	1386.7355	1386.7355	R	N	432	444
PSM	VQIGEYTFEKGDYGDAVVYR	1880	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=28816	62.247	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	1881	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=29981	64.525	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VTEFGGELHEDGGK	1882	sp|Q9UFW8|CGBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=8835	22.258	3	1473.6736	1473.6736	R	L	27	41
PSM	VVDNSALGNSPYHR	1883	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=7908	20.561	2	1527.743	1527.7430	R	A	40	54
PSM	WESPAQNTAHLDQFER	1884	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=13393	31.13	3	1927.8813	1927.8813	K	I	31	47
PSM	YISPDQLADLYK	1885	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=19851	43.512	2	1424.7187	1424.7187	R	S	270	282
PSM	YSQVLANGLDNK	1886	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	25.0		ms_run[2]:scan=10730	26.053	2	1320.6674	1320.6674	K	L	95	107
PSM	TTAAVEETIGR	1887	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=8653	21.957187	2	1146.586300	1146.588067	K	H	1741	1752
PSM	MDEPSPLAQPLELNQHSR	1888	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=16490	37.118897	3	2119.000263	2119.000418	-	F	1	19
PSM	QLTEEDGVHSVIEENIK	1889	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=18290	40.39846	3	1921.9259	1921.9264	K	C	2277	2294
PSM	LSLPMQETQLCSTDSPLPLEKEEQVR	1890	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	11-UNIMOD:4	ms_run[1]:scan=19759	43.303975	3	3029.491602	3027.489288	R	L	126	152
PSM	SELEMAQEDLSMTQK	1891	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=16210	36.622466	2	1738.775589	1738.775352	K	D	1330	1345
PSM	YDEALENNKELTAEVFR	1892	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=16548	37.21722	3	2039.980439	2039.980000	R	L	1273	1290
PSM	ADENDEVKITVI	1893	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15852	35.988712	2	1344.677612	1344.677276	R	-	991	1003
PSM	ITQELSDLQQER	1894	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=11473	27.422657	2	1458.730850	1458.731437	K	E	404	416
PSM	ITGLYPTLNISDEFSSNVANYQK	1895	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=30242	65.321663	3	2574.266644	2573.264949	R	V	1172	1195
PSM	IVYTACSHAAVDALCEK	1896	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=25484	54.495204	3	1908.907337	1906.891719	R	A	1227	1244
PSM	HYVYIGDPAQLPAPR	1897	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15213	34.820182	3	1697.891831	1695.873290	K	T	1318	1333
PSM	HYVYIGDPAQLPAPR	1898	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15270	34.947415	3	1697.891831	1695.873290	K	T	1318	1333
PSM	TIGPDMFLGTCR	1899	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=16478	37.09757	2	1382.631129	1382.632257	K	R	1354	1366
PSM	TIGPDMFLGTCR	1900	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=19184	42.086292	2	1382.630026	1382.632257	K	R	1354	1366
PSM	TIGPDMFLGTCR	1901	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=19451	42.720756	2	1382.630026	1382.632257	K	R	1354	1366
PSM	VGILCIMSDRDLYDK	1902	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=20242	44.20271	2	1812.871814	1812.875007	K	L	1493	1508
PSM	GLPSPYNMSSAPGSR	1903	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=13011	30.422624	2	1520.710494	1519.708927	K	S	2812	2827
PSM	LQDEIQNMKEEMAR	1904	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:35	ms_run[1]:scan=12991	30.390909	2	1750.805833	1749.802570	R	H	365	379
PSM	QAVTNPNNTFYATK	1905	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:28	ms_run[1]:scan=13559	31.457683	2	1551.7392	1550.7362	R	R	108	122
PSM	QELEAAESTHDAQR	1906	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5022	14.712641	3	1583.719142	1583.717578	R	K	1105	1119
PSM	YCALAPNMMVTNNTFTLK	1907	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4,9-UNIMOD:35	ms_run[1]:scan=19404	42.620942	2	2104.985203	2103.979154	K	G	799	817
PSM	DAGTIAGLNVLR	1908	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=17952	39.758362	2	1198.667044	1198.666986	K	I	160	172
PSM	DAGTIAGLNVLR	1909	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=18118	40.075243	2	1198.667044	1198.666986	K	I	160	172
PSM	SQQAAQSADVSLNPCNTPQK	1910	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	15-UNIMOD:4	ms_run[1]:scan=9448	23.345894	3	2143.997412	2142.996395	R	I	128	148
PSM	YSSAGTVEFLVDSK	1911	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=17731	39.367311	2	1501.730198	1501.730040	K	K	329	343
PSM	VGEVIVTKDDAMLLK	1912	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	12-UNIMOD:35	ms_run[1]:scan=13190	30.747938	3	1647.899374	1645.896060	K	G	345	360
PSM	IHFPLATYAPVISAEK	1913	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=19748	43.280519	3	1755.958459	1755.955957	R	A	265	281
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	1914	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	16-UNIMOD:4	ms_run[1]:scan=22779	49.143011	3	2994.391441	2994.392551	K	F	396	424
PSM	GGKPEPPAMPQPVPTA	1915	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12004	28.441173	2	1573.802331	1572.797014	K	-	228	244
PSM	KNLDSTTVAIHDEEIYCK	1916	sp|Q16527|CSRP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	17-UNIMOD:4	ms_run[1]:scan=11071	26.700396	3	2136.025003	2135.020485	R	S	42	60
PSM	CSTHSEDSTGTATSLDTAASLTSTK	1917	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4	ms_run[1]:scan=11303	27.107199	3	2529.122824	2528.118421	R	G	87	112
PSM	GPADSLSTAAGAAELSAEGAGK	1918	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=16690	37.470697	3	1930.932527	1929.927964	R	S	268	290
PSM	VCEEIAIIPSKK	1919	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	2-UNIMOD:4	ms_run[1]:scan=10978	26.523087	2	1386.770300	1385.758838	R	L	34	46
PSM	SHQLIHAASLK	1920	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=5576	15.723204	3	1204.672499	1203.672406	R	L	210	221
PSM	HLCQQLQAEQAAAEKR	1921	sp|Q14980|NUMA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	3-UNIMOD:4	ms_run[1]:scan=8084	20.871406	3	1880.934766	1879.932279	K	H	1365	1381
PSM	SAVVDSVCLESVGFCR	1922	sp|Q9BYB4|GNB1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=18778	41.305703	2	1784.815647	1783.823306	R	S	102	118
PSM	GSFSEQGINEFLR	1923	sp|Q15084|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=19689	43.152711	2	1483.710615	1482.710307	K	E	374	387
PSM	CCLTYCFNKPEDK	1924	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=15680	35.685626	2	1716.6933	1716.6941	K	-	144	157
PSM	VPADPVLQDSGVDLDSFSVSPASTLK	1925	sp|Q76N32|CEP68_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=23247	50.029321	3	2644.322465	2643.327943	R	S	323	349
PSM	CTGGEVGATSALAPK	1926	sp|P30050|RL12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0	1-UNIMOD:4	ms_run[1]:scan=9005	22.578735	2	1417.686565	1417.687129	R	I	17	32
PSM	SNYNFEKPFLWLAR	1927	sp|P62826|RAN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=22850	49.286766	3	1783.904434	1783.904590	K	K	153	167
PSM	GSLGGGFSSGGFSGGSFSR	1928	sp|P13645|K1C10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=16197	36.599889	2	1706.769664	1706.764862	K	G	41	60
PSM	VVNTDHGSPEQLQIPVTDSGR	1929	sp|Q6IQ49|SDE2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12309	29.061983	3	2249.111646	2248.108388	R	H	271	292
PSM	AAPSAGSWSTFQHK	1930	sp|P42575|CASP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	25.0	1-UNIMOD:1	ms_run[1]:scan=14070	32.589042	2	1517.7152	1515.7102	M	E	2	16
PSM	VWLDPNETNEIANANSR	1931	sp|P84098|RL19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=16157	36.530499	2	1942.924460	1941.918068	K	Q	22	39
PSM	HNIQFSSFDIFSDEEVR	1932	sp|O76003|GLRX3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=22034	47.613496	3	2070.955404	2068.949034	K	Q	172	189
PSM	TGNLGNVVHIER	1933	sp|Q6P5R6|RL22L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10137	24.702941	3	1307.694626	1307.694598	K	F	48	60
PSM	HIQSNLDFSPVNSASSEENVK	1934	sp|O14757|CHK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=12712	29.840628	3	2302.089255	2301.087319	K	Y	293	314
PSM	IKPENSSSASTGGK	1935	sp|Q69YQ0|CYTSA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=2108	8.6800373	3	1362.673409	1361.678673	K	L	26	40
PSM	LNEQASEEILK	1936	sp|Q01105|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=10984	26.53613	2	1274.663548	1272.656146	R	V	58	69
PSM	VGTFFSEVKPAGPTVEQQGEMAR	1937	sp|P54886|P5CS_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=15577	35.500932	3	2467.215575	2464.205660	K	S	349	372
PSM	STNGDTFLGGEDFDQALLR	1938	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	25.0		ms_run[1]:scan=23655	50.831324	2	2055.939529	2054.954513	K	H	266	285
PSM	AAHSEGNTTAGLDMR	1939	sp|P78371|TCPB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6328	17.124	3	1529.6893	1529.6893	R	E	467	482
PSM	AAQAGSLEISK	1940	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7320	19.255	2	1073.5717	1073.5717	R	A	2317	2328
PSM	ADFAQACQDAGVR	1941	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=9861	24.184	2	1407.6201	1407.6201	R	F	125	138
PSM	AELQAQLAALSTK	1942	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16314	36.804	3	1342.7456	1342.7456	K	L	436	449
PSM	AGELGLGGAGTR	1943	sp|Q9Y4X0-3|AMMR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8837	22.264	2	1057.5516	1057.5516	R	L	41	53
PSM	AGELTEDEVER	1944	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8049	20.81	2	1246.5677	1246.5677	R	V	56	67
PSM	ALAETGIAVPSYYNPAAVNPMK	1945	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20273	44.266	3	2276.1511	2276.1511	K	F	258	280
PSM	ALTVPELTQQMFDAK	1946	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23302	50.152	2	1690.86	1690.8600	R	N	283	298
PSM	ALTVPELTQQVFDAK	1947	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22459	48.571	3	1658.8879	1658.8879	R	N	283	298
PSM	AMTDLQNMLEAK	1948	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18809	41.368	2	1363.6476	1363.6476	R	N	483	495
PSM	APDFVFYAPR	1949	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18698	41.155	2	1181.5869	1181.5869	K	L	264	274
PSM	APILIATDVASR	1950	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14264	32.93	2	1225.703	1225.7030	K	G	392	404
PSM	AVLVDLEPGTMDSVR	1951	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18273	40.366	2	1600.8131	1600.8131	R	S	63	78
PSM	AVNYVGAGTVEFIMDSK	1952	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22554	48.745	3	1799.8764	1799.8764	K	H	312	329
PSM	AYENAVGILSR	1953	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13872	32.16	2	1191.6248	1191.6248	K	R	998	1009
PSM	CAGNEDIITLR	1954	sp|P12004|PCNA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=13138	30.649	2	1260.6132	1260.6132	K	A	81	92
PSM	CEFQDAYVLLSEKK	1955	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=17957	39.771	3	1728.8393	1728.8393	K	I	237	251
PSM	CESALQSLEGR	1956	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=12523	29.487	2	1248.5768	1248.5769	R	Y	829	840
PSM	CGQEAAELKEK	1957	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=3849	12.204	3	1261.5973	1261.5973	R	L	321	332
PSM	CVIFEIPGAPDDEAVR	1958	sp|Q96I25|SPF45_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:4	ms_run[2]:scan=21037	45.753	2	1786.856	1786.8560	K	I	339	355
PSM	DAGQISGLNVLR	1959	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16136	36.496	2	1241.6728	1241.6728	K	V	207	219
PSM	DASVQTVATEGDLLR	1960	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16116	36.462	2	1573.7948	1573.7948	K	F	870	885
PSM	DCDHADEQK	1961	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=1833	8.2478	2	1116.4142	1116.4142	R	C	103	112
PSM	DFLAGGIAAAISK	1962	sp|P12236|ADT3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21781	47.087	2	1232.6765	1232.6765	K	T	11	24
PSM	DKEMDSDQQR	1963	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2185	8.7998	2	1250.5197	1250.5197	R	S	1036	1046
PSM	DLEAHIDSANK	1964	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7237	19.071	2	1211.5782	1211.5782	K	N	1621	1632
PSM	DLNYCFSGMSDHR	1965	sp|P31943|HNRH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4	ms_run[2]:scan=13780	31.929	3	1600.6399	1600.6399	R	Y	263	276
PSM	DREPGTSNSLLVPDSLR	1966	sp|Q04724|TLE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14570	33.471	3	1854.9436	1854.9436	R	G	193	210
PSM	DSQQAPLDGEVELLQQK	1967	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18365	40.538	2	1896.9429	1896.9429	R	L	1519	1536
PSM	DVDTQEFNLEK	1968	sp|Q8NDD1|CA131_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13462	31.251	2	1336.6147	1336.6147	R	A	160	171
PSM	EAESCDCLQGFQLTHSLGGGTGSGMGTLLLSK	1969	sp|Q3ZCM7|TBB8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=21959	47.424	4	3310.5268	3310.5268	K	I	123	155
PSM	EAFNMIDQNR	1970	sp|P19105|ML12A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12270	28.997	2	1236.5557	1236.5557	K	D	35	45
PSM	EALNLAQMQEQTLQLEQQSK	1971	sp|Q5T9A4|ATD3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20599	44.954	3	2329.1584	2329.1584	K	L	73	93
PSM	EDCALQLMLAR	1972	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=19534	42.872	2	1318.6373	1318.6373	K	S	858	869
PSM	EETGLLMPLKAPK	1973	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14221	32.853	3	1425.7901	1425.7901	R	E	725	738
PSM	EFPDVLECTVSHAVEK	1974	sp|P48507|GSH0_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:4	ms_run[2]:scan=19581	42.951	3	1858.8771	1858.8771	R	I	65	81
PSM	EGLQSSAWTEEK	1975	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11080	26.716	2	1363.6256	1363.6256	R	V	743	755
PSM	EHEHEIAWYTER	1976	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10115	24.669	3	1598.7114	1598.7114	R	S	233	245
PSM	ELAPYDENWFYTR	1977	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21393	46.391	2	1702.7627	1702.7627	K	A	44	57
PSM	ELEEIVQPIISK	1978	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17640	39.21	2	1396.7813	1396.7813	K	L	622	634
PSM	ELKEQLAELQSGFVK	1979	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18372	40.551	2	1717.9251	1717.9251	R	L	544	559
PSM	EREEFLIPIYHQVAVQFADLHDTPGR	1980	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23800	51.1	4	3079.5516	3079.5516	K	M	2170	2196
PSM	ESLCQAALGLILK	1981	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4	ms_run[2]:scan=26486	56.868	2	1414.7854	1414.7854	K	E	506	519
PSM	ESSGLVLLSSCPQTASR	1982	sp|Q6P087|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=15289	34.992	2	1790.8833	1790.8833	K	L	137	154
PSM	ETNLDSLPLVDTHSK	1983	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14477	33.309	3	1667.8366	1667.8366	R	R	425	440
PSM	ETNLDSLPLVDTHSKR	1984	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12316	29.075	3	1823.9377	1823.9377	R	T	425	441
PSM	EVEVVPSNMWGGQGLLGASVR	1985	sp|Q9BQQ3-2|GORS1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23233	50	3	2184.0997	2184.0997	R	F	81	102
PSM	FLSNGHVTIPGQQDKDMFQETMEAMR	1986	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20262	44.245	4	3009.3783	3009.3783	R	I	302	328
PSM	FRSETITEEELVGLMNK	1987	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20549	44.865	3	1994.9983	1994.9983	K	F	158	175
PSM	FSSELEQIELHNSIR	1988	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15977	36.212	2	1800.9006	1800.9006	R	D	85	100
PSM	FTDEEVDELYR	1989	sp|P19105|ML12A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15309	35.029	2	1414.6252	1414.6252	R	E	133	144
PSM	GADINAPDKHHITPLLSAVYEGHVSCVK	1990	sp|P58546|MTPN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	26-UNIMOD:4	ms_run[2]:scan=14745	33.812	5	3027.5236	3027.5236	K	L	58	86
PSM	GGGGPGGGGPGGGSAGGPSQPPGGGGPGIRK	1991	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6203	16.904	3	2397.1534	2397.1534	R	D	41	72
PSM	GGSGLSHAGWPGSTPSVSDLER	1992	sp|A7MCY6|TBKB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15314	35.039	3	2153.0138	2153.0138	R	R	205	227
PSM	GKVEIDQQQLTQQQLNGN	1993	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11631	27.704	3	2040.0236	2040.0236	R	-	314	332
PSM	GLAPDLPEDLYHLIK	1994	sp|P62277|RS13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24118	51.709	3	1692.9087	1692.9087	K	K	79	94
PSM	GLCAIAQAESLR	1995	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=14976	34.276	2	1287.6605	1287.6605	R	Y	95	107
PSM	GLGLSPDLVVCR	1996	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4	ms_run[2]:scan=17753	39.407	2	1284.686	1284.6860	R	C	206	218
PSM	GLPWSCSADEVQR	1997	sp|P31943|HNRH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=14371	33.12	2	1503.6776	1503.6776	R	F	17	30
PSM	GMFTISDHQPEQR	1998	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11067	26.695	2	1544.7042	1544.7042	R	G	170	183
PSM	GPLEPSEPAVVAAAR	1999	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12921	30.269	2	1462.778	1462.7780	R	V	230	245
PSM	GSQQEHQLR	2000	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2128	8.7132	2	1081.5265	1081.5265	R	R	2553	2562
PSM	GVDEVTIVNILTNR	2001	sp|P07355-2|ANXA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24559	52.579	2	1541.8413	1541.8413	K	S	68	82
PSM	GVEGLIDIENPNR	2002	sp|Q13442|HAP28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16922	37.881	2	1424.726	1424.7260	K	V	76	89
PSM	GVITHDVSSAINRPQIGVVR	2003	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14507	33.362	4	2117.1705	2117.1705	K	E	1401	1421
PSM	GVNSYPSLFIFR	2004	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23975	51.429	2	1398.7296	1398.7296	K	S	197	209
PSM	HFIDVGAGVIDEDYR	2005	sp|P33316-2|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16598	37.309	3	1704.8107	1704.8107	K	G	92	107
PSM	HGRPGIGATHSSR	2006	sp|P62841|RS15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=1954	8.4372	4	1331.6807	1331.6807	K	F	128	141
PSM	HGVQELEIELQSQLSK	2007	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19871	43.547	3	1836.9581	1836.9581	R	K	375	391
PSM	HPGSFDVVHVK	2008	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7888	20.525	3	1220.6302	1220.6302	R	D	201	212
PSM	HQNQNTIQELLQNCSDCLMR	2009	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=21358	46.325	3	2501.121	2501.1210	R	A	65	85
PSM	HTAYISELK	2010	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7867	20.486	2	1060.5553	1060.5553	R	A	65	74
PSM	ICCDLDVLASK	2011	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=14718	33.757	2	1292.6105	1292.6105	R	K	515	526
PSM	IESIQLMMDSETGR	2012	sp|Q14498-2|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:35	ms_run[2]:scan=14369	33.117	2	1624.7437	1624.7437	R	S	276	290
PSM	IFSGSSHQDLSQK	2013	sp|P60891|PRPS1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5764	16.09	3	1432.6947	1432.6947	K	I	6	19
PSM	IFYPEIEEVQALDDTER	2014	sp|P33316-2|DUT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22478	48.609	2	2065.9844	2065.9844	R	G	137	154
PSM	IGDQEFDHLPALLEFYK	2015	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25043	53.518	3	2034.0098	2034.0098	K	I	73	90
PSM	IGGGIDVPVPR	2016	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13645	31.677	2	1078.6135	1078.6135	R	H	321	332
PSM	IIETLTQQLQAK	2017	sp|Q9UHV9|PFD2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14458	33.273	2	1384.7926	1384.7926	K	G	100	112
PSM	IITLAGPTNAIFK	2018	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20120	43.98	2	1357.7969	1357.7969	R	A	58	71
PSM	ILEEDLEQIK	2019	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14365	33.111	2	1228.6551	1228.6551	K	L	1680	1690
PSM	ILTPLVSLDTPGK	2020	sp|Q9HC38-2|GLOD4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18921	41.573	2	1352.7915	1352.7915	K	A	225	238
PSM	IQEQGVEYQAAMECLQK	2021	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	14-UNIMOD:4	ms_run[2]:scan=16102	36.438	2	2023.9343	2023.9343	R	A	3060	3077
PSM	IQFKPDDGISPER	2022	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10731	26.055	3	1500.7573	1500.7573	R	A	287	300
PSM	IQVLQQQADDAEER	2023	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10205	24.822	2	1641.7958	1641.7958	K	A	14	28
PSM	ISSIQSIVPALEIANAHR	2024	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21089	45.853	3	1918.0636	1918.0636	K	K	251	269
PSM	ISVATGALEAAQGSK	2025	sp|P51610-2|HCFC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12597	29.638	2	1401.7464	1401.7464	R	S	1080	1095
PSM	ITAEEMYDIFGK	2026	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22724	49.044	2	1415.6643	1415.6643	K	Y	30	42
PSM	ITELQAQNSEHQAR	2027	sp|Q8WXW3|PIBF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5190	15.004	3	1623.7965	1623.7965	R	L	513	527
PSM	IVGLDQVTGMTETAFGSAYK	2028	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24039	51.563	3	2087.0245	2087.0245	R	T	625	645
PSM	KDSETGENIR	2029	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2517	9.379	2	1147.5469	1147.5469	R	Q	625	635
PSM	KTGQAPGYSYTAANK	2030	sp|P99999|CYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5564	15.704	3	1555.7631	1555.7631	R	N	40	55
PSM	KVVGCSCVVVK	2031	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5550	15.679	2	1233.6573	1233.6573	R	D	102	113
PSM	KYEEIDNAPEER	2032	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6408	17.27	3	1491.6842	1491.6842	K	A	91	103
PSM	LAAAASPHSGGR	2033	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2410	9.1878	2	1093.5629	1093.5629	R	A	3269	3281
PSM	LALEGLTEDKEK	2034	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11267	27.043	3	1344.7137	1344.7137	K	L	1579	1591
PSM	LDEFNELAIQK	2035	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15976	36.21	2	1318.6769	1318.6769	K	E	1540	1551
PSM	LEGQLEALSLEASQALK	2036	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23658	50.836	2	1798.9676	1798.9676	R	E	417	434
PSM	LGDLYEEEMR	2037	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13206	30.781	2	1253.5598	1253.5598	R	E	146	156
PSM	LGSDLTSAQK	2038	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5836	16.213	2	1018.5295	1018.5295	R	E	981	991
PSM	LGTITPDGADVYSFQEEEPVLDPHLAK	2039	sp|Q92995-2|UBP13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21018	45.715	3	2940.4393	2940.4393	K	H	195	222
PSM	LGTPELSTAER	2040	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9716	23.849	2	1172.6037	1172.6037	R	K	2151	2162
PSM	LIAPVAEEEATVPNNK	2041	sp|P07195|LDHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12715	29.845	2	1693.8887	1693.8887	K	I	8	24
PSM	LKEQQTEMEAIQAQR	2042	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	8-UNIMOD:35	ms_run[2]:scan=6430	17.309	3	1817.8942	1817.8942	R	E	891	906
PSM	LLDLVQQSCNYK	2043	sp|P55769|NH2L1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=14803	33.925	2	1479.7392	1479.7392	K	Q	22	34
PSM	LLEAQACTGGIIHPTTGQK	2044	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=11334	27.167	3	1994.0255	1994.0255	R	L	2650	2669
PSM	LLGLGSASGSVGR	2045	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13227	30.82	2	1172.6513	1172.6513	R	V	118	131
PSM	LLSRPQDVLEGVVLSPSLEAR	2046	sp|Q5T9A4|ATD3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22069	47.681	3	2277.2692	2277.2692	R	V	307	328
PSM	LLVLQEADSIR	2047	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17453	38.895	2	1255.7136	1255.7136	R	Q	1068	1079
PSM	LMELHGEGSSSGK	2048	sp|P61247|RS3A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5974	16.477	3	1330.6187	1330.6187	K	A	228	241
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	2049	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=27480	59.732	4	3382.7384	3382.7384	K	I	1142	1172
PSM	LPSSPVYEDAASFK	2050	sp|Q14247-3|SRC8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15429	35.235	2	1509.7351	1509.7351	R	A	378	392
PSM	LQAQVECSHSSQQR	2051	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	7-UNIMOD:4	ms_run[2]:scan=3904	12.313	3	1656.7638	1656.7638	K	Q	449	463
PSM	LQGEVVAFDYQSK	2052	sp|Q3MHD2|LSM12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14551	33.441	2	1482.7355	1482.7355	R	M	25	38
PSM	LQPTWNDLGDKYNSMEDAK	2053	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15501	35.361	3	2224.0106	2224.0106	R	V	95	114
PSM	LSSTQQSLAEK	2054	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5244	15.096	2	1190.6143	1190.6143	K	E	895	906
PSM	LTNENMEITSALQSEQHVK	2055	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35	ms_run[2]:scan=14231	32.871	3	2187.0478	2187.0478	K	R	559	578
PSM	LTTPTYGDLNHLVSATMSGVTTCLR	2056	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	17-UNIMOD:35,23-UNIMOD:4	ms_run[2]:scan=22142	47.818	3	2723.3259	2723.3259	K	F	217	242
PSM	LVNHFVEEFKR	2057	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11075	26.709	3	1416.7514	1416.7514	R	K	237	248
PSM	MADALDNYVIR	2058	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16466	37.077	2	1279.6231	1279.6231	R	G	466	477
PSM	MAESQEAELER	2059	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7574	19.788	2	1291.5714	1291.5714	R	L	614	625
PSM	MAVTFIGNSTAIQELFKR	2060	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24216	51.897	3	2025.0717	2025.0717	K	I	363	381
PSM	MDGIVPDIAVGTK	2061	sp|P26599|PTBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:1	ms_run[2]:scan=23555	50.645	2	1356.6959	1356.6959	-	R	1	14
PSM	MEELHNQEVQK	2062	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4872	14.408	3	1383.6453	1383.6453	R	R	237	248
PSM	MIKPFFHSLSEK	2063	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	1-UNIMOD:35	ms_run[2]:scan=10992	26.554	3	1478.7592	1478.7592	K	Y	37	49
PSM	MMNGGHYTYSENR	2064	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:35	ms_run[2]:scan=5157	14.951	3	1574.6242	1574.6242	K	V	133	146
PSM	NADMSEEMQQDSVECATQALEK	2065	sp|P63167|DYL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4	ms_run[2]:scan=18602	40.982	2	2513.0356	2513.0356	K	Y	10	32
PSM	NDGSVGGVQYFSCSPR	2066	sp|Q8N3C7-3|CLIP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4	ms_run[2]:scan=13431	31.194	2	1728.7526	1728.7526	K	Y	526	542
PSM	NGIAFMGPPSQAMWALGDK	2067	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=24167	51.8	2	1989.9441	1989.9441	K	I	225	244
PSM	NHACEMCGK	2068	sp|P56270-2|MAZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2122	8.7017	2	1105.4103	1105.4103	K	A	278	287
PSM	NHPGLLLMDTTFR	2069	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18036	39.917	2	1513.7711	1513.7711	R	D	559	572
PSM	NKLDHYAIIK	2070	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8264	21.191	3	1213.6819	1213.6819	R	F	69	79
PSM	NLEPEWAAAASEVK	2071	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17681	39.283	2	1513.7413	1513.7413	K	E	192	206
PSM	NMITGTAPLDGCILVVAANDGPMPQTR	2072	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	12-UNIMOD:4	ms_run[2]:scan=23851	51.192	3	2811.3718	2811.3718	K	E	136	163
PSM	NMSVIAHVDHGK	2073	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6269	17.022	3	1306.6452	1306.6452	R	S	21	33
PSM	NPPNQSSNERPPSLLVIETK	2074	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13779	31.927	3	2219.1546	2219.1546	K	K	169	189
PSM	NQMAEPPPPEPPAGPSEVEQQLQAEAEHLRK	2075	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20200	44.124	4	3403.6467	3403.6467	R	E	444	475
PSM	NQVALNPQNTVFDAK	2076	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14114	32.667	2	1657.8424	1657.8424	K	R	57	72
PSM	NQVAMNPTNTVFDAK	2077	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:35	ms_run[2]:scan=13677	31.742	2	1664.7828	1664.7828	K	R	57	72
PSM	NTAMDAQEALAR	2078	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=10108	24.654	2	1289.6034	1289.6034	R	R	182	194
PSM	NTHLEAQLQK	2079	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5434	15.437	3	1180.62	1180.6200	K	A	661	671
PSM	NTQSNEDLKQEK	2080	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=2305	9.0085	3	1432.6794	1432.6794	K	S	303	315
PSM	NVGQFSGFPFEK	2081	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19372	42.545	2	1355.651	1355.6510	K	G	126	138
PSM	QADVFPDRDHFGR	2082	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9846	24.154	4	1558.7277	1558.7277	R	T	181	194
PSM	QGNVLPLWGNEK	2083	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17459	38.906	2	1353.7041	1353.7041	K	T	43	55
PSM	QGTIFLAGPPLVK	2084	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19661	43.101	2	1339.7864	1339.7864	K	A	236	249
PSM	QGVDADINGLR	2085	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11379	27.251	2	1156.5836	1156.5836	R	Q	251	262
PSM	QIGVEHVVVYVNK	2086	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12144	28.763	3	1482.8195	1482.8195	R	A	170	183
PSM	QQLAGCQEAVNLLQQQHDQWEEEGK	2087	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:4	ms_run[2]:scan=18931	41.59	4	2965.3624	2965.3624	R	A	407	432
PSM	QVGYENAGTVEFLVDR	2088	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19498	42.807	3	1795.8741	1795.8741	K	H	301	317
PSM	QVLMQEEEIKR	2089	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8917	22.399	3	1401.7286	1401.7286	R	L	1556	1567
PSM	RAEDGSVIDYELIDQDAR	2090	sp|P07355-2|ANXA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16214	36.628	3	2063.976	2063.9760	R	D	197	215
PSM	RCPAEIVDTVSALVYDNK	2091	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=27694	60.321	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2092	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4	ms_run[2]:scan=25452	54.437	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RPASVSSSAAVEHEQR	2093	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=3758	12.008	3	1709.8445	1709.8445	K	E	237	253
PSM	RPGAALDPGCVLAK	2094	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	10-UNIMOD:4	ms_run[2]:scan=10946	26.447	3	1423.7606	1423.7606	K	M	804	818
PSM	RQAVTNPNNTFYATK	2095	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7858	20.467	3	1723.8642	1723.8642	K	R	107	122
PSM	RQVDQLTNDK	2096	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4011	12.584	2	1215.6208	1215.6208	R	A	159	169
PSM	RSIQFVDWCPTGFK	2097	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	9-UNIMOD:4	ms_run[2]:scan=19078	41.859	3	1739.8454	1739.8454	K	V	339	353
PSM	RVQALEEVLGDLR	2098	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20278	44.276	3	1496.8311	1496.8311	R	A	1881	1894
PSM	SALVKPVTINVGR	2099	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11481	27.438	3	1352.814	1352.8140	K	A	388	401
PSM	SEEMTLQINELQK	2100	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15666	35.66	2	1561.7658	1561.7658	K	E	714	727
PSM	SGSLSLTQFADMISLK	2101	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=26357	56.507	2	1696.8706	1696.8706	R	N	2549	2565
PSM	SHFAIGLALYYPSAR	2102	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25128	53.686	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	2103	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25972	55.601	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	2104	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20742	45.208	2	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	2105	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23051	49.659	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHGLFGLNENQLR	2106	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14363	33.109	3	1483.7532	1483.7532	K	I	142	155
PSM	SIYGEKFEDENFILK	2107	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17938	39.734	2	1830.904	1830.9040	K	H	77	92
PSM	SKPGAAMVEMADGYAVDR	2108	sp|P14866-2|HNRPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14768	33.857	3	1866.8604	1866.8604	K	A	284	302
PSM	SLLSEIQALHAQMNGR	2109	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22686	48.977	3	1766.9098	1766.9098	R	K	3081	3097
PSM	SLTASQDPEHSLTEYIHHLEVIQQR	2110	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21487	46.558	4	2930.4522	2930.4522	R	L	3292	3317
PSM	SQNVMAAASIANIVK	2111	sp|P17987|TCPA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=18709	41.177	2	1515.8079	1515.8079	R	S	19	34
PSM	SSSAEESGQDVLENTFSQK	2112	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16172	36.558	2	2041.9076	2041.9076	R	H	542	561
PSM	SSVHQPGSHYCQGCAYK	2113	sp|Q9P021|CRIPT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4606	13.912	4	1964.8258	1964.8258	K	K	63	80
PSM	STVAESVSQQILR	2114	sp|Q86WX3|AROS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16137	36.498	2	1416.7573	1416.7573	R	Q	84	97
PSM	SVHSSVPLLNSKDPIDR	2115	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11569	27.594	4	1862.985	1862.9850	K	I	1905	1922
PSM	SWHQQELAK	2116	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=5404	15.372	2	1125.5567	1125.5567	R	A	867	876
PSM	SYCAEIAHNVSSK	2117	sp|P62910|RL32_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	3-UNIMOD:4	ms_run[2]:scan=8675	21.994	3	1464.6667	1464.6667	K	N	94	107
PSM	TAMSTPHVAEPAENEQDEQDENGAEASADLR	2118	sp|P26038|MOES_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11539	27.537	3	3311.412	3311.4120	K	A	465	496
PSM	TIQGHLQSENFK	2119	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8364	21.36	3	1400.7048	1400.7048	R	Q	636	648
PSM	TLHSDDEGTVLDDSR	2120	sp|O00170|AIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8251	21.168	3	1658.7384	1658.7384	R	A	40	55
PSM	TLQTEQEANTEGQK	2121	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=4709	14.115	2	1575.7376	1575.7376	K	K	3382	3396
PSM	TLSECAEMSSVAEISSHMR	2122	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	5-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=15312	35.034	3	2139.9235	2139.9235	R	E	1221	1240
PSM	TLTAVHDAILEDLVFPSEIVGK	2123	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=26149	55.986	3	2366.2733	2366.2733	R	R	121	143
PSM	TPAQYDASELK	2124	sp|P07355-2|ANXA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=8804	22.207	2	1221.5877	1221.5877	K	A	123	134
PSM	TPFLGDMAHIR	2125	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15037	34.457	3	1256.6336	1256.6336	K	-	547	558
PSM	TPGPGAQSALR	2126	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6060	16.661	2	1053.5567	1053.5567	K	A	107	118
PSM	TQLLFSHEEELSK	2127	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=12782	29.961	3	1559.7831	1559.7831	R	L	627	640
PSM	TTGFGMIYDSLDYAK	2128	sp|P62847-2|RS24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	6-UNIMOD:35	ms_run[2]:scan=20164	44.059	2	1696.7654	1696.7654	K	K	69	84
PSM	TTPSVVAFTADGER	2129	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13624	31.634	2	1449.71	1449.7100	R	L	86	100
PSM	TTPSYVAFTDTER	2130	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13630	31.645	2	1486.694	1486.6940	R	L	37	50
PSM	TTPSYVAFTDTER	2131	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13696	31.778	3	1486.694	1486.6940	R	L	37	50
PSM	TVIIEQSWGSPK	2132	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=13947	32.368	2	1343.7085	1343.7085	R	V	61	73
PSM	TVLLLADQMISR	2133	sp|P48730|KC1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21101	45.874	2	1358.7592	1358.7592	K	I	104	116
PSM	TWNDPSVQQDIK	2134	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11773	28.031	2	1429.6838	1429.6838	R	F	102	114
PSM	TYQEDLTLLQQR	2135	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16898	37.838	3	1506.7678	1506.7678	K	L	533	545
PSM	VADGMVFGALLPCEECSGQLVFK	2136	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	13-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=25833	55.289	3	2526.1957	2526.1957	R	S	283	306
PSM	VAPEEHPVLLTEAPLNPK	2137	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=14308	33.014	3	1953.0571	1953.0571	R	A	96	114
PSM	VCEVCSAYLGLHDNDRR	2138	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=10937	26.429	4	2062.9313	2062.9313	R	L	189	206
PSM	VDKPSEIVDVGDK	2139	sp|Q9NP64-2|NO40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=9342	23.168	3	1399.7195	1399.7195	R	V	30	43
PSM	VEFATLQEALAHALTEK	2140	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=25596	54.712	3	1869.9836	1869.9836	R	E	1043	1060
PSM	VEILANDQGNR	2141	sp|P17066|HSP76_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7565	19.77	2	1227.6208	1227.6208	R	T	28	39
PSM	VFDKEGNGTVMGAELR	2142	sp|P05976-2|MYL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=11254	27.019	3	1721.8407	1721.8407	R	H	94	110
PSM	VGDQILLAIK	2143	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17632	39.198	2	1068.6543	1068.6543	K	G	69	79
PSM	VISGVLQLGNIVFKK	2144	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=22126	47.789	3	1613.9869	1613.9869	R	E	342	357
PSM	VLEQLTGQTPVFSK	2145	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15958	36.176	3	1545.8403	1545.8403	K	A	39	53
PSM	VQIGEYTFEKGDYGDAVVYR	2146	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=17785	39.465	4	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	2147	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=29685	63.895	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQNQVILEENTTLLGFQDK	2148	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=21036	45.752	3	2188.1376	2188.1376	R	H	1425	1444
PSM	VTEEGTELSQR	2149	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=6081	16.696	2	1247.5994	1247.5994	K	L	1814	1825
PSM	VVEEAPSIFLDAETRR	2150	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=16984	37.991	3	1830.9476	1830.9476	K	A	299	315
PSM	VYVGNLGNNGNK	2151	sp|P84103-2|SRSF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=7918	20.579	2	1247.6258	1247.6258	K	T	12	24
PSM	WENVEEPNLDELLVR	2152	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=23615	50.754	3	1853.9159	1853.9159	R	L	88	103
PSM	WFNGQPIHAELSPVTDFR	2153	sp|Q01081|U2AF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=19645	43.071	3	2113.0381	2113.0381	R	E	134	152
PSM	YFYVSAEQVVQGMK	2154	sp|O95881|TXD12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=20703	45.136	2	1647.7967	1647.7967	K	E	139	153
PSM	YLYTLVITDKEK	2155	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0		ms_run[2]:scan=15158	34.69	3	1484.8126	1484.8126	R	A	41	53
PSM	YPGTPADFNPGSLACSQLQNYDPDR	2156	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	24.0	15-UNIMOD:4	ms_run[2]:scan=21304	46.229	3	2782.2293	2782.2293	R	A	3842	3867
PSM	DQVLSLSHEIEECR	2157	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	13-UNIMOD:4	ms_run[1]:scan=15256	34.917469	2	1714.801243	1713.799199	K	S	1107	1121
PSM	MDGREPAQLLLLLAK	2158	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=24200	51.865283	3	1666.943652	1666.944012	R	T	238	253
PSM	GPLLTALSAEAVASALHK	2159	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=23110	49.768852	3	1748.986785	1747.983235	R	L	1230	1248
PSM	QLVTLECLALELEENHHK	2160	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=27147	58.653354	3	2158.0730	2158.0723	K	M	1551	1569
PSM	QNAELTGHISQLTEEKNDLR	2161	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=12644	29.723272	3	2297.150057	2295.145502	R	N	3591	3611
PSM	MDEPSPLAQPLELNQHSR	2162	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:1	ms_run[1]:scan=18866	41.475733	3	2103.004937	2103.005504	-	F	1	19
PSM	MDEPSPLAQPLELNQHSR	2163	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=16545	37.21269	3	2119.000263	2119.000418	-	F	1	19
PSM	KMEEVTETFLSLEK	2164	sp|Q8N4C6|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=18477	40.753266	3	1682.844317	1682.843689	K	S	1296	1310
PSM	INQHLQEELENR	2165	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9592	23.593334	2	1522.755392	1521.753569	R	T	2007	2019
PSM	VSHLLGINVTDFTR	2166	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=18894	41.52655	3	1570.847017	1570.846741	K	G	374	388
PSM	ELLLGQLFLTEQEVSGEHLDGK	2167	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=26199	56.101207	3	2454.267208	2454.264220	R	T	801	823
PSM	CCYDHVISTSHK	2168	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=9098	22.739869	3	1488.6110	1488.6121	K	L	952	964
PSM	CCYDHVISTSHK	2169	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=9814	24.091095	3	1488.6097	1488.6121	K	L	952	964
PSM	ELHLSWEVGK	2170	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0		ms_run[1]:scan=15187	34.756993	2	1196.6195	1196.6184	R	P	1085	1095
PSM	VQIGEYTFEKGDYGDAVVYR	2171	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=22443	48.537869	3	2310.114987	2308.101178	K	G	1116	1136
PSM	HYVYIGDPAQLPAPR	2172	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=15956	36.17371	3	1695.872946	1695.873290	K	T	1318	1333
PSM	HYVYIGDPAQLPAPR	2173	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=13670	31.728298	4	1695.872805	1695.873290	K	T	1318	1333
PSM	GTLEPEYFNSVCR	2174	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	12-UNIMOD:4	ms_run[1]:scan=15571	35.489344	2	1570.707132	1570.708593	K	L	1338	1351
PSM	TIGPDMFLGTCR	2175	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:4	ms_run[1]:scan=19827	43.463799	2	1366.635867	1366.637342	K	R	1354	1366
PSM	RCPAEIVDTVSALVYDNK	2176	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4	ms_run[1]:scan=24838	53.127893	3	2050.028707	2049.020091	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2177	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4	ms_run[1]:scan=24810	53.073237	3	2050.028707	2049.020091	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2178	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4	ms_run[1]:scan=26190	56.077474	3	2049.021313	2049.020091	R	L	1366	1384
PSM	GVITHDVSSAINR	2179	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9724	23.867136	3	1367.712038	1367.715727	K	P	1401	1414
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	2180	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	32-UNIMOD:4	ms_run[1]:scan=26118	55.92385	3	4030.888067	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	2181	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=24975	53.393266	3	4029.883816	4027.852775	K	F	1448	1484
PSM	GLAPVQAYLHIPDIIK	2182	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=23599	50.724827	3	1747.002004	1747.003242	R	V	89	105
PSM	VVEIAPAAHLDPQLR	2183	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=14032	32.525596	3	1627.905894	1627.904590	K	T	274	289
PSM	VDSGIQPGSDISIYYDPMISK	2184	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=21663	46.869098	3	2285.092460	2284.093315	R	L	431	452
PSM	VWDDGIIDPADTR	2185	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=17052	38.107617	2	1472.694190	1471.694323	R	L	526	539
PSM	QLFHPEQLITGK	2186	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	24.0	1-UNIMOD:28	ms_run[1]:scan=20876	45.453812	2	1392.7398	1392.7396	R	E	85	97
PSM	AVCMLSNTTAIAEAWAR	2187	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	3-UNIMOD:4	ms_run[1]:scan=23155	49.852627	3	1863.896856	1863.897139	R	L	374	391
PSM	CPEALFQPSFLGMESCGIHETTFNSIMK	2188	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=24875	53.201432	3	3231.461201	3230.454500	R	C	257	285
PSM	DLYANTVLSGGTTMYPGIADR	2189	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=21632	46.814244	2	2216.064304	2214.062684	K	M	292	313
PSM	LCQIFSDLNATYR	2190	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	2-UNIMOD:4	ms_run[1]:scan=19609	43.006248	2	1600.770706	1599.771528	K	T	623	636
PSM	TIRYPDPLIK	2191	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=12902	30.234656	3	1214.702854	1214.702309	R	V	146	156
PSM	AGGAAVVITEPEHTK	2192	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=7765	20.217244	3	1478.771148	1478.772908	K	E	78	93
PSM	LIQLMEEIMAEKENK	2193	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=21170	45.992772	3	1817.924309	1817.926708	K	T	406	421
PSM	MGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGR	2194	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:35	ms_run[1]:scan=23041	49.639151	4	3519.783123	3519.782040	R	L	145	179
PSM	TWGDLGAAAGGGTPSK	2195	sp|P31323|KAP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=12635	29.707233	2	1445.696663	1444.694657	R	G	57	73
PSM	CPVAQLEQDDQVSPSSTFCK	2196	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	1-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=14665	33.647818	3	2295.013391	2295.014748	K	V	252	272
PSM	IILDLISESPIK	2197	sp|P61978|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=23009	49.581226	2	1339.795937	1339.796269	K	G	208	220
PSM	LAAVDATVNQVLASR	2198	sp|Q15084|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=19098	41.894458	2	1526.838196	1526.841656	K	Y	217	232
PSM	EIHKPGYLANDR	2199	sp|P35241|RADI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=5506	15.594972	3	1412.726347	1411.720812	K	L	140	152
PSM	VDKPSEIVDVGDK	2200	sp|Q9NP64|NO40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=9406	23.275978	3	1399.719560	1399.719475	R	V	54	67
PSM	NLDAQYEMAR	2201	sp|Q7L4I2|RSRC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10124	24.681531	2	1209.545809	1209.544822	R	S	402	412
PSM	KQMVIDVLHPGK	2202	sp|P62847|RS24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=10789	26.17582	3	1363.764585	1363.764591	R	A	21	33
PSM	TDPTTLTDEEINR	2203	sp|P11586|C1TC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=11440	27.359914	2	1503.705901	1503.705282	K	F	505	518
PSM	AGELGLGGAGTR	2204	sp|Q9Y4X0|AMMR1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=8842	22.269954	2	1057.552358	1057.551622	R	L	41	53
PSM	TILSNQTVDIPENVDITLK	2205	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=21163	45.979606	2	2112.131378	2112.131415	K	G	3	22
PSM	NHLLPDIVTCVQSSR	2206	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	10-UNIMOD:4	ms_run[1]:scan=16606	37.321373	3	1737.880099	1737.883203	R	K	175	190
PSM	GKDSLYAQGK	2207	sp|P83881|RL36A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=3710	11.917369	2	1065.546061	1065.545474	K	R	29	39
PSM	GVEGLIDIENPNR	2208	sp|Q13442|HAP28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=16913	37.862271	2	1424.725710	1424.725957	K	V	76	89
PSM	GQAGGGGPGTGPGLGEAGSLATCELPLAK	2209	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	23-UNIMOD:4	ms_run[1]:scan=19284	42.33575	3	2581.272543	2579.264966	R	S	23	52
PSM	YVIHTVGPIAYGEPSASQAAELR	2210	sp|Q9BQ69|MACD1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=16418	36.986719	3	2429.239275	2428.238674	K	S	222	245
PSM	HIHITQATETTTTR	2211	sp|Q14677|EPN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=4920	14.50125	3	1609.825275	1608.821983	K	H	261	275
PSM	VQIGEYTFEKGDYGDAVVYR	2212	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0		ms_run[1]:scan=23013	49.587264	3	2311.101917	2308.101178	K	G	1116	1136
PSM	VMTIPYQPMPASSPVICAGGQDR	2213	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	9-UNIMOD:35,17-UNIMOD:4	ms_run[1]:scan=17206	38.391922	3	2493.164572	2490.170537	R	C	178	201
PSM	IVYTACSHAAVDALCAK	2214	cov|corona04765|ORF1b_France/OCC-31/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13286	30.932016	2	1849.871286	1848.886240	R	A	1227	1244
PSM	SHKPPISFPLCANGQVFGLYK	2215	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	24.0	11-UNIMOD:4	ms_run[1]:scan=20832	45.374916	3	2360.197867	2359.214708	K	N	997	1018
PSM	AAGLQAEIGQVK	2216	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11872	28.216	2	1183.6561	1183.6561	K	Q	461	473
PSM	AASAYAVGDVK	2217	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7841	20.437	2	1050.5346	1050.5346	R	C	348	359
PSM	AASLELSEVKK	2218	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8338	21.32	3	1173.6605	1173.6605	K	E	1211	1222
PSM	ACSEMEVLNR	2219	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=10583	25.678	2	1207.5325	1207.5325	K	Q	1131	1141
PSM	ADALQGALEQAHMTLK	2220	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:35	ms_run[2]:scan=16062	36.363	3	1711.8563	1711.8563	K	E	1840	1856
PSM	ADKTPGGSQK	2221	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=2297	8.9916	2	1029.5091	1029.5091	M	A	2	12
PSM	AEGVIDGYADEK	2222	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9844	24.152	2	1265.5776	1265.5776	K	T	1920	1932
PSM	AGKPVICATQMLESMIK	2223	sp|P14618-2|KPYM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=23108	49.761	3	1875.962	1875.9620	R	K	320	337
PSM	ALIAAQYSGAQVR	2224	sp|P26641|EF1G_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11859	28.192	2	1346.7306	1346.7306	K	V	18	31
PSM	AMLDQLMGTSR	2225	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=13125	30.624	2	1237.5795	1237.5795	R	D	9	20
PSM	AMLDQLMGTSR	2226	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17212	38.403	2	1221.5846	1221.5846	R	D	9	20
PSM	APTIETVVLYTGETPSEQDQGKR	2227	sp|Q9BYC8|RM32_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16974	37.973	3	2518.2551	2518.2551	K	I	151	174
PSM	AVCMLSNTTAVAEAWAR	2228	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=21108	45.885	3	1849.8815	1849.8815	R	L	374	391
PSM	AVPGCNKDSVR	2229	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,5-UNIMOD:4	ms_run[2]:scan=6190	16.88	2	1243.5979	1243.5979	M	A	2	13
PSM	AYGGAYDVMSSK	2230	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11077	26.712	2	1247.5492	1247.5492	K	H	434	446
PSM	CASQAGMTAYGTR	2231	sp|Q15417-3|CNN3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=7021	18.629	2	1372.5864	1372.5864	K	R	127	140
PSM	CEFQDAYVLLSEK	2232	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=20980	45.641	3	1600.7443	1600.7443	K	K	237	250
PSM	CGDSVYAAEK	2233	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=5390	15.347	2	1098.4652	1098.4652	R	I	122	132
PSM	CPAEIVDTVSALVYDNK	2234	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=28696	62.043	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	2235	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=29277	63.127	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	2236	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=27400	59.456	3	1892.919	1892.9190	R	L	1367	1384
PSM	CPDLSDFQQK	2237	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:4	ms_run[2]:scan=11271	27.049	2	1236.5445	1236.5445	R	I	1692	1702
PSM	DASVQTVATEGDLLR	2238	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16182	36.575	2	1573.7948	1573.7948	K	F	870	885
PSM	DATNVGDEGGFAPNILENK	2239	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18067	39.973	2	1959.9174	1959.9174	K	E	203	222
PSM	DGQVINETSQHHDDLE	2240	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8139	20.97	3	1835.7922	1835.7922	R	-	451	467
PSM	DISEASVFDAYVLPK	2241	sp|P62854|RS26_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23818	51.133	2	1652.8298	1652.8298	R	L	52	67
PSM	DLAQDEAVWLER	2242	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21526	46.628	2	1443.6994	1443.6994	R	G	218	230
PSM	DLMACAQTGSGK	2243	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=8604	21.874	2	1237.5431	1237.5431	R	T	203	215
PSM	DLQDRNDELQAELEGLWAR	2244	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=24783	53.025	3	2270.0927	2270.0927	R	L	560	579
PSM	DMAGLLKPTACTMLVSSLR	2245	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=20230	44.182	3	2079.0527	2079.0527	K	D	742	761
PSM	DMVGIAQTGSGK	2246	sp|Q92841-1|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9360	23.197	2	1162.5652	1162.5652	R	T	131	143
PSM	DNHLLGTFDLTGIPPAPR	2247	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21442	46.478	3	1933.0058	1933.0058	K	G	475	493
PSM	DQVLSLSHEIEECRSELEVLQQR	2248	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:4	ms_run[2]:scan=22148	47.827	4	2796.3712	2796.3712	K	R	1107	1130
PSM	DYGVLLEGSGLALR	2249	sp|P30048-2|PRDX3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22494	48.638	2	1461.7827	1461.7827	R	G	153	167
PSM	EANVYHASTANGESR	2250	sp|Q9BRS2|RIOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4124	12.841	3	1604.7179	1604.7179	K	A	191	206
PSM	EASFEYLQNEGER	2251	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13398	31.137	2	1570.69	1570.6900	K	L	1436	1449
PSM	ECEQECELAITDLESGREDEAGLHQSQAVHGLELEALR	2252	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=20329	44.402	5	4320.9863	4320.9863	K	L	214	252
PSM	EEAENTLQSFR	2253	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11698	27.829	2	1322.6103	1322.6103	R	Q	197	208
PSM	EHALLAYTLGVK	2254	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15163	34.702	3	1313.7343	1313.7343	R	Q	135	147
PSM	EHALLAYTLGVK	2255	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15497	35.355	3	1313.7343	1313.7343	R	Q	135	147
PSM	EILSSPPNDAVGELEQQLK	2256	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21754	47.041	3	2066.0532	2066.0532	K	R	121	140
PSM	EKEALSEELNSCVDK	2257	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	12-UNIMOD:4	ms_run[2]:scan=10321	25.095	3	1749.8091	1749.8091	K	L	1715	1730
PSM	EKLQEEMLQR	2258	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9068	22.687	2	1302.6602	1302.6602	R	E	187	197
PSM	ELADASQQLER	2259	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8830	22.251	2	1258.6153	1258.6153	K	L	940	951
PSM	EMDDCHSTLEQLTEK	2260	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=12269	28.996	3	1834.7713	1834.7713	K	K	420	435
PSM	ENNVDAVHPGYGFLSER	2261	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14603	33.528	2	1902.886	1902.8860	K	A	108	125
PSM	ENYLGNSLMAPVGR	2262	sp|Q9BU76-4|MMTA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17007	38.029	2	1519.7453	1519.7453	R	W	28	42
PSM	EQLAELQSGFVK	2263	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15226	34.852	2	1347.7034	1347.7034	K	L	547	559
PSM	EQTEGEYSSLEHESAR	2264	sp|O43837|IDH3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8463	21.603	3	1850.7919	1850.7919	R	G	165	181
PSM	EQYLMAISDKDQQLSHLQNLIR	2265	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20880	45.46	4	2642.3486	2642.3486	K	E	2973	2995
PSM	ESTGAQVQVAGDMLPNSTER	2266	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13678	31.743	3	2088.9746	2088.9746	R	A	125	145
PSM	ETNLDSLPLVDTHSKR	2267	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12418	29.256	2	1823.9377	1823.9377	R	T	425	441
PSM	EVEDLSATLLCK	2268	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=16769	37.61	2	1376.6857	1376.6857	K	L	756	768
PSM	FAAATGATPIAGR	2269	sp|P08865|RSSA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9372	23.218	2	1202.6408	1202.6408	K	F	90	103
PSM	FDSNNVVLIEDNGNPVGTR	2270	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16533	37.191	2	2058.997	2058.9970	R	I	100	119
PSM	FGDLDPSSAEFFLQEER	2271	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23754	51.019	2	1985.9007	1985.9007	K	L	516	533
PSM	FGDPECQVILPLLK	2272	sp|P22102-2|PUR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=23858	51.205	2	1627.8644	1627.8644	R	S	293	307
PSM	FGQGGAGPVGGQGPR	2273	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7545	19.732	2	1340.6585	1340.6585	R	G	667	682
PSM	FNASQLITQR	2274	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14479	33.312	2	1176.6251	1176.6251	K	A	148	158
PSM	FQTMSDQIIGR	2275	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13469	31.264	2	1294.634	1294.6340	K	I	27	38
PSM	GDLLQVVQEAFEK	2276	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=27361	59.311	2	1474.7668	1474.7668	R	E	2451	2464
PSM	GGDAPAAGEDA	2277	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4295	13.207	2	929.37265	929.3727	K	-	115	126
PSM	GGQDQFNWEDVK	2278	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15425	35.229	2	1421.6212	1421.6212	R	T	11	23
PSM	GGSGGSYGGGGSGGGYGGGSGSR	2279	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4854	14.377	2	1790.7204	1790.7204	R	G	491	514
PSM	GGSGSGPTIEEVD	2280	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10541	25.604	2	1203.5255	1203.5255	K	-	629	642
PSM	GGVDHAAAFGR	2281	sp|Q9HC38-2|GLOD4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5814	16.178	3	1056.5101	1056.5101	K	I	191	202
PSM	GHQQLYWSHPR	2282	sp|P62273|RS29_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7002	18.589	3	1407.6796	1407.6796	M	K	2	13
PSM	GHQQLYWSHPR	2283	sp|P62273|RS29_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7075	18.746	2	1407.6796	1407.6796	M	K	2	13
PSM	GNVGVVLFNFGK	2284	sp|P33316-2|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21686	46.911	2	1249.6819	1249.6819	R	E	107	119
PSM	GPLATGGIKK	2285	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4505	13.652	2	940.57057	940.5706	K	S	51	61
PSM	GQVCLPVISAENWKPATK	2286	sp|P68036-2|UB2L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	4-UNIMOD:4	ms_run[2]:scan=17828	39.539	3	1997.0404	1997.0404	K	T	51	69
PSM	GSAVDASVQEESPVTK	2287	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8824	22.239	2	1602.7737	1602.7737	K	E	43	59
PSM	GSVLEPEGTVEIK	2288	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12969	30.353	2	1356.7137	1356.7137	R	F	2115	2128
PSM	GTPLDTEVPMER	2289	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12849	30.098	2	1343.6391	1343.6391	R	V	819	831
PSM	GVITHDVSSAINR	2290	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9688	23.775	2	1367.7157	1367.7157	K	P	1401	1414
PSM	HDVHQICDKDAQQDLNLDIEK	2291	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	7-UNIMOD:4	ms_run[2]:scan=11211	26.944	4	2533.1867	2533.1867	K	I	1688	1709
PSM	HGELQDHKEQAR	2292	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1946	8.4246	4	1446.6964	1446.6964	R	R	1858	1870
PSM	HHSHLQQIR	2293	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2054	8.5849	3	1154.6057	1154.6057	R	R	726	735
PSM	HREDIPFDGTNDETER	2294	sp|P57060|RWD2B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8818	22.23	3	1929.8453	1929.8453	R	Q	255	271
PSM	HWPFMVVNDAGRPK	2295	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14513	33.374	3	1652.8246	1652.8246	K	V	89	103
PSM	IEDVTPIPSDSTR	2296	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10826	26.237	2	1428.7096	1428.7096	R	R	129	142
PSM	IFDYSPLDPTQDFNTQMTK	2297	sp|Q92995-2|UBP13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22127	47.79	3	2260.0358	2260.0358	R	L	306	325
PSM	IFTSIGEDYDER	2298	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14100	32.643	2	1443.6518	1443.6518	R	V	106	118
PSM	IINDLLQSLR	2299	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20122	43.983	2	1183.6925	1183.6925	R	S	385	395
PSM	IMNTFSVVPSPK	2300	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:35	ms_run[2]:scan=13313	30.987	2	1334.6904	1334.6904	R	V	163	175
PSM	IPASQTSVPFDHLGK	2301	sp|P49674|KC1E_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12380	29.189	3	1595.8308	1595.8308	R	-	402	417
PSM	IQIASESSGIPERPCVLTGTPESIEQAK	2302	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	15-UNIMOD:4	ms_run[2]:scan=16274	36.731	4	2996.5125	2996.5125	K	R	111	139
PSM	ISEQFTAMFR	2303	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18807	41.365	2	1228.591	1228.5910	R	R	381	391
PSM	ITGLYPTLNISDEFSSNVANYQK	2304	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20677	45.088	3	2573.2649	2573.2649	R	V	1172	1195
PSM	KAYGGAYDVMSSK	2305	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8758	22.13	3	1375.6442	1375.6442	R	H	433	446
PSM	KESQWQMEQEFFK	2306	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17134	38.259	3	1743.7927	1743.7927	R	G	155	168
PSM	KGPGPGGPGGAGVAR	2307	sp|Q92686|NEUG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3745	11.985	3	1233.6578	1233.6578	R	G	54	69
PSM	KHPDASVNFSEFSK	2308	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10489	25.495	4	1591.7631	1591.7631	K	K	30	44
PSM	KHPDSSVNFAEFSK	2309	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10224	24.859	4	1591.7631	1591.7631	K	K	30	44
PSM	KLEMTELLLQQFSSR	2310	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22969	49.512	3	1821.9659	1821.9659	K	C	341	356
PSM	KLLEGEESR	2311	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4262	13.112	2	1059.556	1059.5560	R	I	402	411
PSM	KNPEVPVNFAEFSK	2312	sp|O15347|HMGB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15584	35.514	3	1604.8199	1604.8199	K	K	30	44
PSM	KPAAATVTK	2313	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=1997	8.5007	2	885.52837	885.5284	K	K	160	169
PSM	KQDPDTWENELPVSK	2314	sp|Q92995-2|UBP13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13687	31.762	3	1784.8581	1784.8581	R	Y	111	126
PSM	KQMVIDVLHPGK	2315	sp|P62847-2|RS24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10773	26.147	3	1363.7646	1363.7646	R	A	21	33
PSM	KSDIDEIVLVGGSTR	2316	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14614	33.549	3	1587.8468	1587.8468	K	I	353	368
PSM	KSEIEYYAMLAK	2317	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15412	35.207	3	1444.7272	1444.7272	R	T	57	69
PSM	LAVNMVPFPR	2318	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:35	ms_run[2]:scan=18517	40.837	2	1158.6219	1158.6220	K	L	253	263
PSM	LCQELTEIDQLAQQLER	2319	sp|Q66GS9|CP135_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=26070	55.818	3	2086.0365	2086.0365	K	H	315	332
PSM	LEDTHFVQCPSVPSHK	2320	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=9294	23.086	4	1879.8887	1879.8887	R	F	497	513
PSM	LEDTHFVQCPSVPSHK	2321	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4	ms_run[2]:scan=9346	23.174	3	1879.8887	1879.8887	R	F	497	513
PSM	LEEGTEETSETLEK	2322	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8299	21.253	2	1593.7257	1593.7257	R	L	799	813
PSM	LEHIDGVNLTVPVK	2323	sp|Q6P087|RUSD3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15031	34.444	3	1532.8562	1532.8562	K	A	192	206
PSM	LEQELFSGGNTGINFEK	2324	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18665	41.097	2	1881.9109	1881.9109	R	Y	130	147
PSM	LGAQLADLHLDNKK	2325	sp|Q9HA64|KT3K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11641	27.721	3	1534.8467	1534.8467	K	L	103	117
PSM	LGHAEQKDEMVPR	2326	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4745	14.185	4	1508.7406	1508.7406	R	L	362	375
PSM	LHFFMPGFAPLTSR	2327	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22661	48.928	3	1619.8283	1619.8283	R	G	263	277
PSM	LKLFAAETLK	2328	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13929	32.318	3	1132.6856	1132.6856	R	A	1053	1063
PSM	LKLFAAETLK	2329	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14275	32.951	3	1132.6856	1132.6856	R	A	1053	1063
PSM	LKLFAAETLK	2330	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14638	33.593	3	1132.6856	1132.6856	R	A	1053	1063
PSM	LLDAVDTYIPVPAR	2331	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20387	44.501	2	1541.8453	1541.8453	K	D	239	253
PSM	LLEQLQEIGQEKEQLTQELQEAR	2332	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23167	49.873	4	2752.4243	2752.4243	R	K	401	424
PSM	LNKENDTLK	2333	sp|Q9BQQ3-2|GORS1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2712	9.7419	2	1073.5717	1073.5717	R	A	48	57
PSM	LNTICAQVIPFLSQEHQQQVAQAVER	2334	sp|Q04724|TLE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=21766	47.061	3	3006.5345	3006.5345	R	A	85	111
PSM	LPPAASEEAHTSNVK	2335	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5378	15.325	3	1549.7736	1549.7736	R	M	3117	3132
PSM	LQEMLMGLEAK	2336	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17207	38.393	2	1261.641	1261.6410	R	Q	524	535
PSM	LQSAGSAMPTSSSFK	2337	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10630	25.762	2	1497.7133	1497.7133	R	H	1268	1283
PSM	LQTLVSEQPNKDVVEQMEK	2338	sp|Q86UP2|KTN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13998	32.461	3	2214.1202	2214.1202	K	C	717	736
PSM	LSSSQGTIETSLQDIDSR	2339	sp|Q9UHD2|TBK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16725	37.534	2	1935.9385	1935.9385	R	L	508	526
PSM	LTDSSPSSTSTSNSQR	2340	sp|Q5VT06|CE350_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3624	11.73	2	1653.7442	1653.7442	R	L	254	270
PSM	LTPEEEEILNK	2341	sp|P62241|RS8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12946	30.314	2	1313.6715	1313.6715	K	K	129	140
PSM	LTQAQASFER	2342	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7792	20.303	2	1149.5778	1149.5778	R	E	731	741
PSM	LVEALAAATEK	2343	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11632	27.705	2	1114.6234	1114.6234	K	Q	188	199
PSM	LVEALCAEHQINLIK	2344	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=15729	35.772	3	1749.9447	1749.9447	K	V	64	79
PSM	LVNLQHLDLLNNK	2345	sp|Q96AG4|LRC59_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17523	39.013	3	1532.8675	1532.8675	R	L	84	97
PSM	LVPELDTIVPLESTK	2346	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21791	47.107	2	1652.9237	1652.9237	R	A	298	313
PSM	LVVPASQCGSLIGK	2347	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=13329	31.017	2	1427.7806	1427.7806	R	G	102	116
PSM	LVVPATQCGSLIGK	2348	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=13931	32.321	2	1441.7963	1441.7963	R	G	102	116
PSM	LYSPSQIGAFVLMK	2349	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	13-UNIMOD:35	ms_run[2]:scan=22416	48.484	2	1568.8273	1568.8273	K	M	160	174
PSM	MAIMVQSPMFDGK	2350	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18906	41.547	2	1453.6768	1453.6768	R	V	35	48
PSM	MDDREDLVYQAK	2351	sp|P62258|1433E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1	ms_run[2]:scan=13314	30.989	2	1523.6926	1523.6926	-	L	1	13
PSM	MGPAMGPALGAGIER	2352	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14825	33.967	2	1426.7061	1426.7061	R	M	553	568
PSM	MGQLGLGNQTDAVPSPAQIMYNGQPITK	2353	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21477	46.54	3	2928.4474	2928.4474	K	M	231	259
PSM	MKETAENYLGHTAK	2354	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6573	17.548	4	1591.7664	1591.7664	K	N	174	188
PSM	MKETAENYLGHTAK	2355	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6581	17.562	2	1591.7664	1591.7664	K	N	174	188
PSM	MMCGAPSATQPATAETQHIADQVR	2356	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	1-UNIMOD:1,1-UNIMOD:35,3-UNIMOD:4	ms_run[2]:scan=15081	34.546	3	2628.1731	2628.1731	-	S	1	25
PSM	MMNGGHYTYSENRVEK	2357	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=6393	17.242	4	1914.8353	1914.8353	K	D	133	149
PSM	NDELTSLAEETR	2358	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14067	32.585	2	1376.642	1376.6420	R	A	247	259
PSM	NDFTEEEEAQVR	2359	sp|P63208|SKP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10654	25.808	2	1465.6321	1465.6321	K	K	143	155
PSM	NLTPAPLTSTPPLRS	2360	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14430	33.223	2	1563.8621	1563.8621	R	-	2119	2134
PSM	NPQNSSQSADGLR	2361	sp|Q01081|U2AF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4500	13.632	2	1372.6331	1372.6331	R	C	54	67
PSM	NQVAMNPTNTVFDAK	2362	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:35	ms_run[2]:scan=11144	26.826	2	1664.7828	1664.7828	K	R	57	72
PSM	NSEGWEQNGLYEFFR	2363	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=24511	52.486	2	1874.8224	1874.8224	R	A	704	719
PSM	NSMPASSFQQQK	2364	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7506	19.657	2	1351.619	1351.6190	R	L	175	187
PSM	QAQAQHLQEVR	2365	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4228	13.043	3	1306.6742	1306.6742	R	L	1242	1253
PSM	QIESTETSCHGCR	2366	sp|Q9Y508-2|RN114_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=2940	10.276	3	1563.6406	1563.6406	R	K	83	96
PSM	QLEMNLAEAER	2367	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13319	30.999	2	1302.6238	1302.6238	K	Q	773	784
PSM	QNQNYKDQLSQLNVR	2368	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11752	27.982	3	1846.9286	1846.9286	R	V	1141	1156
PSM	QNRPIPQWIR	2369	sp|Q59GN2|R39L5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=12130	28.728	3	1306.7258	1306.7258	K	M	19	29
PSM	QQLLQDLEDLR	2370	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21998	47.521	2	1369.7201	1369.7201	R	N	913	924
PSM	QQMTALQSQLQQVQLER	2371	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17982	39.812	3	2028.0422	2028.0422	R	T	538	555
PSM	QSGYGGQTKPIFR	2372	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8344	21.328	3	1437.7365	1437.7365	K	K	45	58
PSM	QSIHDEISVSSMDASR	2373	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11340	27.178	3	1760.7999	1760.7999	R	Q	1563	1579
PSM	QSNQDAQDIER	2374	sp|Q12923-3|PTN13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4516	13.677	2	1302.58	1302.5800	R	A	875	886
PSM	QSSDYEELIQVLKK	2375	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19670	43.117	3	1678.8778	1678.8778	K	E	546	560
PSM	QTIAHQQQQLTNLQMAAQR	2376	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11644	27.726	3	2207.1229	2207.1229	K	Q	43	62
PSM	QTLMWSATWPK	2377	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20202	44.127	2	1347.6645	1347.6645	R	E	274	285
PSM	QVDQLTNDKAR	2378	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4114	12.822	3	1286.6579	1286.6579	R	V	160	171
PSM	QVEELLMAMEK	2379	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=20173	44.076	2	1319.6465	1319.6465	K	V	873	884
PSM	RCPAEIVDTVSALVYDNK	2380	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=22295	48.162	4	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2381	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=25799	55.216	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2382	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=28275	61.325	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2383	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4	ms_run[2]:scan=30027	64.63	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RHDAQQLQQLK	2384	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4613	13.925	3	1363.732	1363.7320	R	H	36	47
PSM	SATDRDLMELK	2385	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10347	25.163	3	1277.6286	1277.6286	K	A	196	207
PSM	SCCSCCPVGCAK	2386	sp|P80297|MT1X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	2-UNIMOD:4,3-UNIMOD:4,5-UNIMOD:4,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=4418	13.477	2	1444.5026	1444.5026	K	C	32	44
PSM	SEEELLVIFNKK	2387	sp|Q9NX58|LYAR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18756	41.267	3	1447.7922	1447.7922	R	I	350	362
PSM	SFSRPDHLNSHVR	2388	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5170	14.972	3	1550.7702	1550.7702	K	Q	345	358
PSM	SGDAAIVDMVPGK	2389	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14480	33.313	2	1258.6227	1258.6227	K	P	396	409
PSM	SGGASHSELIHNLRK	2390	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5129	14.905	3	1604.8383	1604.8383	K	N	5	20
PSM	SGQQQSDQIQK	2391	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2629	9.5704	2	1245.5949	1245.5949	R	L	1190	1201
PSM	SHFAIGLALYYPSAR	2392	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19739	43.262	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHFAIGLALYYPSAR	2393	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=23707	50.928	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHKPPISFPLCANGQVFGLYK	2394	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=21872	47.252	4	2359.2147	2359.2147	K	N	997	1018
PSM	SKITVTSEVPFSK	2395	sp|P35268|RL22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11684	27.795	3	1421.7766	1421.7766	K	R	68	81
PSM	SLCEVQQEVLQLR	2396	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=19845	43.5	3	1600.8243	1600.8243	R	S	2626	2639
PSM	SMPGKPPGMDPIASALR	2397	sp|Q04726-3|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14967	34.25	3	1723.8749	1723.8749	R	T	339	356
PSM	SPVSQLDCLNR	2398	sp|Q04724|TLE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	8-UNIMOD:4	ms_run[2]:scan=12379	29.187	2	1287.6241	1287.6241	K	D	519	530
PSM	SQEAQSLQQQR	2399	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4323	13.281	2	1301.6324	1301.6324	K	D	602	613
PSM	SQLQEQLAQLSR	2400	sp|Q5TZA2|CROCC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16158	36.532	2	1399.7419	1399.7419	R	Q	830	842
PSM	SRPELCDAATEAR	2401	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:4	ms_run[2]:scan=6938	18.443	3	1474.6834	1474.6834	R	R	113	126
PSM	SSLLSEIQALR	2402	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22586	48.8	2	1215.6823	1215.6823	R	A	2515	2526
PSM	SSLPGAKPGPSMTDGVSSGFLNR	2403	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14867	34.046	3	2261.111	2261.1110	K	S	317	340
PSM	STAGDTHLGGEDFDNR	2404	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8461	21.596	3	1690.7183	1690.7183	K	M	221	237
PSM	SVEELLEAELLK	2405	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=25242	53.916	2	1371.7497	1371.7497	K	V	812	824
PSM	SVHSSVPLLNSKDPIDR	2406	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11222	26.963	4	1862.985	1862.9850	K	I	1905	1922
PSM	SVLEHLPMAVQER	2407	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14240	32.887	3	1507.7817	1507.7817	R	E	1487	1500
PSM	TAALVEEVYFAQK	2408	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18534	40.868	2	1467.7609	1467.7609	K	E	163	176
PSM	TDASSASSFLDSDELER	2409	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16866	37.78	2	1828.7963	1828.7963	R	T	330	347
PSM	TDTESELDLISR	2410	sp|P11586|C1TC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=15303	35.018	2	1377.6624	1377.6624	K	L	761	773
PSM	TGIDLGTTGR	2411	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9440	23.335	2	989.51417	989.5142	R	L	347	357
PSM	THINIVVIGHVDSGK	2412	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11509	27.486	4	1587.8733	1587.8733	K	S	6	21
PSM	TIADLELHYQEFIR	2413	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21665	46.872	3	1746.8941	1746.8941	K	N	579	593
PSM	TICSHVQNMIK	2414	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	3-UNIMOD:4	ms_run[2]:scan=9966	24.381	3	1329.6533	1329.6533	R	G	72	83
PSM	TIGPDMFLGTCR	2415	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=15300	35.013	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	2416	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=18177	40.184	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	2417	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=17233	38.442	2	1366.6373	1366.6373	K	R	1354	1366
PSM	TIGPDMFLGTCR	2418	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	11-UNIMOD:4	ms_run[2]:scan=20226	44.173	2	1366.6373	1366.6373	K	R	1354	1366
PSM	TKLEEALSPEVLELR	2419	sp|Q9Y3E2|BOLA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18832	41.413	3	1725.9513	1725.9513	R	N	38	53
PSM	TKTENSGEALAK	2420	sp|Q9P016|THYN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2534	9.4089	2	1247.6357	1247.6357	R	V	23	35
PSM	TSDLIVLGLPWK	2421	sp|Q13148|TADBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=25032	53.498	2	1340.7704	1340.7704	K	T	103	115
PSM	TSQLTGQVEDLEHK	2422	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=10759	26.118	3	1583.7791	1583.7791	K	L	725	739
PSM	TTPSVVAFTADGER	2423	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13660	31.708	3	1449.71	1449.7100	R	L	86	100
PSM	TVDNFVALATGEK	2424	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=18502	40.809	3	1363.6983	1363.6983	K	G	72	85
PSM	TVETRDGQVINETSQHHDDLE	2425	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9322	23.135	4	2422.0997	2422.0997	K	-	446	467
PSM	TVLEHYALEDDPLAAFK	2426	sp|Q3ZCQ8-3|TIM50_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=21618	46.79	3	1930.9676	1930.9676	R	Q	183	200
PSM	VFDYSEYWEGAR	2427	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19780	43.361	2	1520.6572	1520.6572	R	G	831	843
PSM	VGEFSGANKEK	2428	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=3722	11.945	3	1164.5775	1164.5775	K	L	86	97
PSM	VGLLCIMSDR	2429	cov|corona06480|ORF1b_Norway/2505/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=19354	42.489	2	1162.5838	1162.5839	K	D	1493	1503
PSM	VGLLCIMSDRDLYDK	2430	cov|corona06480|ORF1b_Norway/2505/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	5-UNIMOD:4	ms_run[2]:scan=20831	45.373	3	1796.8801	1796.8801	K	L	1493	1508
PSM	VGLNQQLLQLEEENQSVCSR	2431	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	18-UNIMOD:4	ms_run[2]:scan=19899	43.596	2	2343.1489	2343.1489	K	M	613	633
PSM	VGSTSENITQK	2432	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=4288	13.185	2	1162.583	1162.5830	R	V	392	403
PSM	VHLVGIDIFTGK	2433	sp|P63241|IF5A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19432	42.682	3	1297.7394	1297.7394	K	K	56	68
PSM	VHPEIINENGNPSYK	2434	sp|O95881|TXD12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8832	22.254	3	1709.8373	1709.8373	K	Y	124	139
PSM	VIKDFMIQGGDFTR	2435	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16208	36.619	2	1625.8236	1625.8236	R	G	96	110
PSM	VLAQYYTVTDEHHR	2436	sp|Q9NX58|LYAR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=9369	23.213	3	1730.8376	1730.8376	K	S	336	350
PSM	VLELDPALAPVVSR	2437	sp|O00170|AIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19903	43.605	2	1477.8504	1477.8504	K	E	291	305
PSM	VLQLGQEASTHQAQNEEHR	2438	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=7217	19.035	3	2174.0465	2174.0465	R	V	1156	1175
PSM	VMQEQGTHPK	2439	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=2160	8.7582	2	1153.555	1153.5550	K	F	546	556
PSM	VNNADDFPNLFR	2440	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=19697	43.17	2	1420.6735	1420.6735	K	Q	324	336
PSM	VQAERPDTMLGVVCGALHVADVSLR	2441	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0	14-UNIMOD:4	ms_run[2]:scan=25018	53.471	4	2692.3789	2692.3789	K	N	621	646
PSM	VQAQAEQGQQELK	2442	sp|Q9BW19|KIFC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=5363	15.299	2	1455.7318	1455.7318	K	N	195	208
PSM	VQIGEYTFEKGDYGDAVVYR	2443	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17712	39.336	4	2308.1012	2308.1012	K	G	1116	1136
PSM	VQQAELHTGSLPR	2444	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=8134	20.963	3	1434.7579	1434.7579	K	I	826	839
PSM	VSFENMTVGEESKQEQLILDHLPSVTK	2445	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=22410	48.472	4	3057.5329	3057.5329	K	E	1054	1081
PSM	VVEIAPAAHLDPQLR	2446	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14059	32.573	3	1627.9046	1627.9046	K	T	274	289
PSM	VYENYPTYDLTER	2447	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=14421	33.206	2	1661.7573	1661.7573	K	K	350	363
PSM	VYTITPLLSDNR	2448	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=17477	38.936	2	1390.7456	1390.7456	K	E	272	284
PSM	YASINTHLGIEQSR	2449	sp|P48730|KC1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=11134	26.809	3	1587.8005	1587.8005	R	R	179	193
PSM	YDFGIYDDDPEIITLER	2450	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=24178	51.82	2	2072.9579	2072.9579	R	R	120	137
PSM	YGPMEEPLVIEK	2451	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=16163	36.542	2	1403.7007	1403.7007	R	D	153	165
PSM	YYVTIIDAPGHR	2452	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	23.0		ms_run[2]:scan=13220	30.807	3	1403.7197	1403.7197	K	D	85	97
PSM	LEPSEGHSQELPWVHLQGVQDGDLEADTER	2453	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=18711	41.179698	4	3370.570245	3370.570192	R	A	637	667
PSM	QLQDQQAAQILDLER	2454	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=18105	40.049318	3	1767.911838	1767.911526	R	S	798	813
PSM	GQALQGELEAALEAK	2455	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=20366	44.464744	2	1526.792049	1526.794037	R	E	1785	1800
PSM	CESLAEVNTQLR	2456	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=17998	39.841343	2	1401.6556	1401.6553	R	L	110	122
PSM	GPLLTALSAEAVASALHK	2457	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=23099	49.744248	3	1748.986785	1747.983235	R	L	1230	1248
PSM	DEQLLHLSSQLEDSYNQVQSFSK	2458	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=23382	50.301309	3	2696.282468	2694.277304	K	A	2814	2837
PSM	AQLEAHLGQVMESVR	2459	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:35	ms_run[1]:scan=15719	35.75693	3	1682.839916	1682.841004	R	Q	373	388
PSM	AQTQEFQGSEDYETALSGK	2460	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=14237	32.882173	3	2089.937948	2087.928358	K	E	358	377
PSM	VQIGEYTFEKGDYGDAVVYR	2461	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=21982	47.482827	3	2308.101439	2308.101178	K	G	1116	1136
PSM	ITGLYPTLNISDEFSSNVANYQK	2462	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=26338	56.470401	3	2573.264893	2573.264949	R	V	1172	1195
PSM	SHFAIGLALYYPSAR	2463	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=25815	55.247768	3	1664.869760	1664.867477	K	I	1212	1227
PSM	IVYTACSHAAVDALCEK	2464	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=26443	56.726899	3	1906.891457	1906.891719	R	A	1227	1244
PSM	RCPAEIVDTVSALVYDNK	2465	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4	ms_run[1]:scan=28394	61.522015	3	2049.019560	2049.020091	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	2466	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4	ms_run[1]:scan=23693	50.903759	3	2049.019998	2049.020091	R	L	1366	1384
PSM	CPAEIVDTVSALVYDNK	2467	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=28314	61.389947	3	1893.920955	1892.918980	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	2468	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:4	ms_run[1]:scan=27203	58.829072	3	1892.908198	1892.918980	R	L	1367	1384
PSM	VGILCIMSDR	2469	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=19211	42.158747	2	1178.578863	1178.578765	K	D	1493	1503
PSM	QVGYENAGTVEFLVDR	2470	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28	ms_run[1]:scan=24163	51.791752	2	1778.8490	1778.8470	K	H	301	317
PSM	LGDLYEEEMR	2471	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	9-UNIMOD:35	ms_run[1]:scan=10453	25.415188	2	1269.553624	1269.554718	R	E	146	156
PSM	QVQSLTCEVDALK	2472	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=21551	46.672122	2	1472.7189	1472.7176	R	G	322	335
PSM	MEEFKDQLPADECNK	2473	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:4	ms_run[1]:scan=10399	25.294874	3	1852.796331	1852.797150	K	L	596	611
PSM	LVNHFVEEFKR	2474	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11278	27.064214	3	1416.752148	1416.751384	R	K	237	248
PSM	ARFEELCSDLFR	2475	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	7-UNIMOD:4	ms_run[1]:scan=17834	39.550897	3	1541.729473	1541.729663	R	S	300	312
PSM	DNSDKTLEANEMLLEK	2476	sp|Q5VU43|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=14337	33.061345	3	1848.871845	1848.877509	R	L	461	477
PSM	SQIHDIVLVGGSTR	2477	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11798	28.090857	3	1480.800107	1480.799791	K	I	329	343
PSM	AILVDLEPGTMDSVR	2478	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=19542	42.883867	3	1614.827830	1614.828708	R	S	63	78
PSM	SGPFGQIFRPDNFVFGQSGAGNNWAK	2479	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=23772	51.049349	3	2797.335641	2797.336097	R	G	78	104
PSM	GVMLAVDAVIAELKK	2480	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=26282	56.325379	3	1555.900991	1555.900751	R	Q	143	158
PSM	CSQVQQDHLNQTDASATK	2481	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8798	22.198871	2	2013.8892	2012.8852	R	S	432	450
PSM	EHALLAYTLGVK	2482	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0		ms_run[1]:scan=15689	35.701518	3	1314.7392	1313.7342	R	Q	135	147
PSM	HLTAENNQER	2483	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=2174	8.7792219	2	1210.580649	1210.569063	R	A	300	310
PSM	IKDEFQFLQAQYHSLK	2484	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=17358	38.658701	4	1994.025610	1994.026162	R	V	29	45
PSM	ASVASEVSTTSSTSKPPTGR	2485	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7443	19.547696	3	1949.970149	1948.970164	K	R	1122	1142
PSM	MMNGGHYTYSENR	2486	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	1-UNIMOD:35	ms_run[1]:scan=5624	15.806154	3	1574.624248	1574.624212	K	V	133	146
PSM	AITIAGVPQSVTECVK	2487	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	14-UNIMOD:4	ms_run[1]:scan=16846	37.744791	2	1671.885878	1671.886557	R	Q	145	161
PSM	DMVGIAQTGSGK	2488	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9371	23.216149	2	1162.561785	1162.565223	R	T	210	222
PSM	AMLDQLMGTSR	2489	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:35	ms_run[1]:scan=13143	30.658758	2	1239.580989	1237.579493	R	D	9	20
PSM	CGESGHLAK	2490	sp|P62633-4|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=4618	13.934913	2	940.4069	940.4067	R	D	57	66
PSM	DLADKETLENMMQR	2491	sp|O14578|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15956	36.17371	3	1693.784657	1692.781106	K	H	735	749
PSM	QGIETPEDQNDLR	2492	sp|Q15637|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9513	23.452929	2	1514.697920	1513.700865	K	K	228	241
PSM	IGAEVYHNLK	2493	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=8094	20.891885	2	1142.605360	1142.608408	R	N	184	194
PSM	SPEEGAETPVYLALLPPDAEGPHGQFVSEK	2494	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=22182	47.888488	3	3165.531191	3163.534976	K	R	243	273
PSM	AIVAIENPADVSVISSR	2495	sp|P08865|RSSA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=18018	39.879161	3	1740.944035	1739.941764	R	N	64	81
PSM	FSPNSSNPIIVSCGWDK	2496	sp|P63244|RACK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	13-UNIMOD:4	ms_run[1]:scan=17706	39.327449	2	1908.893584	1906.888348	R	L	156	173
PSM	IIVDELKQEVISTSSK	2497	sp|P63244|RACK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=16582	37.279788	3	1789.994622	1787.988045	K	A	265	281
PSM	VVDNSALGNSPYHR	2498	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=7828	20.408776	3	1529.743200	1527.743004	R	A	40	54
PSM	CGHTNNLRPK	2499	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1999	8.5031072	3	1179.5642	1178.5612	K	K	115	125
PSM	VLTELLEQER	2500	sp|Q13428|TCOF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=15541	35.433418	2	1228.671523	1228.666317	K	K	1318	1328
PSM	IGEGTYGTVFK	2501	sp|Q00535|CDK5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0		ms_run[1]:scan=13144	30.66026	2	1171.6002	1170.5912	K	A	10	21
PSM	VYENVGLMQQQK	2502	sp|Q06124|PTN11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=11031	26.632361	2	1436.707249	1435.712950	R	S	579	591
PSM	LCASGAGATPDTAIEEIKEK	2503	sp|P53384|NUBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	2-UNIMOD:4	ms_run[1]:scan=12943	30.305812	3	2061.014662	2060.009586	R	M	30	50
PSM	AAADGALPEAAALEQPAELPASVR	2504	sp|P23025|XPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	23.0	1-UNIMOD:1	ms_run[1]:scan=23064	49.683371	3	2360.2082	2359.2012	M	A	2	26
PSM	GPALANGFPSAHEALK	2505	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=12262	28.983767	3	1580.820057	1578.815441	R	S	338	354
PSM	SYAASASAAPAEPR	2506	sp|P20719|HXA5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=6792	18.151737	2	1349.657510	1347.641893	R	Y	72	86
PSM	TTPSYVAFTDTER	2507	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=13864	32.142566	2	1488.701878	1486.693989	R	L	37	50
PSM	IFDYSPLDPTQDFNTQMTK	2508	sp|Q92995|UBP13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=22150	47.830153	3	2263.044669	2260.035800	R	L	371	390
PSM	DGQVINETSQHHDDLE	2509	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=9114	22.768294	3	1836.779322	1835.792199	R	-	451	467
PSM	EQQIVIQSSGGLSKDDIENMVK	2510	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0		ms_run[1]:scan=17145	38.278745	3	2419.220473	2417.210805	R	N	542	564
PSM	SHKPPISFPLCANGQVFGLYK	2511	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	23.0	11-UNIMOD:4	ms_run[1]:scan=20892	45.481245	3	2360.197867	2359.214708	K	N	997	1018
PSM	AATASAGAGGIDGKPR	2512	sp|Q02978|M2OM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1	ms_run[2]:scan=7504	19.655	2	1440.7321	1440.7321	M	T	2	18
PSM	ADFEEQLWK	2513	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17417	38.816	2	1164.5451	1164.5451	R	K	995	1004
PSM	AEPTVCSFLTK	2514	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=21185	46.02	2	1293.6275	1293.6275	M	V	2	13
PSM	AFITNIPFDVK	2515	sp|P52272-2|HNRPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21204	46.051	2	1263.6863	1263.6863	R	W	73	84
PSM	AGFAGDDAPR	2516	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6422	17.295	2	975.44101	975.4410	K	A	19	29
PSM	ALDVGSGSGILTACFAR	2517	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:4	ms_run[2]:scan=20028	43.819	3	1693.8458	1693.8458	K	M	82	99
PSM	ALEPLEGLETMR	2518	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19736	43.253	2	1357.6912	1357.6912	R	Q	166	178
PSM	ALIVVPYAEGVIPDEAK	2519	sp|Q05519-2|SRS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22023	47.587	2	1782.9768	1782.9768	R	A	104	121
PSM	ALSTVTQEKLELSR	2520	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11490	27.454	3	1573.8675	1573.8675	K	A	3058	3072
PSM	ALVQNDTLLQVK	2521	sp|Q92522|H1X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14711	33.744	2	1340.7664	1340.7664	K	G	95	107
PSM	ALYALQDIVSR	2522	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19153	41.998	2	1247.6874	1247.6874	R	H	1422	1433
PSM	AMGIMNSFVNDIFER	2523	sp|Q99880|H2B1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35	ms_run[2]:scan=25712	54.999	2	1758.8069	1758.8069	K	I	59	74
PSM	AMGIMNSFVNDIFER	2524	sp|Q99880|H2B1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26894	57.933	2	1742.812	1742.8120	K	I	59	74
PSM	APCAGPSREEELAAVR	2525	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=9193	22.903	3	1711.8312	1711.8312	R	E	56	72
PSM	AQLEEEAAAAEERPLVFLCSGCR	2526	sp|Q9NYP9|MS18A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	19-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=21348	46.308	3	2605.2265	2605.2265	R	R	67	90
PSM	ASANIGCNHTGVVGEGSEGLNDNLLEILQK	2527	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:4	ms_run[2]:scan=22131	47.796	3	3108.5146	3108.5146	R	E	427	457
PSM	ASMAGASSSK	2528	sp|Q13428-2|TCOF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2184	8.7983	2	895.40693	895.4069	K	E	958	968
PSM	ATELQEQLSSEK	2529	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9948	24.35	2	1361.6674	1361.6674	R	M	3139	3151
PSM	ATLLLESRPDLLK	2530	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16642	37.388	3	1467.8661	1467.8661	K	V	785	798
PSM	AVFPSIVGRPR	2531	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12476	29.359	3	1197.6982	1197.6982	R	H	29	40
PSM	AVFVDLEPTVIDEVR	2532	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22627	48.87	3	1700.8985	1700.8985	R	T	65	80
PSM	AVSEEQQPALK	2533	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5908	16.335	2	1198.6194	1198.6194	K	G	164	175
PSM	CADFGMAADK	2534	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=9148	22.824	2	1084.4318	1084.4318	R	N	90	100
PSM	CGESGHLAK	2535	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=2063	8.5987	2	957.43381	957.4338	R	D	50	59
PSM	CGYPGHLTFECR	2536	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=11532	27.527	2	1495.6337	1495.6337	K	N	18	30
PSM	CLGPPTTPGPYR	2537	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=10935	26.426	2	1314.6391	1314.6391	R	S	44	56
PSM	CLHPLANETFVAK	2538	sp|Q13642-1|FHL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=11229	26.976	3	1498.7602	1498.7602	K	D	71	84
PSM	CNEAGDIEAK	2539	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=4668	14.034	2	1105.471	1105.4710	R	S	159	169
PSM	CPAEIVDTVSALVYDNK	2540	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=24793	53.042	3	1892.919	1892.9190	R	L	1367	1384
PSM	CTGGEVGATSALAPK	2541	sp|P30050|RL12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:4	ms_run[2]:scan=8968	22.512	2	1417.6871	1417.6871	R	I	17	32
PSM	DAEDAMDAMDGAVLDGR	2542	sp|Q01130-2|SRSF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20128	43.992	3	1750.7138	1750.7138	R	E	67	84
PSM	DCDHADEQK	2543	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4	ms_run[2]:scan=1822	8.2343	3	1116.4142	1116.4142	R	C	103	112
PSM	DEDDADYKPK	2544	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=3975	12.466	2	1194.5041	1194.5041	R	K	141	151
PSM	DESETEKEK	2545	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1853	8.2771	2	1093.4775	1093.4775	R	I	502	511
PSM	DGFGGLAAAR	2546	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11969	28.38	2	933.46683	933.4668	R	G	328	338
PSM	DGQVINETSQHHDDLE	2547	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8180	21.042	2	1835.7922	1835.7922	R	-	451	467
PSM	DHVDELEPER	2548	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6716	17.965	2	1237.5575	1237.5575	K	H	576	586
PSM	DIPGLTDTTVPR	2549	sp|P62753|RS6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15145	34.661	2	1283.6721	1283.6721	K	R	120	132
PSM	DKLEPQSAELLAQEER	2550	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12973	30.359	3	1854.9323	1854.9323	K	F	531	547
PSM	DLYDKLQFTSLEIPR	2551	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21193	46.032	3	1836.9622	1836.9622	R	R	1503	1518
PSM	DLYDKLQFTSLEIPR	2552	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23436	50.401	3	1836.9622	1836.9622	R	R	1503	1518
PSM	DMEVLSQEIVR	2553	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17524	39.015	2	1317.6599	1317.6599	K	L	812	823
PSM	DNIQGITKPAIR	2554	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9452	23.354	3	1324.7463	1324.7463	R	R	25	37
PSM	DSSTCPGDYVLSVSENSR	2555	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4	ms_run[2]:scan=16491	37.12	2	1971.848	1971.8480	R	V	40	58
PSM	DTLKETNEELR	2556	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6675	17.816	3	1346.6678	1346.6678	R	C	379	390
PSM	DVNFEFPEFQL	2557	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=28046	60.937	2	1383.6347	1383.6347	K	-	184	195
PSM	DYQDNKADVILK	2558	sp|P47813|IF1AX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9796	24.042	3	1420.7198	1420.7198	R	Y	83	95
PSM	EAADAELGQLR	2559	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11155	26.848	2	1171.5833	1171.5833	K	A	1018	1029
PSM	EAEVEDMASR	2560	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7282	19.169	2	1135.4816	1135.4816	R	I	1846	1856
PSM	EAIHDMNFSNEDMIR	2561	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14441	33.241	3	1820.7822	1820.7822	K	E	143	158
PSM	EALLSSAVDHGSDEVK	2562	sp|P78371|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11285	27.074	3	1655.8002	1655.8002	R	F	139	155
PSM	ECMAGTSGSEEVK	2563	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4	ms_run[2]:scan=5325	15.234	2	1383.5646	1383.5646	K	V	1104	1117
PSM	EEAENTLQSFRQDVDNASLAR	2564	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18559	40.91	3	2392.1255	2392.1255	R	L	197	218
PSM	EEAISNMVVALK	2565	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17809	39.507	2	1302.6853	1302.6853	R	E	568	580
PSM	EFFEIMPNYAK	2566	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20496	44.774	2	1387.6482	1387.6482	R	N	328	339
PSM	EFLAHAPTK	2567	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6584	17.565	2	1012.5342	1012.5342	R	G	82	91
PSM	EGANKEVLGILVSYR	2568	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18992	41.7	3	1646.8992	1646.8992	K	V	309	324
PSM	EGESEDLASR	2569	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4977	14.612	2	1091.4731	1091.4731	K	L	248	258
PSM	EGMNIVEAMER	2570	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17525	39.016	2	1277.5744	1277.5744	K	F	134	145
PSM	EGPYDVVVLPGGNLGAQNLSESAAVK	2571	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21423	46.444	3	2583.318	2583.3180	K	E	64	90
PSM	EHNSILETALAK	2572	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12762	29.927	3	1324.6987	1324.6987	R	R	1133	1145
PSM	EIHGAPSNFSSSHLESK	2573	sp|Q5VT06|CE350_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7944	20.628	4	1825.8595	1825.8595	R	H	133	150
PSM	EIKDILIQYDR	2574	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15973	36.203	2	1404.7613	1404.7613	K	T	107	118
PSM	EILKEQENR	2575	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4026	12.624	2	1157.6041	1157.6041	K	K	90	99
PSM	EISELNETFLSDSEKEK	2576	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15280	34.969	3	1996.9477	1996.9477	K	L	436	453
PSM	EKAQDLALSLAQTK	2577	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13401	31.144	2	1514.8304	1514.8304	R	A	2171	2185
PSM	EKPAWLQAELEQSHPR	2578	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13332	31.021	3	1917.9697	1917.9697	R	L	2866	2882
PSM	EKTQHESELEQLR	2579	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6508	17.442	3	1625.8009	1625.8009	R	I	508	521
PSM	ELPPGIGDMVELMGVQDQHMDER	2580	sp|Q96N16|JKIP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=25275	53.983	3	2595.1767	2595.1767	R	D	263	286
PSM	ENIVSITQQQNEELATQLQQALTER	2581	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26507	56.932	3	2883.4574	2883.4574	R	A	374	399
PSM	EPEPFGASAAGLEQPGAR	2582	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14537	33.415	3	1782.8537	1782.8537	K	E	922	940
PSM	EQEYQAQVEEMR	2583	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10828	26.24	2	1538.6671	1538.6671	K	L	554	566
PSM	EQGIQDPIKGGDVR	2584	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9100	22.742	3	1510.774	1510.7740	K	D	864	878
PSM	EQIVPKPEEEVAQK	2585	sp|P18621-3|RL17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8443	21.542	3	1622.8516	1622.8516	K	K	154	168
PSM	ERVEELEHR	2586	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4309	13.242	3	1195.5945	1195.5945	K	C	824	833
PSM	ESQWQMEQEFFK	2587	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20508	44.795	2	1615.6977	1615.6977	K	G	156	168
PSM	ETAENYLGHTAK	2588	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7322	19.258	2	1332.631	1332.6310	K	N	176	188
PSM	ETVVISPPCTGSSEHWKPELEEK	2589	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=13977	32.423	4	2638.2585	2638.2585	K	I	1148	1171
PSM	FAEAFEAIPR	2590	sp|P50990|TCPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16213	36.627	2	1149.5819	1149.5819	K	A	441	451
PSM	FATHAAALSVR	2591	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8239	21.148	3	1142.6196	1142.6196	R	N	366	377
PSM	FEELCSDLFR	2592	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4	ms_run[2]:scan=19244	42.251	2	1314.5914	1314.5914	R	S	302	312
PSM	FLEQQNQVLQTK	2593	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11167	26.869	2	1474.778	1474.7780	R	W	200	212
PSM	FPGQLNADLRK	2594	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10341	25.151	3	1257.683	1257.6830	R	L	242	253
PSM	FPGQLNADLRK	2595	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10814	26.217	3	1257.683	1257.6830	R	L	242	253
PSM	FQAQSLGTTYIYDIPEMFR	2596	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26790	57.665	2	2279.0933	2279.0933	R	Q	1588	1607
PSM	FSSSSGYGGGSSR	2597	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5076	14.816	2	1234.5214	1234.5214	R	V	47	60
PSM	FTTTLNDFNLVAMK	2598	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:35	ms_run[2]:scan=19520	42.846	2	1629.8072	1629.8072	R	Y	3486	3500
PSM	FVGQDVEGER	2599	sp|P17812|PYRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8090	20.883	2	1134.5306	1134.5306	K	M	499	509
PSM	FVIGGPQGDAGLTGR	2600	sp|P31153-2|METK2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14619	33.557	2	1443.747	1443.7470	R	K	187	202
PSM	FVNVVPTFGK	2601	sp|P62861|RS30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16800	37.665	2	1106.6124	1106.6124	R	K	42	52
PSM	GEASSSNPATPIK	2602	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5212	15.043	2	1257.6201	1257.6201	K	I	1387	1400
PSM	GGAEQFMEETER	2603	sp|Q99832|TCPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12295	29.038	2	1382.5772	1382.5772	R	S	376	388
PSM	GGSWVVIDSSINPR	2604	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17724	39.357	2	1485.7576	1485.7576	R	H	2090	2104
PSM	GHVELSEAR	2605	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4218	13.023	2	996.49886	996.4989	R	L	28	37
PSM	GIFTISDHPAEQR	2606	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12182	28.841	2	1469.7263	1469.7263	R	G	196	209
PSM	GIIWGEDTLMEYLENPKK	2607	sp|P99999|CYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=25688	54.943	3	2135.0609	2135.0609	K	Y	57	75
PSM	GIYAYGFEKPSAIQQR	2608	sp|P60842|IF4A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13615	31.615	3	1826.9315	1826.9315	R	A	46	62
PSM	GMKDDDYDDQLC	2609	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:4	ms_run[2]:scan=9973	24.394	2	1473.5388	1473.5388	K	-	398	410
PSM	GQDMETEAHQNKLEEMINELAVAMTAVK	2610	sp|Q15363|TMED2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=27750	60.422	4	3129.4781	3129.4781	K	H	118	146
PSM	GTLEPEYFNSVCR	2611	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:4	ms_run[2]:scan=15061	34.509	3	1570.7086	1570.7086	K	L	1338	1351
PSM	GVTHNIALLR	2612	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10116	24.67	2	1092.6404	1092.6404	R	E	477	487
PSM	HEEKVPCHVCGK	2613	sp|P56270-2|MAZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=2449	9.261	3	1478.6759	1478.6759	R	M	388	400
PSM	HFELGGDK	2614	sp|P83881|RL36A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6188	16.878	2	901.42938	901.4294	K	K	90	98
PSM	HQLTEVGLLDNPELR	2615	sp|Q8NEZ5|FBX22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16084	36.403	3	1732.9108	1732.9108	R	V	204	219
PSM	HSSTPNSSEFSR	2616	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4758	14.209	3	1334.5851	1334.5851	K	K	143	155
PSM	HVINFDLPSDIEEYVHR	2617	sp|O00571-2|DDX3X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21784	47.091	4	2082.0171	2082.0171	K	I	496	513
PSM	HVPGGGNVQIQNK	2618	sp|P27816|MAP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4829	14.332	3	1346.7055	1346.7055	K	K	1016	1029
PSM	HYFIEVNSR	2619	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10129	24.692	2	1163.5724	1163.5724	K	L	320	329
PSM	IAGYVTHLMK	2620	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11007	26.587	2	1131.6111	1131.6111	K	R	50	60
PSM	IESLSSQLSNLQK	2621	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15457	35.286	2	1445.7726	1445.7726	R	E	300	313
PSM	IFHELTQTDK	2622	sp|P11586|C1TC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7664	19.949	3	1230.6245	1230.6245	R	A	464	474
PSM	IIGAGKPWHK	2623	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5590	15.748	3	1105.6396	1105.6396	K	N	132	142
PSM	IITLTGPTNAIFK	2624	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19908	43.612	2	1387.8075	1387.8075	R	A	58	71
PSM	IKDFLQGSSCIAGIYNETTK	2625	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:4	ms_run[2]:scan=18911	41.555	3	2244.1096	2244.1096	R	Q	2250	2270
PSM	IKFEMEQNLR	2626	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:35	ms_run[2]:scan=8697	22.028	3	1322.6653	1322.6653	R	Q	241	251
PSM	ILDTWQEEGIENSQEILK	2627	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20591	44.937	3	2144.0637	2144.0637	R	A	310	328
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	2628	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	32-UNIMOD:4	ms_run[2]:scan=25835	55.295	3	4030.8855	4030.8855	K	F	1448	1484
PSM	INVYYNEATGGK	2629	sp|P68371|TBB4B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10667	25.84	2	1327.6408	1327.6408	R	Y	47	59
PSM	IPEQTYITLK	2630	sp|Q5SW79|CE170_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14049	32.556	2	1204.6703	1204.6703	R	L	73	83
PSM	IQSQFTDAQK	2631	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6595	17.584	2	1164.5775	1164.5775	K	H	608	618
PSM	IQTHIVQQENHLLKDELEK	2632	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11904	28.269	3	2314.2281	2314.2281	K	M	1667	1686
PSM	ISLLLDPGSFVESDMFVEHR	2633	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26084	55.846	3	2290.1304	2290.1304	R	C	70	90
PSM	ITGLYPTLNISDEFSSNVANYQK	2634	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=28588	61.852	3	2573.2649	2573.2649	R	V	1172	1195
PSM	IYEDGDDDMKR	2635	sp|Q9HB71|CYBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5451	15.474	3	1355.5663	1355.5663	K	T	198	209
PSM	KADIDLTK	2636	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5001	14.671	2	902.5073	902.5073	R	R	47	55
PSM	KDDEENYLDLFSHK	2637	sp|Q07666|KHDR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16945	37.923	3	1751.8002	1751.8002	K	N	139	153
PSM	KDSETGENIR	2638	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2513	9.3737	3	1147.5469	1147.5469	R	Q	625	635
PSM	KFGDPVVQSDMK	2639	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9235	22.977	3	1349.6649	1349.6649	R	H	77	89
PSM	KFSDAIQSK	2640	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5345	15.269	2	1022.5397	1022.5397	R	E	2219	2228
PSM	KGDIVDIK	2641	sp|P46778|RL21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6371	17.202	2	886.51238	886.5124	K	G	36	44
PSM	KGQGGAGAGDDEEED	2642	sp|P46781|RS9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2374	9.1237	2	1433.5543	1433.5543	K	-	180	195
PSM	KGTHFVQLCCQR	2643	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6485	17.405	3	1532.734	1532.7340	K	N	383	395
PSM	KICANDAIPK	2644	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=6139	16.796	3	1128.5961	1128.5961	R	T	160	170
PSM	KIQVLQQQADDAEER	2645	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8669	21.982	3	1769.8908	1769.8908	R	A	13	28
PSM	KPESNAVTK	2646	sp|P27816|MAP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=1892	8.3373	2	972.52401	972.5240	R	T	968	977
PSM	KVTQLDLDGPK	2647	sp|Q13442|HAP28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8637	21.928	2	1212.6714	1212.6714	K	E	95	106
PSM	LADKVNSSWQR	2648	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7390	19.431	3	1302.668	1302.6680	K	K	122	133
PSM	LALVTGGEIASTFDHPELVK	2649	sp|P78371|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21153	45.962	3	2096.1154	2096.1154	R	L	323	343
PSM	LAQALHEMR	2650	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6244	16.976	2	1067.5546	1067.5546	K	E	242	251
PSM	LAQDKEEMK	2651	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2572	9.4689	2	1090.5329	1090.5329	R	V	871	880
PSM	LASTEQTEIMK	2652	sp|Q96SN8-2|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8570	21.82	2	1249.6224	1249.6224	R	D	695	706
PSM	LAVNMVPFPR	2653	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:35	ms_run[2]:scan=15235	34.877	2	1158.6219	1158.6220	K	L	253	263
PSM	LAVNMVPFPR	2654	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:35	ms_run[2]:scan=18493	40.789	2	1158.6219	1158.6220	K	L	253	263
PSM	LESASTSSLEDR	2655	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7517	19.676	2	1293.6048	1293.6048	K	V	392	404
PSM	LGDLYEEEMR	2656	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:35	ms_run[2]:scan=10390	25.273	2	1269.5547	1269.5547	R	E	146	156
PSM	LGGVLPDSTSK	2657	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9394	23.256	2	1072.5764	1072.5764	R	K	3317	3328
PSM	LILAEAVMEGRPTPDK	2658	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16104	36.441	3	1738.9288	1738.9288	K	T	989	1005
PSM	LKHYGPGWVSMANAGK	2659	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10723	26.035	3	1714.8613	1714.8613	K	D	130	146
PSM	LKNEIPNSHILDQYR	2660	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12721	29.857	3	1838.9639	1838.9639	R	N	210	225
PSM	LLELQELVLR	2661	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23578	50.688	2	1224.7442	1224.7442	K	L	882	892
PSM	LLETCSIALVGK	2662	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4	ms_run[2]:scan=15629	35.598	2	1302.7217	1302.7217	R	Y	295	307
PSM	LLGPCMDIMK	2663	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	5-UNIMOD:4	ms_run[2]:scan=17266	38.5	2	1176.5705	1176.5705	R	R	370	380
PSM	LLQDKNEQAVQSAQTIQQLEDQLQQK	2664	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=20218	44.154	3	3023.5524	3023.5524	K	S	410	436
PSM	LLWEQLQGLESSK	2665	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21850	47.213	2	1529.809	1529.8090	R	Q	205	218
PSM	LNQDQLDAVSK	2666	sp|Q14444-2|CAPR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9038	22.635	2	1229.6252	1229.6252	R	Y	88	99
PSM	LNSSENGEDR	2667	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2335	9.0602	2	1119.4792	1119.4792	R	H	54	64
PSM	LPAAGVGDMVMATVK	2668	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=11168	26.87	2	1490.7473	1490.7473	R	K	52	67
PSM	LPDEKVELFSK	2669	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13062	30.51	3	1303.7024	1303.7024	R	M	389	400
PSM	LQFTSLEIPRR	2670	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15471	35.31	2	1358.767	1358.7670	K	N	1508	1519
PSM	LTMQVSSLQR	2671	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11946	28.34	2	1161.6176	1161.6176	R	E	66	76
PSM	LVGDRNEWHGR	2672	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5394	15.352	3	1337.6589	1337.6589	R	F	892	903
PSM	LVNHFVEEFK	2673	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12899	30.23	3	1260.6503	1260.6503	R	R	237	247
PSM	LVQAFQFTDK	2674	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15187	34.757	2	1195.6237	1195.6237	R	H	159	169
PSM	MGESDDSILR	2675	sp|P63220|RS21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10280	24.988	2	1121.5023	1121.5023	R	L	62	72
PSM	MKETAENYLGHTAK	2676	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:35	ms_run[2]:scan=5676	15.898	3	1607.7614	1607.7614	K	N	174	188
PSM	MMNGGHYTYSENRVEK	2677	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:35	ms_run[2]:scan=5213	15.044	3	1930.8302	1930.8302	K	D	133	149
PSM	MQAQLLELR	2678	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15477	35.319	2	1100.6012	1100.6012	R	T	13	22
PSM	MREDYDSVEQDGDEPGPQR	2679	sp|Q9Y5S9-2|RBM8A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8787	22.18	3	2221.9182	2221.9182	R	S	49	68
PSM	MTHLQNQEK	2680	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2329	9.0496	2	1127.5393	1127.5393	R	L	2530	2539
PSM	MVNHFIAEFK	2681	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13637	31.663	3	1234.6169	1234.6169	R	R	237	247
PSM	NGLTHQLGGLSQGSR	2682	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9252	23.006	3	1523.7805	1523.7805	R	N	54	69
PSM	NHLLPDIVTCVQSSR	2683	sp|Q9BSD7|NTPCR_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:4	ms_run[2]:scan=16455	37.055	3	1737.8832	1737.8832	R	K	175	190
PSM	NHPGLLLMDTTFR	2684	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17928	39.719	3	1513.7711	1513.7711	R	D	559	572
PSM	NHTLALTETGSVFAFGENK	2685	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18394	40.595	3	2035.0011	2035.0011	R	M	212	231
PSM	NIEDVIAQGIGK	2686	sp|P05387|RLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19809	43.425	2	1255.6772	1255.6772	K	L	50	62
PSM	NKEVEDLSATLLCK	2687	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	13-UNIMOD:4	ms_run[2]:scan=15488	35.338	3	1618.8236	1618.8236	R	L	754	768
PSM	NMSVHLSPCFR	2688	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	9-UNIMOD:4	ms_run[2]:scan=12497	29.41	3	1346.6224	1346.6224	K	D	108	119
PSM	NQCTQVVQER	2689	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=5071	14.806	2	1260.5881	1260.5881	K	E	1803	1813
PSM	NSADYSSESK	2690	sp|Q04727-4|TLE4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2662	9.6322	2	1086.4465	1086.4465	R	K	196	206
PSM	NSIHQAALASFK	2691	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9605	23.614	3	1285.6779	1285.6779	K	A	355	367
PSM	NSMPASSFQQQK	2692	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:35	ms_run[2]:scan=5114	14.881	2	1367.614	1367.6140	R	L	175	187
PSM	NTLTQTTENLR	2693	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10025	24.486	2	1289.6575	1289.6575	K	R	1414	1425
PSM	NTVETEREESK	2694	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2257	8.9247	2	1320.6157	1320.6157	R	I	313	324
PSM	PQYQTWEEFSR	2695	sp|P49458|SRP09_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16035	36.315	2	1469.6575	1469.6575	M	A	2	13
PSM	PSETPQAEVGPTGCPHR	2696	sp|P0DN79|CBSL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	14-UNIMOD:4	ms_run[2]:scan=6302	17.078	3	1818.8319	1818.8319	M	S	2	19
PSM	QFQGHTDGASCIDISNDGTK	2697	sp|Q04724|TLE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:4	ms_run[2]:scan=9439	23.333	3	2149.9335	2149.9335	R	L	611	631
PSM	QIAASSQDSVGR	2698	sp|P54886-2|P5CS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4864	14.394	2	1217.6	1217.6000	R	V	440	452
PSM	QILETMQNDR	2699	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9849	24.162	2	1246.5976	1246.5976	R	T	523	533
PSM	QIVESCGNFK	2700	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=8334	21.312	2	1180.5547	1180.5547	K	V	501	511
PSM	QLFLITNSPFSFVDK	2701	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26434	56.706	2	1754.9243	1754.9243	K	G	300	315
PSM	QNQLILEISK	2702	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15508	35.373	2	1184.6765	1184.6765	K	L	692	702
PSM	QQFEGYGLEIPDILNASNLK	2703	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26017	55.707	3	2248.1376	2248.1376	R	T	122	142
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	2704	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13444	31.216	4	2605.169	2605.1690	R	G	244	269
PSM	QRLEHLQQAVAR	2705	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5801	16.156	3	1447.8008	1447.8008	R	L	2270	2282
PSM	QSLGHPPPEPGPDR	2706	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5996	16.532	3	1482.7215	1482.7215	R	V	57	71
PSM	QVLEHEMEIQGLLQSVSTR	2707	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21746	47.026	3	2196.1209	2196.1209	K	E	800	819
PSM	QVLIASHLPSYELR	2708	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15863	36.007	2	1624.8937	1624.8937	R	H	1083	1097
PSM	QWYESHYALPLGR	2709	sp|P62241|RS8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16472	37.089	3	1618.7892	1618.7892	R	K	111	124
PSM	RCPAEIVDTVSALVYDNK	2710	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4	ms_run[2]:scan=24098	51.673	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RMGESDDSILR	2711	sp|P63220|RS21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8176	21.036	3	1277.6034	1277.6034	R	L	61	72
PSM	RNFQEEQINTR	2712	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6298	17.069	3	1433.7011	1433.7011	K	D	756	767
PSM	RQILETMQNDR	2713	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8238	21.147	3	1402.6987	1402.6987	R	T	522	533
PSM	RTIAPCQK	2714	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	6-UNIMOD:4	ms_run[2]:scan=2373	9.1225	2	972.51748	972.5175	R	A	361	369
PSM	SGGSSCSQTPSR	2715	sp|Q13541|4EBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	1-UNIMOD:1,6-UNIMOD:4	ms_run[2]:scan=3343	11.141	2	1251.515	1251.5150	M	A	2	14
PSM	SGVNSELVKR	2716	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5259	15.124	2	1087.5986	1087.5986	R	I	169	179
PSM	SINPDEAVAYGAAVQAAILMGDK	2717	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=27231	58.912	3	2303.1467	2303.1467	K	S	362	385
PSM	SIYGERFPDENFK	2718	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13417	31.17	2	1600.7522	1600.7522	K	L	117	130
PSM	SLEAEILQLQEELASSER	2719	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=27554	59.942	3	2044.0324	2044.0324	K	A	1684	1702
PSM	SLEEIYLFSLPIK	2720	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=26506	56.93	2	1550.8596	1550.8596	K	E	77	90
PSM	SLLENQSLSSSCESLK	2721	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	12-UNIMOD:4	ms_run[2]:scan=13386	31.115	2	1780.8513	1780.8513	R	L	1563	1579
PSM	SLTASQDPEHSLTEYIHHLEVIQQR	2722	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21493	46.567	5	2930.4522	2930.4522	R	L	3292	3317
PSM	SLYASSPGGVYATR	2723	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11304	27.109	3	1427.7045	1427.7045	R	S	51	65
PSM	SNLNSLDEQEGVK	2724	sp|O75223|GGCT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9140	22.812	2	1431.6842	1431.6842	K	S	89	102
PSM	SPISQLDCLNR	2725	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	8-UNIMOD:4	ms_run[2]:scan=14308	33.014	2	1301.6398	1301.6398	K	D	521	532
PSM	SQLVAQDDSQR	2726	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5007	14.682	2	1245.5949	1245.5949	K	L	1017	1028
PSM	SRLGDLYEEEMR	2727	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14007	32.482	2	1496.6929	1496.6929	K	E	144	156
PSM	SSSSQTQPLK	2728	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2902	10.199	2	1061.5353	1061.5353	R	V	2998	3008
PSM	STESLQANVQR	2729	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6489	17.411	2	1231.6157	1231.6157	K	L	106	117
PSM	STSSHGTDEMESSSYR	2730	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5275	15.155	3	1759.6955	1759.6955	R	D	147	163
PSM	SVYPVASPNECNQMCLSTLMK	2731	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	11-UNIMOD:4,14-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=19987	43.749	3	2444.0844	2444.0844	R	C	302	323
PSM	SYCNDQSTGDIK	2732	sp|P00492|HPRT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=5531	15.645	2	1386.5722	1386.5722	K	V	104	116
PSM	SYLNMDAIMEAIKK	2733	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23098	49.743	3	1625.8157	1625.8157	K	T	120	134
PSM	TALHEKEETLR	2734	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=4035	12.648	4	1325.6939	1325.6939	K	L	1064	1075
PSM	TAVCDIPPR	2735	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4	ms_run[2]:scan=7744	20.168	2	1027.5121	1027.5121	K	G	351	360
PSM	TGPNLHGLFGR	2736	sp|P99999|CYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=14135	32.703	3	1167.6149	1167.6149	K	K	29	40
PSM	TGTITTFEHAHNMR	2737	sp|P13639|EF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8393	21.413	4	1614.7573	1614.7573	K	V	482	496
PSM	TILSNQTVDIPENVDITLK	2738	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21048	45.775	2	2112.1314	2112.1314	K	G	3	22
PSM	TKTENSGEALAK	2739	sp|Q9P016|THYN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=2560	9.4491	3	1247.6357	1247.6357	R	V	23	35
PSM	TLCGTPNYIAPEVLSK	2740	sp|P53350|PLK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4	ms_run[2]:scan=16765	37.604	2	1761.8971	1761.8971	K	K	210	226
PSM	TLHAQIIEK	2741	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=6385	17.228	3	1051.6026	1051.6026	K	D	750	759
PSM	TLNDELEIIEGMK	2742	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=23012	49.586	2	1503.7491	1503.7491	K	F	206	219
PSM	TSMTEEYRVPDGMVGLIIGR	2743	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22972	49.517	3	2223.1028	2223.1028	R	G	143	163
PSM	TTAAVEETIGR	2744	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8583	21.841	2	1146.5881	1146.5881	K	H	1741	1752
PSM	TVIPGMPTVIPPGLTR	2745	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=22065	47.675	2	1647.9382	1647.9382	K	E	31	47
PSM	TYHEVVDEIYFK	2746	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=15116	34.608	3	1541.7402	1541.7402	K	V	81	93
PSM	VADSDYEAICK	2747	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	10-UNIMOD:4	ms_run[2]:scan=9119	22.775	2	1269.5547	1269.5547	R	V	175	186
PSM	VAQLQEEVEK	2748	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8078	20.86	2	1171.6085	1171.6085	K	Q	1578	1588
PSM	VASSGLQSVVHR	2749	sp|P48730|KC1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=8013	20.748	3	1238.6731	1238.6731	R	-	404	416
PSM	VCDTLQGENK	2750	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4	ms_run[2]:scan=4998	14.663	2	1162.5288	1162.5288	K	E	2283	2293
PSM	VCTLAIIDPGDSDIIR	2751	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	2-UNIMOD:4	ms_run[2]:scan=20899	45.492	3	1756.9029	1756.9029	R	S	91	107
PSM	VDCTAHSDVCSAQGVR	2752	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5478	15.537	3	1760.757	1760.7570	K	G	119	135
PSM	VDWQENDFSK	2753	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=12719	29.854	2	1266.5517	1266.5517	R	R	267	277
PSM	VDWQENDFSKR	2754	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10798	26.192	3	1422.6528	1422.6528	R	I	267	278
PSM	VEAQVYILSK	2755	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13429	31.191	2	1148.6441	1148.6441	K	E	352	362
PSM	VFDKDGNGYISAAELR	2756	sp|P0DP25|CALM3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13652	31.694	3	1753.8635	1753.8635	R	H	92	108
PSM	VFEVMLATDR	2757	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16891	37.825	2	1179.5958	1179.5958	K	S	28	38
PSM	VGGFPNFLSNAFVSTAK	2758	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=25084	53.595	2	1754.8992	1754.8992	R	C	154	171
PSM	VIMGEEVEPVGLMTGSGVVGVK	2759	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=21815	47.146	3	2186.1327	2186.1327	R	V	1241	1263
PSM	VKEPSVQEATSTSDILK	2760	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11960	28.363	3	1830.9575	1830.9575	K	V	230	247
PSM	VLDCGAAPGAWSQVAVQK	2761	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0	4-UNIMOD:4	ms_run[2]:scan=15426	35.231	2	1855.9251	1855.9251	R	V	76	94
PSM	VLELDPALAPVVSR	2762	sp|O00170|AIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=19887	43.576	2	1477.8504	1477.8504	K	E	291	305
PSM	VQELETSLAELR	2763	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=17122	38.238	3	1386.7355	1386.7355	R	N	432	444
PSM	VQIGEYTFEKGDYGDAVVYR	2764	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=24085	51.648	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VSHYIINSLPNRR	2765	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=9370	23.215	4	1567.8583	1567.8583	R	F	58	71
PSM	VTHTGQVYDDKDYR	2766	sp|O75380|NDUS6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=5261	15.13	4	1695.7853	1695.7853	K	R	39	53
PSM	VVDLQAMLEK	2767	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18957	41.637	2	1144.6162	1144.6162	R	V	2801	2811
PSM	YEELQITAGR	2768	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=11835	28.154	2	1178.5932	1178.5932	K	H	377	387
PSM	YLQGVPEGVR	2769	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=10823	26.233	2	1116.5928	1116.5928	R	D	224	234
PSM	YLYTLVITDK	2770	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=18696	41.152	2	1227.6751	1227.6751	R	E	41	51
PSM	YSTLQGPPGTGK	2771	cov|corona03981|ORF1b_Kazakhstan/26548/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=7861	20.474	2	1204.6088	1204.6088	K	S	1200	1212
PSM	YVVVTGITPTPLGEGK	2772	sp|P11586|C1TC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=16784	37.636	2	1629.8978	1629.8978	K	S	371	387
PSM	YYVTIIDAPGHR	2773	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	22.0		ms_run[2]:scan=13211	30.788	2	1403.7197	1403.7197	K	D	85	97
PSM	CGQEAAELKEK	2774	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=8912	22.388628	2	1244.5686	1244.5702	R	L	321	332
PSM	DSLHQTILTQELEK	2775	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14540	33.418521	3	1654.864518	1653.857366	K	L	1005	1019
PSM	SLCEVQQEVLQLR	2776	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:4	ms_run[1]:scan=19879	43.563783	3	1600.825089	1600.824292	R	S	2626	2639
PSM	QQLEVLEQEAWR	2777	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=24434	52.339015	2	1510.7426	1510.7411	R	L	477	489
PSM	DVDDGLQAAEEVGYPVMIK	2778	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:35	ms_run[1]:scan=20359	44.451792	3	2063.975592	2063.972138	K	A	293	312
PSM	QLTEEDGVHSVIEENIK	2779	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:28	ms_run[1]:scan=18281	40.380143	3	1921.9259	1921.9264	K	C	2277	2294
PSM	EKAELQAQLAALSTK	2780	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14222	32.854563	3	1599.884024	1599.883186	K	L	434	449
PSM	AYENAVGILSR	2781	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13939	32.343429	2	1191.624493	1191.624787	K	R	998	1009
PSM	ELQEVIALTSQELEESR	2782	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=24199	51.863787	3	1972.995262	1972.995316	K	E	1064	1081
PSM	SLPEFQESVEEFPEVTVIEPLDEEARPSHIPAGDCSEHWK	2783	sp|Q8N4C6|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	35-UNIMOD:4	ms_run[1]:scan=22802	49.183414	5	4619.143969	4619.143855	R	T	109	149
PSM	CEAPDANQQLQQAMEER	2784	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=18309	40.436578	3	1999.8364	1999.8359	R	A	356	373
PSM	NQMAEPPPPEPPAGPSEVEQQLQAEAEHLRK	2785	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	3-UNIMOD:35	ms_run[1]:scan=19486	42.786689	4	3419.638765	3419.641583	R	E	444	475
PSM	LTNENMEITSALQSEQHVK	2786	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14258	32.918402	2	2172.049168	2171.052847	K	R	559	578
PSM	LSELKETVELK	2787	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10336	25.13578	2	1288.730442	1287.728583	K	S	591	602
PSM	CCYDHVISTSHK	2788	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=9470	23.384375	3	1488.6116	1488.6121	K	L	952	964
PSM	LKLFAAETLK	2789	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13705	31.793552	2	1132.682367	1132.685596	R	A	1053	1063
PSM	VQIGEYTFEKGDYGDAVVYR	2790	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=21122	45.908619	3	2308.102001	2308.101178	K	G	1116	1136
PSM	SHFAIGLALYYPSAR	2791	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=29895	64.320039	2	1665.872654	1664.867477	K	I	1212	1227
PSM	IVYTACSHAAVDALCEK	2792	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13413	31.164508	2	1907.884442	1906.891719	R	A	1227	1244
PSM	TIGPDMFLGTCR	2793	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=17473	38.929847	2	1383.634632	1382.632257	K	R	1354	1366
PSM	TIGPDMFLGTCR	2794	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=18551	40.897935	2	1382.631604	1382.632257	K	R	1354	1366
PSM	RCPAEIVDTVSALVYDNK	2795	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	2-UNIMOD:4	ms_run[1]:scan=25690	54.948899	3	2050.028443	2049.020091	R	L	1366	1384
PSM	GVITHDVSSAINRPQIGVVR	2796	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=11995	28.422882	3	2118.173713	2117.170535	K	E	1401	1421
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	2797	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=25294	54.027472	3	4029.883816	4027.852775	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	2798	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=28966	62.57391	3	4029.9042	4027.8522	K	F	1448	1484
PSM	VVEIAPAAHLDPQLR	2799	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14311	33.018199	3	1627.905894	1627.904590	K	T	274	289
PSM	QVQSLTCEVDALK	2800	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=15394	35.17433	2	1489.743393	1489.744644	R	G	322	335
PSM	SQVFSTAADGQTQVEIK	2801	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13021	30.440824	3	1807.896056	1807.895208	K	V	469	486
PSM	LETLAAIGGGELESVR	2802	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=19542	42.883867	3	1614.869471	1613.862451	R	I	1094	1110
PSM	CELENQIAQLNK	2803	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	1-UNIMOD:4	ms_run[1]:scan=14231	32.870596	2	1459.713188	1458.713678	K	E	2052	2064
PSM	TGEPCVAELTEENFQR	2804	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4	ms_run[1]:scan=16763	37.601384	3	1878.841702	1878.841792	R	L	254	270
PSM	CEFQDAYVLLSEK	2805	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	22.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=26645	57.277643	2	1583.7183	1583.7172	K	K	237	250
PSM	MVAAVACAQVPK	2806	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4	ms_run[1]:scan=10430	25.367193	2	1243.640315	1243.641699	K	I	425	437
PSM	LQEACKDILLFK	2807	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4	ms_run[1]:scan=15476	35.317027	2	1477.804217	1476.801037	R	N	130	142
PSM	VAPEEHPVLLTEAPLNPK	2808	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14527	33.397086	3	1953.057366	1953.057128	R	A	96	114
PSM	KLEEEIQTLR	2809	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10218	24.848459	2	1257.692006	1257.692866	K	V	331	341
PSM	DVVICPDASLEDAKK	2810	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	5-UNIMOD:4	ms_run[1]:scan=12131	28.729634	3	1658.820866	1658.818537	R	E	49	64
PSM	AYEVLKDEDLR	2811	sp|Q8IXB1|DJC10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=10919	26.397481	3	1349.683483	1349.682696	R	K	83	94
PSM	AGGAAVVITEPEHTK	2812	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=7761	20.207858	2	1479.773777	1478.772908	K	E	78	93
PSM	QISNLQQSISDAEQR	2813	sp|P04264|K2C1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=14046	32.551673	3	1717.852374	1715.843841	K	G	418	433
PSM	SIYGERFPDENFK	2814	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13299	30.957487	3	1600.753328	1600.752172	K	L	117	130
PSM	SIYGERFPDENFK	2815	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=13471	31.269124	2	1601.754202	1600.752172	K	L	117	130
PSM	GPLQSVQVFGR	2816	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15848	35.982687	2	1186.646734	1186.645856	K	K	5	16
PSM	ETEATNAILMEQIK	2817	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=16156	36.52897	2	1590.800022	1589.797073	R	L	1581	1595
PSM	TGEAIVDAALSALR	2818	sp|Q15084|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=25074	53.577202	2	1385.752049	1385.751444	R	Q	119	133
PSM	DATNVGDEGGFAPNILENKEGLELLK	2819	sp|P06733|ENOA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=22869	49.323116	3	2744.377669	2742.371205	K	T	203	229
PSM	YISPDQLADLYK	2820	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=19976	43.728867	2	1424.717997	1424.718747	R	S	270	282
PSM	LDIQDKDGDTPLHEALR	2821	sp|Q86YT6|MIB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=12318	29.077706	4	1935.975218	1934.969770	K	H	692	709
PSM	ENYLGNSLMAPVGR	2822	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	9-UNIMOD:35	ms_run[1]:scan=14282	32.964154	2	1536.743664	1535.740228	R	W	28	42
PSM	KLYDIDVAK	2823	sp|P62750|RL23A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9974	24.39542	2	1063.591698	1063.591361	K	V	115	124
PSM	TDTESELDLISR	2824	sp|P11586|C1TC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15311	35.032364	2	1377.660705	1377.662354	K	L	761	773
PSM	SEIEYYAMLAK	2825	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=18461	40.72002	2	1316.631354	1316.632240	K	T	58	69
PSM	YLYTLVITDKEK	2826	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=15501	35.360678	2	1484.810542	1484.812647	R	A	41	53
PSM	GLDVDSLVIEHIQVNK	2827	sp|P18621|RL17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=20454	44.693	3	1777.957071	1777.957414	K	A	106	122
PSM	LQPFATEADVEEALR	2828	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=21020	45.718024	2	1688.846303	1687.841715	K	L	628	643
PSM	QTLSTPGTIILGTIPVPK	2829	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=23527	50.587634	2	1836.077639	1835.076801	R	G	131	149
PSM	LVQSPNSYFMDVK	2830	sp|Q71UM5|RS27L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	10-UNIMOD:35	ms_run[1]:scan=14771	33.865527	2	1542.740434	1542.738831	R	C	24	37
PSM	DQHDTFFLRDPAEALQLPMDYVQR	2831	sp|Q9Y285|SYFA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=24978	53.397806	4	2904.385708	2904.386478	R	V	272	296
PSM	LSTPAGVQVILR	2832	sp|Q9BQ48|RM34_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=16861	37.772445	2	1252.750227	1252.750322	R	R	70	82
PSM	GASQAGMLAPGTR	2833	sp|Q15417|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:35	ms_run[1]:scan=5550	15.678905	2	1232.590024	1231.597920	K	R	213	226
PSM	QGYENLCCLR	2834	sp|P41223|BUD31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	7-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=12266	28.992009	2	1313.574314	1311.569991	K	C	95	105
PSM	TIGPDMFLGTCR	2835	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=15285	34.981179	2	1384.647190	1382.632257	K	R	1354	1366
PSM	DQGTYEDYVEGLR	2836	sp|P60660|MYL6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=17510	38.990915	2	1545.680882	1543.679067	K	V	82	95
PSM	AGDPLDLVALAEQVQK	2837	sp|Q9BV19|CA050_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=25425	54.380693	3	1666.894362	1665.893751	R	A	50	66
PSM	DGQVINETSQHHDDLE	2838	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	22.0		ms_run[1]:scan=9039	22.636881	3	1836.779322	1835.792199	R	-	451	467
PSM	AALIYTCTVCR	2839	sp|Q9Y5V0|ZN706_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=12375	29.181	2	1326.6424	1326.6424	K	T	35	46
PSM	AALMESQGQQQEER	2840	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6402	17.262	2	1603.726	1603.7260	R	G	986	1000
PSM	AATITATSPGALWGLDR	2841	sp|P31323|KAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20373	44.478	2	1699.8893	1699.8893	R	V	233	250
PSM	AAYFGIYDTAK	2842	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15624	35.588	2	1218.5921	1218.5921	R	G	189	200
PSM	ADDIDIEAMLEAPYKK	2843	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=25107	53.647	2	1862.8972	1862.8972	M	D	2	18
PSM	ADEAYLIGR	2844	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11772	28.029	2	1006.5084	1006.5084	K	G	80	89
PSM	ADLATAPPHVTVVR	2845	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10354	25.18	3	1445.7991	1445.7991	K	-	570	584
PSM	AESSDKLYR	2846	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=7699	20.026	2	1109.5353	1109.5353	M	V	2	11
PSM	AFVDFLSDEIKEER	2847	sp|Q07021|C1QBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21570	46.705	3	1696.8308	1696.8308	K	K	81	95
PSM	AFYGDTLVTGFAR	2848	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20038	43.837	2	1416.7038	1416.7038	K	I	349	362
PSM	AGCECLNESDEHGFDNCLR	2849	sp|O43396|TXNL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,5-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=11612	27.67	3	2281.8787	2281.8787	K	K	133	152
PSM	AGGAAVVITEPEHTK	2850	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7723	20.104	3	1478.7729	1478.7729	K	E	78	93
PSM	AGVPGVAAPGAPAAAPPAK	2851	sp|P53350|PLK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10469	25.449	2	1568.8675	1568.8675	K	E	20	39
PSM	AIEAAPQEPEQK	2852	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6062	16.664	2	1309.6514	1309.6514	R	R	90	102
PSM	AKEAAEQDVEK	2853	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2357	9.0981	3	1216.5935	1216.5935	R	K	199	210
PSM	ALAAAGYDVEK	2854	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9387	23.244	2	1106.5608	1106.5608	K	N	65	76
PSM	ALEQLNGFELAGRPMK	2855	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16665	37.425	2	1772.9243	1772.9243	K	V	307	323
PSM	AMLDELAMETLQEK	2856	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22769	49.125	2	1620.7739	1620.7739	K	S	431	445
PSM	AMQDAEVSK	2857	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:35	ms_run[2]:scan=2285	8.9724	2	993.44371	993.4437	K	S	369	378
PSM	ANGTSALTAQNGK	2858	sp|Q14978|NOLC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4434	13.504	2	1231.6157	1231.6157	K	A	546	559
PSM	AQAAAPASVPAQAPK	2859	sp|P47914|RL29_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6846	18.262	2	1376.7412	1376.7412	K	R	135	150
PSM	AQELGHSQSALASAQR	2860	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6235	16.961	3	1652.823	1652.8230	K	E	1175	1191
PSM	AQFEGIVTDLIR	2861	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22826	49.234	3	1360.7351	1360.7351	R	R	349	361
PSM	ARPAEVGGMQLR	2862	sp|P33316-2|DUT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8447	21.556	3	1283.6768	1283.6768	R	F	16	28
PSM	ASHNNTQIQVVSASNEPLAFASCGTEGFR	2863	sp|P82912-2|RT11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	23-UNIMOD:4	ms_run[2]:scan=18728	41.212	3	3091.4418	3091.4418	K	N	89	118
PSM	ASHNNTQIQVVSASNEPLAFASCGTEGFR	2864	sp|P82912-2|RT11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	23-UNIMOD:4	ms_run[2]:scan=18736	41.227	3	3091.4418	3091.4418	K	N	89	118
PSM	ASPSPTDPVVPAVPIGPPPAGFR	2865	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20203	44.129	3	2225.1845	2225.1845	K	D	520	543
PSM	ATIENLQENQKR	2866	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5842	16.226	2	1442.7478	1442.7478	K	L	1719	1731
PSM	AVDDGVNTFK	2867	sp|P50990|TCPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8958	22.49	2	1064.5138	1064.5138	R	V	391	401
PSM	AVGIWHCGSCMK	2868	sp|P61513|RL37A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=9925	24.309	3	1404.6101	1404.6101	R	T	51	63
PSM	AVPFQNAILNVK	2869	sp|Q9NXU5|ARL15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18839	41.426	2	1312.7503	1312.7503	K	E	70	82
PSM	AVTTLDGHGGQCVTWLQTLPQGR	2870	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	12-UNIMOD:4	ms_run[2]:scan=18349	40.509	3	2494.2387	2494.2387	R	Q	59	82
PSM	CASQSGMTAYGTR	2871	sp|Q99439-2|CNN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=6536	17.488	2	1388.5813	1388.5813	K	R	136	149
PSM	CASQVGMTAPGTR	2872	sp|Q99439-2|CNN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=6878	18.318	2	1334.6071	1334.6071	K	R	176	189
PSM	CGAQDKEHPR	2873	sp|Q96GX9|MTNB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=1810	8.2144	3	1196.5357	1196.5357	R	Y	16	26
PSM	CGESGHLAR	2874	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=2272	8.9498	2	985.43996	985.4400	R	E	154	163
PSM	CMLFSSGTVQLTTTSR	2875	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=18005	39.857	2	1787.8546	1787.8546	K	A	208	224
PSM	CTLCSQPGATIGCEIK	2876	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=12654	29.74	3	1793.811	1793.8110	K	A	246	262
PSM	CVIFEIPGAPDDEAVR	2877	sp|Q96I25|SPF45_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:4	ms_run[2]:scan=21091	45.856	2	1786.856	1786.8560	K	I	339	355
PSM	DAALATALGDKK	2878	sp|P20700|LMNB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9171	22.863	2	1172.6401	1172.6401	K	S	146	158
PSM	DAHSIHGTNPQYLVEK	2879	sp|Q8NAV1|PR38A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8956	22.487	3	1807.8853	1807.8853	K	I	8	24
PSM	DALNLAQMQEQTLQLEQQSK	2880	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21511	46.6	3	2315.1427	2315.1427	K	L	73	93
PSM	DFTVASPAEFVTR	2881	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19757	43.301	2	1438.7092	1438.7092	R	F	99	112
PSM	DGEEAGAYDGPR	2882	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7155	18.913	2	1235.5055	1235.5055	R	T	108	120
PSM	DGKEGAEEIDR	2883	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4112	12.819	3	1217.5524	1217.5524	K	H	243	254
PSM	DHPTAATK	2884	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=1808	8.2117	2	839.41373	839.4137	K	M	435	443
PSM	DLLHPSPEEEK	2885	sp|P42677|RS27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9259	23.021	2	1292.6248	1292.6248	K	R	6	17
PSM	DLSHIGDAVVISCAK	2886	sp|P12004|PCNA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=15283	34.978	3	1583.7977	1583.7977	R	D	150	165
PSM	DLTLELEEPPQGPLPR	2887	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20733	45.191	2	1802.9414	1802.9414	R	G	756	772
PSM	DQQLEALQQEHLDLMK	2888	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	15-UNIMOD:35	ms_run[2]:scan=14742	33.807	3	1953.9466	1953.9466	R	Q	709	725
PSM	DSYVGDEAQSK	2889	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5488	15.557	2	1197.515	1197.5150	K	R	51	62
PSM	DTNFGTNCICR	2890	sp|P41223|BUD31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=10331	25.124	2	1356.5551	1356.5551	R	V	110	121
PSM	DVCTELLPLIKPQGR	2891	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4	ms_run[2]:scan=20528	44.828	3	1737.9447	1737.9447	R	V	120	135
PSM	EAEAELSGELSGLGALPAR	2892	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20068	43.888	3	1868.948	1868.9480	R	R	736	755
PSM	EAPAPPKAEAK	2893	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2924	10.244	2	1107.5924	1107.5924	K	A	8	19
PSM	EAPGPAGGGGGGSR	2894	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2494	9.3401	2	1125.5163	1125.5163	R	W	14	28
PSM	EATNPPVIQEEKPK	2895	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6603	17.598	3	1578.8253	1578.8253	R	K	483	497
PSM	EDLNQVITIK	2896	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15050	34.488	2	1171.6449	1171.6449	R	D	2543	2553
PSM	EFLELTEQSQK	2897	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14214	32.84	2	1350.6667	1350.6667	R	L	227	238
PSM	EGELTVAQGR	2898	sp|Q03252|LMNB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6921	18.409	2	1058.5356	1058.5356	R	V	139	149
PSM	EGQEDQGLTK	2899	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3768	12.025	2	1103.5095	1103.5095	R	D	419	429
PSM	EGSSIPELAHSDAYQTR	2900	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11556	27.57	3	1859.865	1859.8650	K	E	2874	2891
PSM	EILLSNSDPHDIPESK	2901	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11588	27.63	3	1792.8843	1792.8843	K	D	1527	1543
PSM	EITALAPSTMK	2902	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:35	ms_run[2]:scan=8988	22.55	2	1176.606	1176.6060	K	I	316	327
PSM	EITALAPSTMK	2903	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11630	27.703	2	1160.6111	1160.6111	K	I	316	327
PSM	ELGVQAGQTQK	2904	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5419	15.406	2	1157.6041	1157.6041	K	L	225	236
PSM	ELKEQLAELQSGFVK	2905	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18293	40.403	3	1717.9251	1717.9251	R	L	544	559
PSM	EQCCYNCGKPGHLAR	2906	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,4-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4592	13.883	3	1848.7818	1848.7818	R	D	88	103
PSM	EQNLSSQVECLELEK	2907	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:4	ms_run[2]:scan=16331	36.833	2	1804.8513	1804.8513	K	A	2468	2483
PSM	EQNQTSANNMR	2908	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2713	9.7434	2	1291.5575	1291.5575	K	H	289	300
PSM	EQNQTSANNMR	2909	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2723	9.76	2	1291.5575	1291.5575	K	H	289	300
PSM	EQVANSAFVER	2910	sp|P08238|HS90B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9185	22.888	2	1248.6099	1248.6099	K	V	492	503
PSM	ESFLMSPESVR	2911	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15547	35.446	2	1280.6071	1280.6071	R	E	1240	1251
PSM	ESQAKDVIEEYFK	2912	sp|P25398|RS12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18038	39.92	3	1584.7672	1584.7672	K	C	117	130
PSM	ETGVDLTKDNMALQR	2913	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	11-UNIMOD:35	ms_run[2]:scan=11795	28.084	3	1705.8305	1705.8305	R	V	293	308
PSM	ETNLDSLPLVDTHSK	2914	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14116	32.67	3	1667.8366	1667.8366	R	R	425	440
PSM	EVATNSELVQSGK	2915	sp|P02533|K1C14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6973	18.531	2	1360.6834	1360.6834	R	S	316	329
PSM	EVLSDRELHLSWEVGK	2916	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16348	36.866	4	1895.9741	1895.9741	R	P	1079	1095
PSM	FADLSEAANR	2917	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9759	23.953	2	1092.52	1092.5200	K	N	295	305
PSM	FEELNADLFR	2918	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19429	42.673	2	1252.6088	1252.6088	R	G	302	312
PSM	FLEFQYLTGGLVDPEVHGR	2919	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23921	51.32	3	2176.0953	2176.0953	R	I	2726	2745
PSM	FPLTTESAMK	2920	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12493	29.4	2	1123.5583	1123.5583	K	K	79	89
PSM	FSSSGGGGGGGR	2921	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2281	8.9642	2	981.42642	981.4264	R	F	35	47
PSM	FVVMVTPEDLK	2922	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18919	41.57	2	1276.6737	1276.6737	R	A	153	164
PSM	GCYIGQELTAR	2923	sp|Q5T440|CAF17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=12280	29.014	2	1266.6027	1266.6027	K	T	258	269
PSM	GFVDDIIQPSSTR	2924	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17003	38.023	2	1433.7151	1433.7151	R	A	500	513
PSM	GGDGPSHESEDFPRPLVTLPGR	2925	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14892	34.089	4	2319.1244	2319.1244	R	Q	534	556
PSM	GKDSLYAQGR	2926	sp|Q969Q0|RL36L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4204	12.993	2	1093.5516	1093.5516	K	R	29	39
PSM	GMFTVSDHTPEQR	2927	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10007	24.453	3	1503.6776	1503.6776	R	G	183	196
PSM	GNKPWISLPR	2928	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13276	30.912	3	1166.656	1166.6560	K	G	231	241
PSM	GPLQSVQVFGR	2929	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16040	36.325	2	1186.6459	1186.6459	K	K	5	16
PSM	GTDIMYTGTLDCWR	2930	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	12-UNIMOD:4	ms_run[2]:scan=19664	43.108	2	1687.7334	1687.7334	K	K	246	260
PSM	GTLEPEYFNSVCR	2931	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	12-UNIMOD:4	ms_run[2]:scan=15372	35.139	3	1570.7086	1570.7086	K	L	1338	1351
PSM	GVEEEEEDGEMRE	2932	sp|P62306|RUXF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7938	20.616	2	1536.5886	1536.5886	R	-	74	87
PSM	GVTHNIALLR	2933	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10087	24.619	3	1092.6404	1092.6404	R	E	477	487
PSM	HFTILDAPGHK	2934	sp|P15170-2|ERF3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9315	23.122	3	1234.6459	1234.6459	K	S	290	301
PSM	HGGGGGGFGGGGFGSR	2935	sp|P35908|K22E_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7242	19.081	3	1319.5755	1319.5755	R	S	46	62
PSM	HLTESTNQKDVLLQK	2936	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6959	18.496	3	1752.937	1752.9370	K	F	481	496
PSM	HMEMYADR	2937	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5624	15.806	2	1051.4215	1051.4215	R	E	2104	2112
PSM	IAESTEWQEK	2938	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8498	21.689	2	1219.5721	1219.5721	K	H	1603	1613
PSM	IAGQVAAANK	2939	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3482	11.434	2	941.52943	941.5294	R	K	134	144
PSM	IAGQVAAANKK	2940	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2379	9.1331	3	1069.6244	1069.6244	R	H	134	145
PSM	IAGYVTHLMK	2941	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11000	26.568	3	1131.6111	1131.6111	K	R	50	60
PSM	IAPPEAPVTGYMFGK	2942	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18519	40.84	2	1576.796	1576.7960	R	G	879	894
PSM	ICANDAIPK	2943	sp|Q96EY4|TMA16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=8411	21.452	2	1000.5012	1000.5012	K	T	161	170
PSM	IDVGDVILK	2944	sp|Q12923-3|PTN13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16768	37.609	2	970.5699	970.5699	K	V	1529	1538
PSM	IEELQEQLEQK	2945	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11856	28.187	2	1385.7038	1385.7038	R	H	447	458
PSM	IFPPETSASVAATPPPSTASAPAAVNSSASADKPLSNMK	2946	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15432	35.243	4	3766.8724	3766.8724	R	I	356	395
PSM	IFRDGEEAGAYDGPR	2947	sp|P30101|PDIA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9272	23.045	3	1651.759	1651.7590	K	T	105	120
PSM	IGAVNCGDDR	2948	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:4	ms_run[2]:scan=4688	14.073	2	1075.4717	1075.4717	R	M	181	191
PSM	IGGIGTVPVGR	2949	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11305	27.11	2	1024.6029	1024.6029	K	V	256	267
PSM	IIEEAPAPGIK	2950	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9767	23.977	2	1136.6441	1136.6441	K	S	285	296
PSM	IITITGTQDQIQNAQYLLQNSVK	2951	sp|P61978-3|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23877	51.239	3	2588.381	2588.3810	R	Q	410	433
PSM	IKSEHPGLSIGDTAK	2952	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6563	17.531	3	1551.8257	1551.8257	K	K	113	128
PSM	ILLAELEQLK	2953	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21232	46.099	2	1168.7067	1168.7067	K	G	130	140
PSM	ILYDILAFAK	2954	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24462	52.394	2	1165.6747	1165.6747	K	E	439	449
PSM	IPGGIIEDSCVLR	2955	sp|P49368-2|TCPG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:4	ms_run[2]:scan=16578	37.272	2	1427.7442	1427.7443	K	G	166	179
PSM	IQELEDLLAK	2956	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18558	40.908	2	1170.6496	1170.6496	R	E	321	331
PSM	IQFKPDDGISPER	2957	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10803	26.199	2	1500.7573	1500.7573	R	A	287	300
PSM	ISLGLPVGAVINCADNTGAK	2958	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=21527	46.63	2	1969.0303	1969.0303	R	N	16	36
PSM	ISLPLPNFSSLNLR	2959	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=25277	53.991	3	1569.8879	1569.8879	R	E	411	425
PSM	ITHQIVDRPGQQTSVIGR	2960	sp|O00541-2|PESC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8028	20.772	4	2004.0865	2004.0865	R	C	368	386
PSM	ITVTSEVPFSKR	2961	sp|P35268|RL22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11673	27.776	3	1362.7507	1362.7507	K	Y	70	82
PSM	IVLLDSSLEYK	2962	sp|P49368-2|TCPG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18140	40.116	2	1278.7071	1278.7071	R	K	200	211
PSM	IWHHTFYNELR	2963	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11069	26.697	3	1514.7419	1514.7419	K	V	85	96
PSM	KASGPPVSELITK	2964	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10219	24.85	2	1325.7555	1325.7555	R	A	34	47
PSM	KDDPTLLSSGR	2965	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6794	18.155	2	1187.6146	1187.6146	R	V	125	136
PSM	KESYSVYVYK	2966	sp|Q99880|H2B1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9627	23.656	2	1264.634	1264.6340	R	V	35	45
PSM	KGHAVGDIPGVR	2967	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5874	16.277	3	1204.6677	1204.6677	R	F	108	120
PSM	KHEGELQSVR	2968	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2648	9.6039	3	1181.6153	1181.6153	R	D	1022	1032
PSM	KLEGDSTDLSDQIAELQAQIAELK	2969	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=26461	56.773	3	2614.3338	2614.3338	R	M	1052	1076
PSM	KLGTVITPDTWK	2970	sp|Q9P021|CRIPT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12916	30.261	3	1357.7606	1357.7606	K	D	9	21
PSM	KNFYFLEMNTR	2971	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16778	37.627	3	1461.7075	1461.7075	K	L	343	354
PSM	KQGGLGPMNIPLVSDPK	2972	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16624	37.354	3	1749.9447	1749.9447	K	R	93	110
PSM	KSDGIYIINLK	2973	sp|P08865|RSSA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14846	34.009	3	1262.7234	1262.7234	R	R	42	53
PSM	KVEAQLQELQVK	2974	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10458	25.427	3	1411.8035	1411.8035	K	F	1249	1261
PSM	KWLEEQLK	2975	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10094	24.632	2	1072.5917	1072.5917	R	Q	156	164
PSM	LALELEHEK	2976	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9647	23.695	2	1080.5815	1080.5815	K	G	1110	1119
PSM	LCLWDLAEGR	2977	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=22445	48.545	2	1231.6019	1231.6019	K	S	92	102
PSM	LDAELIQYR	2978	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14402	33.175	2	1119.5924	1119.5924	K	E	2534	2543
PSM	LECVEPNCR	2979	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=6243	16.974	2	1175.5063	1175.5063	R	S	70	79
PSM	LEEAEKAADESER	2980	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4784	14.257	3	1475.674	1475.6740	K	G	77	90
PSM	LEHLQQAVAR	2981	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5967	16.459	3	1163.6411	1163.6411	R	L	2272	2282
PSM	LFEISDIVIK	2982	sp|Q9NSD9|SYFB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22837	49.257	2	1175.6802	1175.6802	K	D	474	484
PSM	LGFITNNSSK	2983	sp|A6NDG6|PGP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10462	25.436	2	1079.5611	1079.5611	R	T	63	73
PSM	LGHAEQKDEMVPR	2984	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4729	14.157	3	1508.7406	1508.7406	R	L	362	375
PSM	LGNDFMGITLASSQAVSNAR	2985	sp|Q9HC38-2|GLOD4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21494	46.568	3	2051.0106	2051.0106	K	K	82	102
PSM	LGPGQSEIAEELCQR	2986	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	13-UNIMOD:4	ms_run[2]:scan=15384	35.157	3	1685.8043	1685.8043	K	L	768	783
PSM	LILCPLMAAVTYIDEK	2987	sp|P53350|PLK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=27814	60.531	3	1848.9729	1848.9729	K	R	541	557
PSM	LILPVGPAGGNQMLEQYDK	2988	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21176	46.002	2	2042.0507	2042.0507	R	L	179	198
PSM	LIPDSIGKDIEK	2989	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12025	28.482	3	1326.7395	1326.7395	K	A	188	200
PSM	LKNPNAPMLPPPK	2990	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8790	22.184	3	1415.7959	1415.7959	R	N	391	404
PSM	LKVPEWVDTVK	2991	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15689	35.702	3	1312.7391	1312.7391	K	L	28	39
PSM	LLAAEQTVVR	2992	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10098	24.637	2	1098.6397	1098.6397	K	D	2598	2608
PSM	LLEAASVSSK	2993	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7496	19.641	2	1003.555	1003.5550	R	G	2802	2812
PSM	LLEPVLLLGK	2994	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22330	48.265	2	1093.7111	1093.7111	K	E	51	61
PSM	LLHLEDVVR	2995	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13965	32.402	3	1092.6291	1092.6291	K	A	1062	1071
PSM	LLQDLLSEEENQEK	2996	sp|Q8IWQ3-3|BRSK2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17950	39.756	2	1686.8312	1686.8312	K	M	318	332
PSM	LLSGPSQESPQTLGK	2997	sp|Q9BWE0|REPI1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10157	24.737	2	1540.8097	1540.8097	R	E	19	34
PSM	LQAVSESTVPPSLPVDSVVITESDAQR	2998	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20481	44.744	3	2823.4502	2823.4502	R	T	1372	1399
PSM	LQFTSLEIPR	2999	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19279	42.326	2	1202.6659	1202.6659	K	R	1508	1518
PSM	LQGEMAHIQVGQMTQAGLLEHLK	3000	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18700	41.158	4	2531.2988	2531.2988	R	L	592	615
PSM	LQLAIEERDEAIAR	3001	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13017	30.435	3	1625.8737	1625.8737	R	A	185	199
PSM	LQQELANIGQK	3002	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9997	24.436	2	1240.6776	1240.6776	K	T	2351	2362
PSM	LQWFQNHLDPQK	3003	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14732	33.786	3	1552.7787	1552.7787	K	K	55	67
PSM	LREYEAALNSK	3004	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7686	19.989	3	1292.6725	1292.6725	K	D	135	146
PSM	LSHSDEKPYQCPVCQQR	3005	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=5532	15.646	3	2130.9575	2130.9575	K	F	299	316
PSM	LSLQDAVSQGVIDQDMATR	3006	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20617	44.983	3	2046.0052	2046.0052	K	L	2669	2688
PSM	LSSSQGTIETSLQDIDSR	3007	sp|Q9UHD2|TBK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16757	37.59	3	1935.9385	1935.9385	R	L	508	526
PSM	LSTPAGVQVILR	3008	sp|Q9BQ48|RM34_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16855	37.761	2	1252.7503	1252.7503	R	R	70	82
PSM	LTMQVSSLQR	3009	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11786	28.063	2	1161.6176	1161.6176	R	E	66	76
PSM	LVILANNCPALR	3010	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4	ms_run[2]:scan=15234	34.876	2	1352.7598	1352.7598	K	K	45	57
PSM	LYTLVTYVPVTTFK	3011	sp|P62899|RL31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22970	49.514	3	1643.9174	1643.9174	K	N	102	116
PSM	MEAAAEPGNLAGVR	3012	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=16913	37.862	2	1426.6875	1426.6875	-	H	1	15
PSM	MELSAEYLR	3013	sp|Q9H3K6|BOLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=22323	48.238	2	1152.5485	1152.5485	-	E	1	10
PSM	MIKPFFHSLSEK	3014	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35	ms_run[2]:scan=12276	29.009	3	1478.7592	1478.7592	K	Y	37	49
PSM	MLSSAYISDHMK	3015	sp|P56270-2|MAZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12282	29.017	3	1381.637	1381.6370	K	V	400	412
PSM	MNQLTQELFSLKR	3016	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19124	41.939	3	1606.8501	1606.8501	K	E	2415	2428
PSM	MQQMSEQVHTLR	3017	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:35	ms_run[2]:scan=5198	15.019	3	1502.697	1502.6970	R	E	411	423
PSM	MQQMSEQVHTLREEK	3018	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7466	19.588	4	1872.8822	1872.8822	R	E	411	426
PSM	MQTYQDAESR	3019	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5777	16.115	2	1227.519	1227.5190	R	Q	448	458
PSM	MVAAVACAQVPK	3020	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4	ms_run[2]:scan=10304	25.058	2	1243.6417	1243.6417	K	I	425	437
PSM	MVNHFIAEFK	3021	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:35	ms_run[2]:scan=12412	29.244	2	1250.6118	1250.6118	R	R	237	247
PSM	NADCSSGPGQR	3022	sp|Q9BSD7|NTPCR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=2159	8.7567	2	1147.4676	1147.4676	R	V	98	109
PSM	NALESYAFNMK	3023	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:35	ms_run[2]:scan=13735	31.849	2	1302.5914	1302.5914	K	S	540	551
PSM	NASLASSNNDLQVAEEQYQR	3024	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14405	33.179	3	2236.0356	2236.0356	K	L	495	515
PSM	NFQEEQINTR	3025	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8379	21.387	2	1277.6	1277.6000	R	D	757	767
PSM	NHQVQQLK	3026	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2369	9.1168	2	993.53558	993.5356	K	D	1099	1107
PSM	NIADLMTQAGVEELESENK	3027	sp|O75506|HSBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24115	51.704	3	2089.9838	2089.9838	K	I	51	70
PSM	NIAVGKDPLEGQR	3028	sp|O00170|AIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9543	23.506	3	1395.747	1395.7470	R	H	107	120
PSM	NISHYEEQLVK	3029	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10113	24.666	3	1358.683	1358.6830	R	M	381	392
PSM	NKLNDLEDALQQAK	3030	sp|P04264|K2C1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16799	37.664	3	1598.8264	1598.8264	K	E	442	456
PSM	NKYETEINITK	3031	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9054	22.664	3	1351.6983	1351.6983	R	T	1208	1219
PSM	NLESHHQAAIEK	3032	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2898	10.191	4	1375.6844	1375.6844	R	L	407	419
PSM	NPLIINSIIDK	3033	sp|Q9UNQ2|DIM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18988	41.694	2	1238.7234	1238.7234	K	A	41	52
PSM	NPTSSSEFYK	3034	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7976	20.684	2	1158.5193	1158.5193	K	A	210	220
PSM	NQILSQQLQQMEAEHNTLR	3035	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16609	37.326	3	2280.1281	2280.1281	R	N	294	313
PSM	NSAQGNVYVK	3036	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4980	14.619	2	1078.5407	1078.5407	K	C	462	472
PSM	NSLESYAFNMK	3037	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:35	ms_run[2]:scan=13349	31.05	2	1318.5864	1318.5864	K	A	540	551
PSM	NVLEHQLLELEK	3038	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17214	38.406	3	1463.7984	1463.7984	R	K	1522	1534
PSM	NVLVSEDNVAK	3039	sp|P41240|CSK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8884	22.338	2	1186.6194	1186.6194	R	V	319	330
PSM	PGFSIADK	3040	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9903	24.27	2	833.42832	833.4283	R	K	137	145
PSM	PGLVDSNPAPPESQEK	3041	sp|Q14061|COX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9036	22.632	3	1663.8053	1663.8053	M	K	2	18
PSM	PGPGVWDPNWDR	3042	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17254	38.479	2	1394.6367	1394.6367	R	R	53	65
PSM	PLVQTIFEGGK	3043	sp|Q99661-2|KIF2C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17032	38.072	2	1187.655	1187.6550	R	A	277	288
PSM	QDMQEAQGEQK	3044	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2996	10.37	2	1290.551	1290.5510	R	E	1087	1098
PSM	QDVDNASLAR	3045	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5766	16.096	2	1087.5258	1087.5258	R	L	208	218
PSM	QEEEMMAKEEELVK	3046	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12174	28.822	3	1721.7852	1721.7852	R	V	843	857
PSM	QFMDEQAAER	3047	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8599	21.867	2	1223.5241	1223.5241	R	E	1479	1489
PSM	QGPPHINHDDPSLVPNVPYFDLPAGLMAPLVK	3048	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=26031	55.738	4	3447.7649	3447.7649	R	L	629	661
PSM	QICGLEQQLR	3049	sp|A7MCY6|TBKB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4	ms_run[2]:scan=11883	28.234	2	1243.6343	1243.6343	R	Q	161	171
PSM	QIEELQQEAR	3050	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=8226	21.126	2	1242.6204	1242.6204	K	K	959	969
PSM	QLAQAEQEGK	3051	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=3409	11.301	2	1100.5462	1100.5462	R	T	832	842
PSM	QLEEEKEILQK	3052	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9223	22.955	3	1385.7402	1385.7402	K	E	2804	2815
PSM	QLEQDVLSYQNLR	3053	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16851	37.755	2	1604.8158	1604.8158	K	K	593	606
PSM	QLQQAAQEQAALREECTR	3054	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	16-UNIMOD:4	ms_run[2]:scan=9633	23.667	3	2129.0284	2129.0284	R	L	1371	1389
PSM	QLSQNQEEK	3055	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2325	9.0411	2	1102.5255	1102.5255	R	S	1293	1302
PSM	QQGASGEVYCPSGEK	3056	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:4	ms_run[2]:scan=6436	17.32	2	1595.6886	1595.6886	K	C	524	539
PSM	QQGTSVAQSGAQAPGR	3057	sp|Q9BWE0|REPI1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=4722	14.144	2	1541.7546	1541.7546	R	A	40	56
PSM	QQIDGLQNEMSQK	3058	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10636	25.774	2	1517.7144	1517.7144	K	I	665	678
PSM	QQLLSQNDK	3059	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5676	15.898	2	1072.5513	1072.5513	R	L	1544	1553
PSM	QQYLQSIEER	3060	sp|P21912|SDHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11862	28.199	2	1292.6361	1292.6361	K	E	168	178
PSM	QSLPPGLAVK	3061	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11861	28.198	2	1008.5968	1008.5968	K	E	58	68
PSM	QSLPPGLAVK	3062	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12176	28.828	2	1008.5968	1008.5968	K	E	58	68
PSM	QTQIFTTYSDNQPGVLIQVYEGER	3063	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23066	49.686	3	2785.3559	2785.3559	K	A	424	448
PSM	QVFFELNGQLR	3064	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19457	42.733	2	1349.7092	1349.7092	R	S	1075	1086
PSM	QVQAEVPGSPIFVMR	3065	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19104	41.906	2	1656.8658	1656.8658	R	L	336	351
PSM	RAGELTEDEVER	3066	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6273	17.027	3	1402.6688	1402.6688	K	V	55	67
PSM	RCPAEIVDTVSALVYDNK	3067	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=26414	56.653	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RIEILESECK	3068	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:4	ms_run[2]:scan=9500	23.432	2	1275.6493	1275.6493	R	V	602	612
PSM	RLEEGTEETSETLEK	3069	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7027	18.64	3	1749.8269	1749.8269	R	L	798	813
PSM	RLEQAEEK	3070	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2095	8.6602	2	1001.5142	1001.5142	R	H	2131	2139
PSM	RLNISYTR	3071	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7715	20.08	2	1021.5669	1021.5669	R	N	544	552
PSM	SAAEPVASTPASR	3072	sp|P49674|KC1E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5089	14.836	2	1242.6204	1242.6204	R	I	343	356
PSM	SACGNCYLGDAFR	3073	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=14432	33.226	2	1489.6078	1489.6078	K	C	272	285
PSM	SCVHEEHTR	3074	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	2-UNIMOD:4	ms_run[2]:scan=1825	8.2378	3	1153.4935	1153.4935	K	V	1781	1790
PSM	SDPEELREPQQSFSEAQQQLCNTR	3075	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	21-UNIMOD:4	ms_run[2]:scan=15360	35.116	3	2876.2995	2876.2995	K	Q	3134	3158
PSM	SEETLDEGPPK	3076	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6743	18.035	2	1200.551	1200.5510	K	Y	100	111
PSM	SEIEYYAMLAK	3077	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18490	40.784	2	1316.6322	1316.6322	K	T	58	69
PSM	SFSRPDHLNSHVR	3078	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5155	14.949	4	1550.7702	1550.7702	K	Q	345	358
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	3079	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:35,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=18506	40.815	3	3026.3824	3026.3824	K	F	396	424
PSM	SGLEELVLSEMNSPSR	3080	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23830	51.153	3	1746.8458	1746.8458	R	T	643	659
PSM	SGQGAFGNMCR	3081	sp|P36578|RL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	10-UNIMOD:4	ms_run[2]:scan=8564	21.812	2	1183.4863	1183.4863	R	G	87	98
PSM	SHFAIGLALYYPSAR	3082	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=28711	62.068	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHKPPISFPLCANGQVFGLYK	3083	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	11-UNIMOD:4	ms_run[2]:scan=19626	43.035	2	2359.2147	2359.2147	K	N	997	1018
PSM	SHLEVPLEENVNRR	3084	sp|Q96CT7|CC124_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9722	23.861	3	1690.8751	1690.8751	K	V	122	136
PSM	SIETSSTLQSR	3085	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=6566	17.535	2	1207.6044	1207.6044	R	L	1608	1619
PSM	SIFASPESVTGK	3086	sp|O75940|SPF30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13111	30.598	2	1221.6241	1221.6241	R	V	197	209
PSM	SIYGERFPDENFK	3087	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13345	31.044	3	1600.7522	1600.7522	K	L	117	130
PSM	SLLVIPNTLAVNAAQDSTDLVAK	3088	sp|P17987|TCPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24352	52.177	3	2352.29	2352.2900	R	L	444	467
PSM	SLQELFLAHILSPWGAEVK	3089	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=27623	60.166	3	2137.1572	2137.1572	K	A	468	487
PSM	SPVGMLDLSSWSSPEVLR	3090	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=25154	53.735	2	1958.9772	1958.9772	K	K	2214	2232
PSM	SQVVAGTNYFIK	3091	sp|P04080|CYTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14323	33.038	2	1325.698	1325.6980	K	V	45	57
PSM	SSGIHVALVTGGNK	3092	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	1-UNIMOD:1	ms_run[2]:scan=13233	30.833	2	1380.7361	1380.7361	M	G	2	16
PSM	SSIDNENLVSER	3093	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9598	23.602	2	1361.6423	1361.6423	R	E	1641	1653
PSM	SVSETPPLSGNDTDSLSCDSGSSATSTPCVSR	3094	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	18-UNIMOD:4,29-UNIMOD:4	ms_run[2]:scan=12974	30.361	3	3257.3936	3257.3936	K	L	1680	1712
PSM	SVYPVASPNECNQMCLSTLMK	3095	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	11-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=19869	43.544	3	2428.0895	2428.0895	R	C	302	323
PSM	SYELQTPFEIK	3096	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18954	41.633	2	1353.6816	1353.6816	K	L	248	259
PSM	TAEAGGVTGK	3097	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2406	9.1822	2	889.45051	889.4505	K	G	88	98
PSM	TATAVAHCK	3098	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	8-UNIMOD:4	ms_run[2]:scan=1970	8.4635	2	957.4702	957.4702	K	R	18	27
PSM	TAVCDIPPR	3099	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=7141	18.888	2	1027.5121	1027.5121	K	G	351	360
PSM	TAVCDIPPR	3100	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	4-UNIMOD:4	ms_run[2]:scan=9580	23.57	2	1027.5121	1027.5121	K	G	351	360
PSM	TEDEVLTSK	3101	sp|Q9BQ61|TRIR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=5959	16.437	2	1020.4975	1020.4975	K	G	138	147
PSM	TEIIILATR	3102	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15564	35.476	2	1028.623	1028.6230	R	T	46	55
PSM	TGNLGNVVHIER	3103	sp|Q6P5R6|RL22L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10120	24.676	3	1307.6946	1307.6946	K	F	48	60
PSM	TIRYPDPLIK	3104	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12879	30.188	3	1214.7023	1214.7023	R	V	146	156
PSM	TKHECQNLESEPIR	3105	sp|P49454|CENPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:4	ms_run[2]:scan=5230	15.074	3	1739.8261	1739.8261	K	N	1162	1176
PSM	TKPADMVIEAYGHGQR	3106	sp|O94903|PLPHP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11608	27.664	3	1771.8676	1771.8676	K	T	48	64
PSM	TLLEQLDDDQ	3107	sp|O75400-2|PR40A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18438	40.67	2	1188.551	1188.5510	R	-	921	931
PSM	TLLTKGTLEPEYFNSVCR	3108	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	17-UNIMOD:4	ms_run[2]:scan=16822	37.703	3	2127.067	2127.0670	R	L	1333	1351
PSM	TLVLIGAQGVGR	3109	sp|Q14168-5|MPP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15287	34.989	2	1182.7085	1182.7085	K	R	213	225
PSM	TNAENEFVTIK	3110	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=12345	29.126	2	1264.6299	1264.6299	R	K	278	289
PSM	TTEALKSEEK	3111	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2501	9.3525	2	1134.5768	1134.5768	K	A	154	164
PSM	TTYLVLDEADR	3112	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14876	34.062	2	1294.6405	1294.6405	R	M	242	253
PSM	TVEDDLLLQKPFQK	3113	sp|Q70Z53-2|F10C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16464	37.074	3	1672.9036	1672.9036	R	E	27	41
PSM	TVETLQQQLSK	3114	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11143	26.825	2	1273.6878	1273.6878	K	M	1457	1468
PSM	TVTNAVVTVPAYFNDSQR	3115	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17818	39.524	3	1980.9905	1980.9905	K	Q	138	156
PSM	TYHGDVFSTSSESPSIISSESDFR	3116	sp|Q12923-3|PTN13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17234	38.444	3	2634.1722	2634.1722	K	Q	406	430
PSM	TYHYHCGVQDK	3117	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	6-UNIMOD:4	ms_run[2]:scan=3615	11.712	3	1406.6037	1406.6037	K	A	266	277
PSM	TYSYLTPDLWK	3118	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20814	45.34	2	1385.6867	1385.6867	K	E	247	258
PSM	VAAENALSVAEEQIR	3119	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=17821	39.528	3	1598.8264	1598.8264	R	R	3175	3190
PSM	VAHEDPMYDIIR	3120	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14366	33.113	3	1457.6973	1457.6973	R	D	135	147
PSM	VEELSQALSQK	3121	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=11596	27.644	2	1230.6456	1230.6456	K	E	866	877
PSM	VEGRPGASLPPLDLQALEK	3122	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=19209	42.153	3	1989.0895	1989.0895	R	E	974	993
PSM	VELQELNDR	3123	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10502	25.523	2	1114.5619	1114.5619	K	F	105	114
PSM	VFELDLVTLR	3124	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23368	50.275	2	1203.6863	1203.6863	K	S	2200	2210
PSM	VFSGLVSTGLK	3125	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15024	34.426	2	1106.6336	1106.6336	R	V	416	427
PSM	VGAVDADKHHSLGGQYGVQGFPTIK	3126	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=13015	30.432	4	2580.3085	2580.3085	K	I	75	100
PSM	VGLNAQAACAPR	3127	sp|P48681|NEST_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	9-UNIMOD:4	ms_run[2]:scan=8162	21.011	2	1226.619	1226.6190	R	C	149	161
PSM	VGMIPVPYVEK	3128	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	3-UNIMOD:35	ms_run[2]:scan=14488	33.327	2	1246.6631	1246.6631	R	L	170	181
PSM	VHIGQVIMSIR	3129	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15320	35.048	3	1251.7122	1251.7122	R	T	129	140
PSM	VIKDFMIQGGDFTR	3130	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16165	36.545	3	1625.8236	1625.8236	R	G	96	110
PSM	VKETSNENLR	3131	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=2616	9.5471	3	1188.6099	1188.6099	R	L	1776	1786
PSM	VLGVPIIVQASQAEK	3132	sp|Q14498-2|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=18927	41.584	2	1550.9032	1550.9032	R	N	218	233
PSM	VLLEELEALK	3133	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21593	46.745	2	1155.6751	1155.6751	R	Q	1655	1665
PSM	VLNGNQQVVDTSLK	3134	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10599	25.706	2	1513.81	1513.8100	R	Q	123	137
PSM	VPAINVNDSVTK	3135	sp|P23526|SAHH_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=10440	25.387	2	1255.6772	1255.6772	K	S	175	187
PSM	VQAERPDTMLGVVCGALHVADVSLR	3136	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	14-UNIMOD:4	ms_run[2]:scan=25115	53.661	3	2692.3789	2692.3789	K	N	621	646
PSM	VQALEEVLGDLRAESR	3137	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=22514	48.674	3	1783.9428	1783.9428	R	E	1882	1898
PSM	VQIGEYTFEK	3138	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15443	35.263	2	1212.6027	1212.6027	K	G	1116	1126
PSM	VQIGEYTFEKGDYGDAVVYR	3139	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24622	52.709	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	3140	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=24949	53.341	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VTEDTSSVLR	3141	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7811	20.36	2	1105.5615	1105.5615	K	S	654	664
PSM	VTHAVVTVPAYFNDAQR	3142	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=14480	33.313	3	1886.9639	1886.9639	K	Q	165	182
PSM	YDIDLPNKK	3143	sp|O00244|ATOX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=9528	23.482	2	1104.5815	1104.5815	K	V	31	40
PSM	YEEIDNAPEER	3144	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=7994	20.716	2	1363.5892	1363.5892	K	A	92	103
PSM	YFPTQALNFAFK	3145	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=23329	50.201	2	1445.7343	1445.7343	R	D	81	93
PSM	YGREDLDVLGLSFR	3146	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20908	45.509	3	1638.8366	1638.8366	R	K	64	78
PSM	YLQSLLAEVER	3147	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=20695	45.124	2	1319.7085	1319.7085	R	R	88	99
PSM	YLSSVSSQETQGGPLAPMTGTIEK	3148	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=16916	37.869	3	2480.2105	2480.2105	K	V	636	660
PSM	YLYTLVITDKEK	3149	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=15846	35.98	3	1484.8126	1484.8126	R	A	41	53
PSM	YNAQCQETIR	3150	sp|P21741|MK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	5-UNIMOD:4	ms_run[2]:scan=6022	16.592	2	1281.5772	1281.5772	R	V	112	122
PSM	YTLNVLEDLGDGQK	3151	sp|P13797-3|PLST_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0		ms_run[2]:scan=21382	46.369	2	1563.7781	1563.7781	R	A	460	474
PSM	YVDNNFCGPDGYPLECIK	3152	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	21.0	7-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=19049	41.805	2	2159.9292	2159.9292	R	D	185	203
PSM	GEATATDAEAR	3153	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=2884	10.146637	2	1090.490344	1090.489081	R	E	1393	1404
PSM	QAEAVTALEQQVASLDK	3154	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:28	ms_run[1]:scan=27457	59.65572	2	1782.8986	1782.8994	K	H	1456	1473
PSM	HSQALEALQQR	3155	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7713	20.072301	3	1279.661865	1279.663297	R	L	1813	1824
PSM	QLQSELLLVK	3156	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=16516	37.162791	2	1169.702303	1169.701974	R	N	2029	2039
PSM	RLEATGGPIPQR	3157	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6819	18.206193	3	1293.715331	1293.715333	K	W	76	88
PSM	NVLEHQLLELEK	3158	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17334	38.613283	3	1463.798474	1463.798394	R	K	1522	1534
PSM	VGETSLLLSQR	3159	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13351	31.053059	2	1201.667975	1201.666652	K	E	1766	1777
PSM	QLMLNEEQLEDMR	3160	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18103	40.046289	2	1648.760105	1647.759642	R	Q	1579	1592
PSM	TDCNHIFLNFVPTVIMDPSKIEESVR	3161	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	3-UNIMOD:4	ms_run[1]:scan=25842	55.308042	4	3060.508480	3060.504879	R	S	1468	1494
PSM	QLEMNLAEAER	3162	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13444	31.21611	2	1302.625787	1302.623800	K	Q	768	779
PSM	VEELSQALSQK	3163	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11493	27.457807	2	1230.646397	1230.645582	K	E	861	872
PSM	LALEGLTEDKEK	3164	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11307	27.112518	3	1344.713901	1344.713661	K	L	1574	1586
PSM	LGELQGEAASR	3165	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7199	18.998029	2	1129.578790	1129.572751	R	E	754	765
PSM	AQLEAHLGQVMESVR	3166	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:35	ms_run[1]:scan=15651	35.635339	3	1682.839916	1682.841004	R	Q	373	388
PSM	FLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAR	3167	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	32-UNIMOD:4	ms_run[1]:scan=20176	44.080763	5	4789.252257	4789.252570	R	E	903	951
PSM	CCYDHVISTSHK	3168	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=9310	23.114546	2	1489.6122	1488.6122	K	L	952	964
PSM	LFAAETLKATEETFK	3169	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17603	39.149671	3	1698.887916	1697.887603	K	L	1055	1070
PSM	VQIGEYTFEKGDYGDAVVYR	3170	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21952	47.411289	3	2308.101439	2308.101178	K	G	1116	1136
PSM	IVYTACSHAAVDALCEK	3171	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=13423	31.178741	2	1908.892307	1906.891719	R	A	1227	1244
PSM	IVYTACSHAAVDALCEK	3172	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=15896	36.068167	2	1907.894138	1906.891719	R	A	1227	1244
PSM	TIGPDMFLGTCR	3173	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	11-UNIMOD:4	ms_run[1]:scan=20313	44.363957	2	1366.635867	1366.637342	K	R	1354	1366
PSM	VIAHGKDHPTAATK	3174	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1946	8.424587	4	1444.777668	1444.778662	K	M	429	443
PSM	GVIMHDVSSAINRPQIGVVR	3175	cov|corona04460|ORF1b_Brazil/L15_CD282/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12835	30.058428	3	2148.154521	2147.163341	K	E	1401	1421
PSM	AQQIHSQTSQQYPLYDLDLGK	3176	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=16933	37.899736	3	2432.198353	2432.197203	K	F	835	856
PSM	VQQTVQDLFGR	3177	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=15332	35.070835	2	1289.672995	1289.672800	K	A	395	406
PSM	HWPFQVINDGDKPK	3178	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13812	32.000273	4	1679.841785	1679.841990	K	V	89	103
PSM	SINPDEAVAYGAAVQAAILMGDK	3179	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	20-UNIMOD:35	ms_run[1]:scan=26151	55.989481	3	2319.139241	2319.141663	K	S	362	385
PSM	ALQQLQEELQNK	3180	sp|Q5VU43|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=14184	32.786057	3	1440.761498	1440.757257	K	S	403	415
PSM	EAESCDCLQGFQLTHSLGGGTGSGMGTLLISK	3181	sp|P04350|TBB4A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4,7-UNIMOD:4,25-UNIMOD:35	ms_run[1]:scan=19837	43.485869	3	3326.521980	3326.521728	K	I	123	155
PSM	ISEQFTAMFR	3182	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:35	ms_run[1]:scan=18825	41.397244	2	1245.589451	1244.585959	R	R	381	391
PSM	KAEVNTIPGFDGVVK	3183	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13874	32.167416	3	1573.853190	1572.851158	K	D	186	201
PSM	AAVEEGIVLGGGCALLR	3184	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	13-UNIMOD:4	ms_run[1]:scan=20088	43.923993	3	1683.900392	1683.897791	R	C	430	447
PSM	DMEVLSQEIVR	3185	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17507	38.986397	2	1317.661857	1317.659852	K	L	812	823
PSM	CQHAAHIISELILTAQER	3186	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:4	ms_run[1]:scan=19709	43.189767	4	2089.074680	2089.073858	R	D	310	328
PSM	QTQTSEVYDGPK	3187	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7176	18.9559	2	1351.633275	1351.625575	K	N	1750	1762
PSM	LLGPCMDIMK	3188	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	5-UNIMOD:4	ms_run[1]:scan=17290	38.542644	2	1176.570151	1176.570508	R	R	370	380
PSM	TTGIVMDSGDGVTHTVPIYEGYALPHAILR	3189	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	6-UNIMOD:35	ms_run[1]:scan=19821	43.452201	4	3198.604838	3198.601950	R	L	148	178
PSM	THINIVVIGHVDSGK	3190	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12423	29.265611	3	1588.874608	1587.873290	K	S	6	21
PSM	LSDALAVEDDQVAPVPLNVVETSSSVR	3191	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=22154	47.836191	3	2810.440598	2809.434533	K	E	86	113
PSM	VEYDKLANEK	3192	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6800	18.165675	3	1207.606868	1207.608468	K	T	45	55
PSM	IWGLGFLPQVSTDLTPQTFSEK	3193	sp|Q8IXB1|DJC10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=27560	59.963332	3	2464.269825	2463.268578	R	V	662	684
PSM	KAYGGAYDVMSSK	3194	sp|P05166|PCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8738	22.094957	3	1375.641644	1375.644202	R	H	433	446
PSM	VGMIPVPYVEK	3195	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17634	39.200714	2	1230.667900	1230.668231	R	L	170	181
PSM	LVVPATQCGSLIGK	3196	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	8-UNIMOD:4	ms_run[1]:scan=14100	32.642779	2	1441.795298	1441.796286	R	G	102	116
PSM	DMVGIAQTGSGK	3197	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=9446	23.342899	2	1162.561785	1162.565223	R	T	210	222
PSM	AMLDQLMGTSR	3198	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:35	ms_run[1]:scan=11918	28.292301	2	1237.581020	1237.579493	R	D	9	20
PSM	VQALEEANNDLENK	3199	sp|P35527|K1C9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10825	26.235651	3	1586.762323	1585.758380	K	I	171	185
PSM	IEVEKPFAIAK	3200	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12064	28.576124	2	1243.718763	1243.717624	K	E	205	216
PSM	MDATANDVPSPYEVR	3201	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12967	30.350768	2	1664.751152	1663.751186	K	G	434	449
PSM	LGGLTQAPGNPVLAVQINQDK	3202	sp|P26368|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18094	40.025825	3	2132.158142	2132.158967	R	N	175	196
PSM	VFEVSLADLQNDEVAFRK	3203	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21993	47.511005	3	2080.065257	2079.063670	R	F	66	84
PSM	IAIYELLFK	3204	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=25815	55.247768	2	1108.655427	1108.653233	R	E	9	18
PSM	MSSYAFFVQTCR	3205	sp|B2RPK0|HGB1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	1-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=16701	37.489828	2	1511.652104	1511.653721	K	E	13	25
PSM	GIGMGNIGPAGMGMEGIGFGINK	3206	sp|P52272|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23806	51.109466	3	2178.040550	2177.043151	K	M	323	346
PSM	VDEFPLCGHMVSDEYEQLSSEALEAAR	3207	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	7-UNIMOD:4,10-UNIMOD:35	ms_run[1]:scan=23381	50.299794	3	3099.368648	3097.364482	K	I	43	70
PSM	AQQNNVEHKVETFSGVYK	3208	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11299	27.098649	3	2077.023541	2077.022868	K	K	161	179
PSM	NSQFAGGPLGNPNTTAK	3209	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10573	25.660493	2	1673.817722	1672.816898	R	V	724	741
PSM	IGAEVYHNLK	3210	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8056	20.82365	2	1142.605360	1142.608408	R	N	184	194
PSM	DGFIDKEDLHDMLASLGK	3211	sp|P19105|ML12A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=23164	49.868781	3	2002.967131	2002.966992	R	N	45	63
PSM	LNGTDPEDVIR	3212	sp|P19105|ML12A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=11276	27.058656	2	1227.609223	1227.609531	K	N	93	104
PSM	ILTPLVSLDTPGK	3213	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=18954	41.632532	2	1352.790707	1352.791518	K	A	240	253
PSM	TIDDLEDKLK	3214	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=12017	28.464742	3	1189.628226	1188.623784	K	C	216	226
PSM	VTYVVLDEADR	3215	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13809	31.992158	2	1279.649674	1278.645582	R	M	523	534
PSM	LKQSLPPGLAVK	3216	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=10168	24.758122	3	1249.776578	1249.775808	K	E	56	68
PSM	AEDNADTLALVFEAPNQEK	3217	sp|P12004|PCNA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21396	46.395463	2	2074.989185	2073.985479	R	V	92	111
PSM	LNNLVLFDK	3218	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17061	38.126207	2	1074.608216	1074.607346	K	A	44	53
PSM	TVAGGAWTYNTTSAVTVK	3219	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=14888	34.082746	2	1825.920085	1825.921028	K	S	63	81
PSM	KLDPGSEETQTLVR	3220	sp|P26641|EF1G_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=9271	23.043355	3	1572.819398	1571.815501	R	E	401	415
PSM	HETWSGHVISS	3221	sp|Q9Y2V2|CHSP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8489	21.666821	2	1239.565647	1238.568000	K	-	137	148
PSM	VLDELTLTK	3222	sp|P13645|K1C10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=13808	31.990652	2	1031.597715	1030.591027	R	A	258	267
PSM	SLLEGEGSSGGGGR	3223	sp|P13645|K1C10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=7571	19.781149	2	1261.588305	1261.589858	R	G	451	465
PSM	VSYGIGDEEHDQEGR	3224	sp|P27695|APEX1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8039	20.790473	3	1689.729624	1689.723057	K	V	142	157
PSM	QDHPSSMGVYGQESGGFSGPGENR	3225	sp|Q01844|EWS_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	21.0		ms_run[1]:scan=11378	27.249434	3	2479.0465	2479.0453	R	S	269	293
PSM	TYPGVMHSSCPQEMAAVK	3226	sp|O95372|LYPA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0	10-UNIMOD:4	ms_run[1]:scan=11011	26.595332	3	1991.879444	1991.890339	K	E	204	222
PSM	AKEQEAEPEEQEEDSSSDPR	3227	sp|P55081|MFAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=4742	14.181107	3	2289.955393	2288.951673	K	L	66	86
PSM	GAEAANVTGPGGVPVQGSK	3228	sp|P67809|YBOX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=8813	22.222858	2	1695.861887	1694.858763	K	Y	119	138
PSM	YGSMEIFQSK	3229	sp|Q2TBE0|C19L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=14425	33.211802	2	1189.553562	1188.548510	R	L	259	269
PSM	FGGSGSQVDSAR	3230	sp|Q13200|PSMD2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=5223	15.061374	2	1167.535374	1166.531615	R	M	358	370
PSM	KVHGSLAR	3231	sp|P62861|RS30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=1875	8.3093544	2	866.508767	866.508635	-	A	1	9
PSM	HQQLLEEK	3232	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=4413	13.466851	2	1025.551770	1023.534909	K	N	882	890
PSM	VASAGSAISNASGER	3233	sp|Q86YT6|MIB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=6846	18.261905	2	1377.689005	1375.669171	K	L	400	415
PSM	ALEQLNGFELAGR	3234	sp|Q86U06|RBM23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=17995	39.836851	2	1417.730281	1416.736128	R	P	320	333
PSM	MGQLGLGNQTDAVPSPAQIMYNGQPITK	3235	sp|Q9P258|RCC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	21.0		ms_run[1]:scan=21257	46.145515	3	2931.452079	2928.447363	K	M	231	259
PSM	AAAMANNLQK	3236	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5017	14.703	2	1030.523	1030.5230	R	G	235	245
PSM	AAILQTEVDALR	3237	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16988	37.997	2	1298.7194	1298.7194	R	L	517	529
PSM	AALQELLSK	3238	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15135	34.642	2	971.56515	971.5651	R	G	86	95
PSM	AASAHAIGTVK	3239	sp|P31323|KAP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3263	10.963	2	1024.5665	1024.5665	R	C	362	373
PSM	ACGVDFEIR	3240	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=13582	31.52	2	1065.4913	1065.4913	K	A	140	149
PSM	AEFGDFDIK	3241	sp|Q8IWS0-5|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16718	37.523	2	1040.4815	1040.4815	R	T	224	233
PSM	AEGSEKEESR	3242	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1794	8.1908	3	1120.4996	1120.4996	R	R	272	282
PSM	AELNEFLTR	3243	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15328	35.065	2	1091.5611	1091.5611	K	E	19	28
PSM	AELQAQLAALSTK	3244	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16263	36.715	2	1342.7456	1342.7456	K	L	436	449
PSM	AELQTALAHTQHAAR	3245	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7581	19.801	4	1616.8383	1616.8383	K	Q	231	246
PSM	AGITTIEAVKR	3246	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:1	ms_run[2]:scan=13430	31.192	2	1199.6874	1199.6874	M	K	2	13
PSM	AHAALQGK	3247	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1939	8.4091	2	794.43989	794.4399	K	E	1973	1981
PSM	AIGDGEDEMLFTR	3248	sp|O14654|IRS4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17163	38.311	2	1452.6555	1452.6555	R	R	385	398
PSM	AILVDLEPGTMDSVR	3249	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19547	42.894	3	1614.8287	1614.8287	R	S	63	78
PSM	ALASFNQEER	3250	sp|Q8N5F7|NKAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9118	22.774	2	1163.5571	1163.5571	R	R	381	391
PSM	ALEAALVEK	3251	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10182	24.781	2	942.5386	942.5386	K	G	2092	2101
PSM	ALNEELHLQR	3252	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9918	24.296	3	1221.6466	1221.6466	K	I	895	905
PSM	ALQDSWLQAQAVLK	3253	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20760	45.239	3	1569.8515	1569.8515	R	E	1923	1937
PSM	ALTVPELTQQMFDAK	3254	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22942	49.462	2	1690.86	1690.8600	R	N	283	298
PSM	ALVDHENVISCPHLGASTK	3255	sp|O43175|SERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:4	ms_run[2]:scan=10925	26.409	4	2047.0157	2047.0157	R	E	271	290
PSM	ALYETELADAR	3256	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12896	30.222	2	1250.6143	1250.6143	K	R	80	91
PSM	AMLDQLMGTSR	3257	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:35	ms_run[2]:scan=17187	38.355	2	1237.5795	1237.5795	R	D	9	20
PSM	ANMELQLQHAR	3258	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9056	22.667	3	1309.6561	1309.6561	R	E	399	410
PSM	ANVEKPVK	3259	sp|Q9BQQ3-2|GORS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2173	8.7777	2	883.51272	883.5127	K	L	61	69
PSM	APGLGLVLER	3260	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16623	37.352	2	1023.6077	1023.6077	K	V	300	310
PSM	APSEEDSLSSVPISPYKDEPWK	3261	sp|Q9Y676|RT18B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17303	38.562	3	2460.1697	2460.1697	K	Y	36	58
PSM	AQTEVQLQQK	3262	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5659	15.869	2	1171.6197	1171.6197	K	V	2273	2283
PSM	ASQAEISSLQSVR	3263	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10955	26.468	2	1374.7103	1374.7103	K	Q	563	576
PSM	ASQEPSPKPGTEVIPAAPR	3264	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9486	23.409	3	1931.0112	1931.0112	K	K	16	35
PSM	ATASSPTQQDGR	3265	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2408	9.1848	2	1217.5636	1217.5636	K	G	2328	2340
PSM	ATSNVFAMFDQSQIQEFK	3266	sp|P19105|ML12A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24592	52.648	2	2089.9779	2089.9779	R	E	17	35
PSM	AYEVLKDEDLR	3267	sp|Q8IXB1|DJC10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10964	26.487	3	1349.6827	1349.6827	R	K	83	94
PSM	AYNMVDIIHSVVDER	3268	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24374	52.216	3	1759.8563	1759.8563	K	E	313	328
PSM	CGQEAAELK	3269	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=4477	13.586	2	1004.4597	1004.4597	R	E	321	330
PSM	CIAGDLQK	3270	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=6528	17.477	2	903.4484	903.4484	K	T	2576	2584
PSM	CKHFELGGDK	3271	sp|P83881|RL36A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=4624	13.947	3	1189.555	1189.5550	R	K	88	98
PSM	CLAMDVQAFER	3272	sp|P31323|KAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=17690	39.299	2	1338.606	1338.6060	K	L	373	384
PSM	CMPTFQFFKK	3273	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=17441	38.874	3	1332.6359	1332.6359	K	G	73	83
PSM	CNGVLEGIR	3274	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:4	ms_run[2]:scan=10743	26.083	2	1016.5073	1016.5073	R	I	694	703
PSM	DAALATALGDKK	3275	sp|P20700|LMNB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9199	22.912	3	1172.6401	1172.6401	K	S	146	158
PSM	DAFADAVQR	3276	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10118	24.673	2	991.47231	991.4723	K	A	72	81
PSM	DFIIQTGDPTGTGR	3277	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14712	33.746	2	1476.7209	1476.7209	R	G	48	62
PSM	DGGAQHAQYVGPYR	3278	sp|Q8IWQ3-3|BRSK2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7665	19.95	3	1517.7011	1517.7011	K	L	7	21
PSM	DIELVMSQANVSR	3279	sp|Q13765|NACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16556	37.232	2	1460.7293	1460.7293	K	A	180	193
PSM	DKYAENLK	3280	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4473	13.577	2	979.49746	979.4975	R	G	394	402
PSM	DLEAHIDSANK	3281	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7247	19.092	3	1211.5782	1211.5782	K	N	1621	1632
PSM	DLLHPSPEEEK	3282	sp|P42677|RS27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9328	23.146	3	1292.6248	1292.6248	K	R	6	17
PSM	DLLPGPVTLVMER	3283	sp|Q86U90|YRDC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24429	52.329	2	1438.7854	1438.7854	K	S	143	156
PSM	DLQNVNITLR	3284	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14806	33.934	2	1184.6513	1184.6513	K	I	84	94
PSM	DQALSNAQAK	3285	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3508	11.492	2	1044.52	1044.5200	R	V	576	586
PSM	DQHDTFFLRDPAEALQLPMDYVQR	3286	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24950	53.343	4	2904.3865	2904.3865	R	V	241	265
PSM	DSYVGDEAQSKR	3287	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4732	14.164	2	1353.6161	1353.6161	K	G	51	63
PSM	DVKPDNFLMGLGK	3288	sp|P48730|KC1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19082	41.868	3	1432.7384	1432.7384	R	K	128	141
PSM	DYLHLPPEIVPATLR	3289	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22013	47.559	3	1732.9512	1732.9512	R	R	81	96
PSM	EAHEPLAVADAK	3290	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6567	17.536	3	1249.6303	1249.6303	K	L	82	94
PSM	EAIEGTYIDKK	3291	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7616	19.863	2	1265.6503	1265.6503	K	C	49	60
PSM	EALCDPTVASR	3292	sp|Q9BRX2|PELO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=8395	21.416	2	1217.571	1217.5710	K	L	255	266
PSM	EAQEEIAFLK	3293	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15458	35.287	2	1176.6027	1176.6027	K	L	573	583
PSM	ECCQPVLVYIPPQAELR	3294	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=20393	44.512	3	2071.0231	2071.0231	R	G	2073	2090
PSM	EEFLIPIYHQVAVQFADLHDTPGR	3295	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=25230	53.888	4	2794.4079	2794.4079	R	M	2172	2196
PSM	EFQQPSQITESTIHEIPTK	3296	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14917	34.132	3	2212.1012	2212.1012	K	D	247	266
PSM	EGNNPAENGDAK	3297	sp|P05204|HMGN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2242	8.8993	2	1214.5164	1214.5164	K	T	65	77
PSM	EGTCGAQTQR	3298	sp|P21741|MK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=2087	8.6467	2	1106.4775	1106.4775	R	I	58	68
PSM	EHEHEIAWYTER	3299	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10169	24.759	4	1598.7114	1598.7114	R	S	233	245
PSM	EHEREEFQQEIQR	3300	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7543	19.729	3	1756.8129	1756.8129	R	L	1489	1502
PSM	EIIDLVLDR	3301	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21118	45.903	2	1084.6128	1084.6128	K	I	113	122
PSM	EIVHLQAGQCGNQIGAK	3302	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:4	ms_run[2]:scan=9380	23.231	3	1821.9156	1821.9156	R	F	3	20
PSM	EKDDMETK	3303	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1976	8.4706	2	994.42773	994.4277	R	L	1054	1062
PSM	ELQAQIAELQEDFESEK	3304	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23571	50.674	3	2005.948	2005.9480	R	A	1115	1132
PSM	ELQEVIALTSQELEESR	3305	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24260	51.984	2	1972.9953	1972.9953	K	E	1064	1081
PSM	ELSDFISYLQR	3306	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23785	51.072	2	1369.6878	1369.6878	R	E	472	483
PSM	ELSMVTELR	3307	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14704	33.731	2	1076.5536	1076.5536	K	A	760	769
PSM	EMDEEDKAFK	3308	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6361	17.183	2	1240.5282	1240.5282	K	Q	21	31
PSM	ERLQEMLMGLEAK	3309	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19925	43.644	3	1546.7847	1546.7847	R	Q	522	535
PSM	ESEAVEWQQK	3310	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8716	22.061	2	1232.5673	1232.5673	K	A	439	449
PSM	ESEVLDLKEQLEK	3311	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14544	33.425	2	1558.809	1558.8090	R	M	1652	1665
PSM	ESIDGKLPSTDQQESCSSTPGLEEPLFK	3312	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	16-UNIMOD:4	ms_run[2]:scan=17137	38.263	3	3078.4339	3078.4339	R	A	1247	1275
PSM	FDTFNGECPNFVFPLNSIIK	3313	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=27120	58.574	3	2358.1355	2358.1355	K	T	263	283
PSM	FGDLDPSSAEFFLQEER	3314	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23770	51.046	3	1985.9007	1985.9007	K	L	516	533
PSM	FLSSAAAVSK	3315	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8225	21.124	2	979.53385	979.5338	R	E	1110	1120
PSM	FSDSYASVIK	3316	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12947	30.315	2	1115.5499	1115.5499	K	A	310	320
PSM	FSIAPSSLDPSNR	3317	sp|P53350|PLK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15478	35.32	2	1389.6888	1389.6888	R	K	325	338
PSM	FTVAESCDR	3318	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=7316	19.242	2	1083.4655	1083.4655	K	I	20	29
PSM	FVGQDVEGER	3319	sp|P17812|PYRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8072	20.849	2	1134.5306	1134.5306	K	M	499	509
PSM	FVINYDYPNSSEDYVHR	3320	sp|Q92841-1|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15967	36.192	3	2116.949	2116.9490	K	I	410	427
PSM	GAEEMETVIPVDVMR	3321	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	14-UNIMOD:35	ms_run[2]:scan=20355	44.446	2	1690.7906	1690.7906	K	R	13	28
PSM	GASQAGMLAPGTR	3322	sp|Q15417-3|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7883	20.515	2	1215.603	1215.6030	K	R	167	180
PSM	GCTATLGNFAK	3323	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=10565	25.646	2	1138.5441	1138.5441	R	A	228	239
PSM	GDYGDAVVYR	3324	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9978	24.404	3	1113.5091	1113.5091	K	G	1126	1136
PSM	GEALYGYCNLK	3325	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=12891	30.212	2	1286.5965	1286.5965	K	D	175	186
PSM	GIIASSVGTILK	3326	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18195	40.216	2	1157.702	1157.7020	K	S	17	29
PSM	GIPHLVTHDAR	3327	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6426	17.3	3	1214.652	1214.6520	K	T	135	146
PSM	GIPHLVTHDAR	3328	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6479	17.394	2	1214.652	1214.6520	K	T	135	146
PSM	GLFSANDWQCK	3329	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:4	ms_run[2]:scan=16352	36.872	2	1324.587	1324.5870	R	T	62	73
PSM	GLQPGEEELPDISPPIVIPDDSKDR	3330	sp|Q92995-2|UBP13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20618	44.985	3	2715.3603	2715.3603	R	L	553	578
PSM	GMFTISDHQPEQR	3331	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:35	ms_run[2]:scan=8515	21.721	3	1560.6991	1560.6991	R	G	170	183
PSM	GNFNYIEFTR	3332	sp|P19105|ML12A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17500	38.976	2	1259.5935	1259.5935	K	I	151	161
PSM	GPLATGGIK	3333	sp|Q9Y2S6|TMA7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7047	18.683	2	812.4756	812.4756	K	K	51	60
PSM	GPLATGGIKK	3334	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4528	13.705	3	940.57057	940.5706	K	S	51	61
PSM	GPSSVEDIK	3335	sp|P06748|NPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6208	16.91	2	930.46583	930.4658	K	A	240	249
PSM	GQQGVGPPTDNEAR	3336	sp|Q9BQS8|FYCO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5623	15.805	2	1424.6644	1424.6644	K	E	752	766
PSM	GSEQESVKEFLAK	3337	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12608	29.66	3	1450.7304	1450.7304	K	A	10	23
PSM	GTHFVQLCCQR	3338	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=8684	22.006	3	1404.6391	1404.6391	K	N	384	395
PSM	GWDEALLTMSK	3339	sp|Q00688|FKBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20290	44.305	2	1249.6013	1249.6013	R	G	174	185
PSM	HKSETDTSLIR	3340	sp|P40227|TCPZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4322	13.28	3	1285.6626	1285.6626	K	G	198	209
PSM	HLEPALAFQLELNR	3341	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19515	42.836	3	1649.8889	1649.8889	R	M	1372	1386
PSM	HLHHDAGIMR	3342	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2640	9.5874	3	1185.5825	1185.5825	K	N	2691	2701
PSM	HLSIILEK	3343	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10543	25.607	2	951.57532	951.5753	R	D	2492	2500
PSM	HLSVNDLPVGR	3344	sp|P30048-2|PRDX3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11344	27.189	2	1205.6517	1205.6517	K	S	179	190
PSM	HQLDVVIAEK	3345	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9138	22.806	2	1150.6346	1150.6346	K	L	2378	2388
PSM	HSDGNLCVK	3346	sp|P49458|SRP09_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=3011	10.397	2	1028.4709	1028.4709	R	V	33	42
PSM	HSQYHVDGSLEK	3347	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5095	14.848	3	1398.6528	1398.6528	R	D	105	117
PSM	HYAHTDCPGHADYVK	3348	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=3953	12.419	4	1769.758	1769.7580	R	N	121	136
PSM	HYGPGWVSMANAGK	3349	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12125	28.719	3	1473.6823	1473.6823	K	D	132	146
PSM	IANPVEGSSGR	3350	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6216	16.924	2	1085.5465	1085.5465	K	Q	315	326
PSM	IASLSNIVR	3351	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13098	30.577	2	971.57638	971.5764	K	N	2110	2119
PSM	IASSIVAQTAGIPTLPWSGSGLR	3352	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23897	51.277	3	2281.243	2281.2430	K	V	244	267
PSM	IAVHCTVR	3353	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	5-UNIMOD:4	ms_run[2]:scan=4217	13.021	2	954.50692	954.5069	K	G	68	76
PSM	IAWDDEETRDGFR	3354	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13010	30.421	3	1608.7168	1608.7168	R	L	231	244
PSM	IDFYFDENPYFENK	3355	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23234	50.002	2	1839.7992	1839.7992	R	V	124	138
PSM	IDVYGFSALWK	3356	sp|Q9UBV8|PEF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24930	53.305	2	1297.6707	1297.6707	R	F	171	182
PSM	IFDPQNPDENE	3357	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11997	28.428	2	1316.5521	1316.5521	K	-	293	304
PSM	IFRDGEEAGAYDGPR	3358	sp|P30101|PDIA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9262	23.028	3	1651.759	1651.7590	K	T	105	120
PSM	IIEDGDGAGAGTTVNNLEETPVIENR	3359	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16103	36.44	3	2683.2937	2683.2937	R	S	1546	1572
PSM	ILAFPCNQFGK	3360	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4	ms_run[2]:scan=17031	38.07	2	1293.654	1293.6540	R	Q	70	81
PSM	INGCAIQCR	3361	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=5729	16.026	2	1090.5012	1090.5012	R	V	369	378
PSM	INNADTGIAIQK	3362	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8698	22.03	2	1256.6725	1256.6725	R	N	228	240
PSM	IQALEAELQAVSHSK	3363	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16677	37.446	2	1622.8628	1622.8628	R	T	1044	1059
PSM	IQQTEATNK	3364	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2218	8.8562	2	1031.5247	1031.5247	K	I	411	420
PSM	ISITEGIER	3365	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11850	28.178	2	1016.5502	1016.5502	K	G	2631	2640
PSM	ITAEEMSALIEER	3366	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20516	44.807	3	1490.7287	1490.7287	R	D	258	271
PSM	ITEDSAVTTFEALK	3367	sp|Q5VTB9-3|RN220_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18740	41.235	2	1523.7719	1523.7719	K	A	270	284
PSM	ITVTSEVPFSK	3368	sp|P35268|RL22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13756	31.884	2	1206.6496	1206.6496	K	R	70	81
PSM	IVYTACSHAAVDALCEK	3369	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=30872	68.124	3	1906.8917	1906.8917	R	A	1227	1244
PSM	KAVFISPYNSQNAVASK	3370	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11542	27.544	2	1822.9577	1822.9577	R	I	1431	1448
PSM	KDDPTLLSSGR	3371	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6896	18.357	3	1187.6146	1187.6146	R	V	125	136
PSM	KEEELQAALAR	3372	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9115	22.77	3	1256.6725	1256.6725	K	V	1081	1092
PSM	KESESCDCLQGFQLTHSLGGGTGSGMGTLLISK	3373	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=20063	43.881	4	3454.6167	3454.6167	R	I	122	155
PSM	KFLDGIYVSEK	3374	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13331	31.019	3	1297.6918	1297.6918	R	G	174	185
PSM	KGLFPFTHVK	3375	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11762	28.008	3	1172.6706	1172.6706	R	I	283	293
PSM	KIENLQEQLR	3376	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8806	22.21	2	1269.7041	1269.7041	K	D	579	589
PSM	KLAVNMVPFPR	3377	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15191	34.766	2	1270.722	1270.7220	R	L	252	263
PSM	KPNEGADGQWK	3378	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4077	12.75	3	1228.5836	1228.5836	R	K	295	306
PSM	KTFEASTEK	3379	sp|Q6ZWJ1|STXB4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2644	9.596	2	1039.5186	1039.5186	R	L	421	430
PSM	KVAEPELMGTPDGTCYPPPPVPR	3380	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	15-UNIMOD:4	ms_run[2]:scan=15409	35.203	3	2507.2189	2507.2189	R	Q	1875	1898
PSM	KVQTESSTGSVGSNR	3381	sp|Q9BRX2|PELO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2433	9.2336	3	1535.754	1535.7540	R	V	46	61
PSM	LALSQNQQSSGAAGPTGK	3382	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7224	19.048	3	1713.8646	1713.8646	R	N	107	125
PSM	LAVNMVPFPR	3383	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18459	40.717	2	1142.627	1142.6270	K	L	253	263
PSM	LCYVALDFEQEMATAASSSSLEK	3384	sp|P60709|ACTB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=25793	55.203	3	2549.1666	2549.1666	K	S	216	239
PSM	LEEEKTHLQEK	3385	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3113	10.611	3	1382.7042	1382.7042	K	L	708	719
PSM	LEKDLEEAHR	3386	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4082	12.76	3	1238.6255	1238.6255	R	E	418	428
PSM	LGAFLWMQR	3387	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21846	47.207	2	1120.5852	1120.5852	K	N	176	185
PSM	LGGPQASLSTK	3388	sp|Q9NUI1|DECR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7129	18.861	2	1057.5768	1057.5768	R	V	220	231
PSM	LGTPELSTAERK	3389	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7604	19.841	3	1300.6987	1300.6987	R	E	2151	2163
PSM	LLCGLLAER	3390	sp|P14174|MIF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:4	ms_run[2]:scan=16640	37.385	2	1043.5798	1043.5798	K	L	79	88
PSM	LLETESFQMNR	3391	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13736	31.85	2	1366.6551	1366.6551	K	I	597	608
PSM	LLLLGAGESGK	3392	sp|P19087|GNAT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14382	33.14	2	1056.6179	1056.6179	K	S	36	47
PSM	LLLQVQHASK	3393	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8340	21.322	3	1135.6713	1135.6713	K	Q	34	44
PSM	LLQDFFNGK	3394	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18194	40.215	2	1080.5604	1080.5604	K	E	349	358
PSM	LLQEEEQER	3395	sp|O14654|IRS4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6048	16.642	2	1172.5673	1172.5673	R	R	1074	1083
PSM	LLQLESTVSAK	3396	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12629	29.698	2	1187.6762	1187.6762	R	D	2493	2504
PSM	LLSRPQDALEGVVLSPSLEAR	3397	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20073	43.899	3	2249.2379	2249.2379	R	V	307	328
PSM	LLTEIHGGAGGPSGR	3398	sp|Q16763|UBE2S_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7848	20.45	3	1420.7423	1420.7423	R	A	150	165
PSM	LLYEDVSRENDCLQEELR	3399	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	12-UNIMOD:4	ms_run[2]:scan=18033	39.91	3	2280.0692	2280.0692	K	M	1250	1268
PSM	LMEEIMSEK	3400	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12496	29.408	2	1108.5144	1108.5144	R	E	332	341
PSM	LNHVAAGLVSPSLK	3401	sp|Q05519-2|SRS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11245	27.002	3	1404.8089	1404.8089	K	S	198	212
PSM	LNLLQGQVSELPLR	3402	sp|Q6NTE8-2|MRNIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21022	45.724	2	1578.9093	1578.9093	K	S	101	115
PSM	LQAEADDLQIR	3403	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11854	28.184	3	1270.6517	1270.6517	K	E	1233	1244
PSM	LQDEIQNMK	3404	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:35	ms_run[2]:scan=5427	15.421	2	1133.5387	1133.5387	R	E	365	374
PSM	LQELEQENK	3405	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5750	16.065	2	1129.5615	1129.5615	R	L	2236	2245
PSM	LQNMLEEQLTK	3406	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15436	35.249	2	1345.6912	1345.6912	K	N	795	806
PSM	LQQENSILR	3407	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8840	22.268	2	1099.5986	1099.5986	K	N	1519	1528
PSM	LRECLPLIIFLR	3408	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=24790	53.038	3	1541.9116	1541.9116	K	N	38	50
PSM	LSDLSEQLK	3409	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10105	24.65	2	1031.5499	1031.5499	R	Q	959	968
PSM	LSEENTLLK	3410	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10093	24.63	2	1045.5655	1045.5655	R	N	1089	1098
PSM	LSLDDLLQR	3411	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21612	46.781	2	1071.5924	1071.5924	R	L	1723	1732
PSM	LSSANGHEER	3412	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=1993	8.496	3	1098.5054	1098.5054	K	S	22	32
PSM	LTEEFQNVR	3413	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9981	24.408	2	1134.5669	1134.5669	R	I	208	217
PSM	LTVIAEQIQHLQEQAR	3414	sp|Q9BV19|CA050_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18264	40.345	3	1876.0167	1876.0167	K	K	78	94
PSM	LVEQEVQEK	3415	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5438	15.445	2	1100.5714	1100.5714	R	L	1028	1037
PSM	LVNHFVEEFKR	3416	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11180	26.891	2	1416.7514	1416.7514	R	K	237	248
PSM	LVQSPNSYFMDVK	3417	sp|P42677|RS27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	10-UNIMOD:35	ms_run[2]:scan=16832	37.72	2	1542.7388	1542.7388	R	C	24	37
PSM	LWTGGLDNTVR	3418	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14191	32.799	2	1230.6357	1230.6357	K	S	633	644
PSM	MDSTEPPYSQK	3419	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6450	17.345	2	1281.5547	1281.5547	K	R	155	166
PSM	MGPLGLDHMASSIER	3420	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16054	36.349	3	1612.7701	1612.7701	R	M	418	433
PSM	MLDMGFEPQIR	3421	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18960	41.644	2	1335.6315	1335.6315	R	K	253	264
PSM	MNELETEQR	3422	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6272	17.026	2	1148.5132	1148.5132	K	L	461	470
PSM	MSSYAFFVQTCR	3423	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=16672	37.439	2	1511.6537	1511.6537	K	E	13	25
PSM	MTDQEAIQDLWQWR	3424	sp|P06748|NPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=25545	54.611	2	1818.8359	1818.8359	R	K	278	292
PSM	MTDQEAIQDLWQWR	3425	sp|P06748|NPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=25564	54.644	3	1818.8359	1818.8359	R	K	278	292
PSM	MTHLQNQEK	3426	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2323	9.0385	3	1127.5393	1127.5393	R	L	2530	2539
PSM	MVEKDQDGGR	3427	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2020	8.533	3	1133.5135	1133.5135	K	K	112	122
PSM	MVNHFIAEFK	3428	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13642	31.673	3	1234.6169	1234.6169	R	R	237	247
PSM	MVTETEETQEK	3429	sp|Q6IQ49-3|SDE2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4721	14.142	2	1323.5864	1323.5864	R	K	217	228
PSM	NAESNAELK	3430	sp|P18621-3|RL17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3591	11.667	2	974.46689	974.4669	K	G	97	106
PSM	NEIAELQGQAAVLK	3431	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16258	36.704	2	1482.8042	1482.8042	K	E	674	688
PSM	NELESYAYSLK	3432	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16141	36.504	2	1315.6296	1315.6296	R	N	563	574
PSM	NKHEAMITDLEER	3433	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9082	22.712	3	1584.7566	1584.7566	K	L	1023	1036
PSM	NLLQVDLTK	3434	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15594	35.535	2	1042.6023	1042.6023	R	R	272	281
PSM	NLQYYDISAK	3435	sp|P62826|RAN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12693	29.811	2	1213.5979	1213.5979	K	S	143	153
PSM	NNDDSGAEIK	3436	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3163	10.724	2	1061.4625	1061.4625	K	A	100	110
PSM	NQVDSETHCHAER	3437	sp|Q9NRW3|ABC3C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	9-UNIMOD:4	ms_run[2]:scan=2396	9.1637	3	1581.659	1581.6590	R	C	57	70
PSM	NSEEQPSGGTTVLQR	3438	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7609	19.849	2	1601.7645	1601.7645	R	L	3	18
PSM	NSVTGGTAAFEPSVDYCVVK	3439	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	17-UNIMOD:4	ms_run[2]:scan=16869	37.787	2	2099.9834	2099.9834	R	I	720	740
PSM	QELQETQER	3440	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4137	12.861	2	1159.5469	1159.5469	R	L	666	675
PSM	QELTQLCLK	3441	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=12920	30.267	2	1131.5958	1131.5958	R	L	30	39
PSM	QFQLDSLEAALQK	3442	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22206	47.928	2	1489.7777	1489.7777	R	Q	38	51
PSM	QGANINEIR	3443	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7301	19.205	2	1013.5254	1013.5254	R	Q	298	307
PSM	QGGDLGWMTR	3444	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14380	33.137	2	1119.5131	1119.5131	R	G	78	88
PSM	QGNCQPTNVSEYNAAALMELLR	3445	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=25988	55.636	3	2478.1631	2478.1631	R	E	644	666
PSM	QGNCQPTNVSEYNAAALMELLR	3446	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=25999	55.666	3	2478.1631	2478.1631	R	E	644	666
PSM	QHTENIQELLEDTNVR	3447	sp|Q8N8E3|CE112_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18074	39.986	3	1937.9443	1937.9443	K	L	376	392
PSM	QIFLGGVDKR	3448	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10092	24.629	3	1131.64	1131.6400	K	T	97	107
PSM	QLFHPEQLITGK	3449	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15374	35.142	3	1409.7667	1409.7667	R	E	85	97
PSM	QLLNESQQK	3450	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5440	15.448	2	1086.5669	1086.5669	K	I	3260	3269
PSM	QLLQANPILEAFGNAK	3451	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24377	52.221	2	1725.9414	1725.9414	R	T	210	226
PSM	QMLLDAVPLSCNISK	3452	sp|Q8N3C7-3|CLIP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:4	ms_run[2]:scan=20113	43.967	2	1687.8637	1687.8637	K	A	249	264
PSM	QNAVLQAAQDDLGHLR	3453	sp|Q15276-2|RABE1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18680	41.123	3	1747.8965	1747.8965	R	T	60	76
PSM	QQEADIQNSK	3454	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3038	10.45	2	1159.5469	1159.5469	R	F	2349	2359
PSM	QQFEGYGLEIPDILNASNLK	3455	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=25912	55.464	3	2248.1376	2248.1376	R	T	122	142
PSM	QQQLLNEENLR	3456	sp|Q9NVI7-2|ATD3A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11463	27.403	2	1383.7106	1383.7106	K	K	147	158
PSM	QQSQVEEQR	3457	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2442	9.2484	2	1130.5316	1130.5316	R	V	354	363
PSM	QRLEHLQQAVAR	3458	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5826	16.199	4	1447.8008	1447.8008	R	L	2270	2282
PSM	QSTVLAPVIDLK	3459	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17917	39.7	2	1282.7497	1282.7497	K	R	47	59
PSM	QVHPDTGISSK	3460	sp|Q99880|H2B1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3657	11.797	2	1167.5884	1167.5884	K	A	48	59
PSM	QVSDLISVLR	3461	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19572	42.937	2	1128.6503	1128.6503	K	E	452	462
PSM	RCPAEIVDTVSALVYDNK	3462	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=26653	57.295	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	3463	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=27465	59.684	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	3464	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=26159	56.008	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RCPAEIVDTVSALVYDNK	3465	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4	ms_run[2]:scan=26179	56.051	3	2049.0201	2049.0201	R	L	1366	1384
PSM	RINEEEEK	3466	sp|Q8N9Q2|SR1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2062	8.5975	2	1045.504	1045.5040	K	K	69	77
PSM	RLLWEQLQGLESSK	3467	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19408	42.63	3	1685.9101	1685.9101	K	Q	204	218
PSM	SAVEDEGLK	3468	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5601	15.766	2	946.46074	946.4607	K	G	551	560
PSM	SFNDDAMLIEK	3469	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14987	34.308	2	1281.5911	1281.5911	K	F	238	249
PSM	SGLWAGGPAPGQFYR	3470	sp|P28070|PSB4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18610	40.997	2	1562.763	1562.7630	R	I	9	24
PSM	SHFAIGLALYYPSAR	3471	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22377	48.386	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHKPPISFPLCANGQVFGLYK	3472	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:4	ms_run[2]:scan=24346	52.165	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHKPPISFPLCANGQVFGLYK	3473	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:4	ms_run[2]:scan=27829	60.56	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHQLIHAASLK	3474	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5525	15.63	4	1203.6724	1203.6724	R	L	210	221
PSM	SHSGPSSLPEAPLKPPGPLVPPDQQDK	3475	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13997	32.46	4	2774.4239	2774.4239	R	V	16	43
PSM	SILSPLYAFASEAAR	3476	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=26259	56.271	2	1594.8355	1594.8355	K	V	528	543
PSM	SIMAAAGVPVVEGYHGEDQSDQCLK	3477	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	23-UNIMOD:4	ms_run[2]:scan=15633	35.604	3	2660.2211	2660.2211	K	E	168	193
PSM	SINQQSGAHVELQR	3478	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6582	17.563	3	1565.791	1565.7910	K	N	379	393
PSM	SLDLDSIIAEVK	3479	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24705	52.864	2	1301.7078	1301.7078	R	A	344	356
PSM	SLFDYFLTDLK	3480	sp|Q9NQ88|TIGAR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=27739	60.403	2	1360.6915	1360.6915	R	C	204	215
PSM	SLRPDPNFDALISK	3481	sp|Q99496|RING2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16060	36.36	3	1571.8308	1571.8308	R	I	99	113
PSM	SLYASSPGGVYATR	3482	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11262	27.033	2	1427.7045	1427.7045	R	S	51	65
PSM	SMPGKPPGMDPIGIMASALR	3483	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22891	49.366	3	2025.021	2025.0210	R	T	339	359
PSM	SNAAAYLQHLCYR	3484	sp|O60716|CTND1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	11-UNIMOD:4	ms_run[2]:scan=14615	33.551	3	1565.7409	1565.7409	K	N	384	397
PSM	SNDEEAFTFAR	3485	sp|P0DN79|CBSL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13815	32.009	2	1285.5575	1285.5575	K	M	326	337
PSM	SNKDGGNQEVEIAR	3486	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5088	14.835	3	1515.7277	1515.7277	K	C	316	330
PSM	SNSTTQVSQPR	3487	sp|Q9UPN4-3|CP131_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=3188	10.783	2	1203.5844	1203.5844	R	S	76	87
PSM	SNYNFEKPFLWLAR	3488	sp|P62826|RAN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22840	49.262	3	1783.9046	1783.9046	K	K	153	167
PSM	SPILVATAVAAR	3489	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14164	32.753	2	1167.6976	1167.6976	K	G	476	488
PSM	SPYQEFTDHLVK	3490	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15330	35.068	3	1462.7092	1462.7092	K	T	264	276
PSM	SREETGLLMPLK	3491	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13159	30.687	3	1372.7384	1372.7384	K	A	723	735
PSM	SSGCFPNMAAK	3492	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=9391	23.252	2	1168.5005	1168.5005	R	V	457	468
PSM	SSMSGLHLVK	3493	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9357	23.193	2	1057.559	1057.5590	R	Q	77	87
PSM	SSTAAQEVK	3494	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2332	9.0532	2	919.46108	919.4611	K	T	471	480
PSM	TAFTEKDALLETVNR	3495	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14625	33.568	3	1706.8839	1706.8839	R	L	525	540
PSM	TAGQTGMCGGVR	3496	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=4792	14.268	2	1193.5281	1193.5281	K	G	106	118
PSM	TALIHDGLAR	3497	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8223	21.122	2	1065.5931	1065.5931	K	G	24	34
PSM	TAQIMFQAYGDK	3498	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14293	32.983	2	1371.6493	1371.6493	R	Q	1553	1565
PSM	TAVCDIPPR	3499	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=9883	24.232	2	1027.5121	1027.5121	K	G	351	360
PSM	TDCDIEDDR	3500	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	3-UNIMOD:4	ms_run[2]:scan=5560	15.695	2	1137.4244	1137.4244	K	L	1295	1304
PSM	TDLLLEPYNK	3501	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15180	34.739	2	1204.634	1204.6340	K	Y	290	300
PSM	TDPTTLTDEEINR	3502	sp|P11586|C1TC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11459	27.397	2	1503.7053	1503.7053	K	F	505	518
PSM	TDYNASVSVPDSSGPER	3503	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10500	25.517	2	1779.7911	1779.7911	R	I	70	87
PSM	TEDSNAGNSGGNVPAPDSTK	3504	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5098	14.852	2	1916.8348	1916.8348	R	G	251	271
PSM	TGNAWHSK	3505	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2296	8.9901	2	899.42496	899.4250	K	N	622	630
PSM	TGVHHYSGNNIELGTACGK	3506	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	17-UNIMOD:4	ms_run[2]:scan=7255	19.106	4	2013.9327	2013.9327	K	Y	69	88
PSM	THNGESVSYLFSHVPL	3507	sp|P60891|PRPS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21309	46.24	3	1785.8686	1785.8686	R	-	303	319
PSM	TILTLTGVSTLGDVK	3508	sp|A6NDG6|PGP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20622	44.991	2	1516.8712	1516.8712	K	N	276	291
PSM	TITLEVEPSDTIENVK	3509	sp|P62987|RL40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16836	37.726	2	1786.92	1786.9200	K	A	12	28
PSM	TLAYLLPAIVHINHQPYLER	3510	sp|Q92841-1|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=21872	47.252	4	2360.3005	2360.3005	K	G	143	163
PSM	TLELSEALR	3511	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14635	33.589	2	1030.5659	1030.5659	R	H	2754	2763
PSM	TLGDFAAEYAK	3512	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=15293	35	2	1184.5714	1184.5714	K	S	109	120
PSM	TLLEGEESR	3513	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7750	20.185	2	1032.5088	1032.5088	R	M	484	493
PSM	TLSEEQEKANSVQK	3514	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4752	14.198	3	1589.7897	1589.7897	K	L	2584	2598
PSM	TLSFSHDGK	3515	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5864	16.259	2	990.47706	990.4771	R	M	271	280
PSM	TPLPPELADVQA	3516	sp|Q9Y5V0|ZN706_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=19587	42.963	2	1249.6554	1249.6554	K	-	65	77
PSM	TPVPSDIDISR	3517	sp|P11586|C1TC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12001	28.434	2	1198.6194	1198.6194	K	S	314	325
PSM	TQHESELEQLR	3518	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8029	20.774	3	1368.6634	1368.6634	K	I	510	521
PSM	TSIAIDTIINQK	3519	sp|P25705-2|ATPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16764	37.603	2	1315.7347	1315.7347	K	R	169	181
PSM	TSMNAHSLSEEADSLKHQLDVVIAEK	3520	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=22662	48.93	4	2851.4022	2851.4022	K	L	2362	2388
PSM	TSYAQHQQVR	3521	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2732	9.7744	3	1216.5949	1216.5949	K	Q	153	163
PSM	TVNSNCEINNR	3522	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4	ms_run[2]:scan=4236	13.056	2	1319.5888	1319.5888	R	S	577	588
PSM	TVTNAVVTVPAYFNDSQR	3523	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18196	40.218	2	1980.9905	1980.9905	K	Q	138	156
PSM	TVVTGIEMFHK	3524	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13812	32	3	1260.6536	1260.6536	R	S	301	312
PSM	TYSLGSALR	3525	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12242	28.947	2	966.51345	966.5134	R	P	37	46
PSM	TYSLGSALRPSTSR	3526	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10950	26.456	3	1494.7791	1494.7791	R	S	37	51
PSM	VAYLDKEFSK	3527	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10360	25.196	3	1198.6234	1198.6234	K	A	45	55
PSM	VCEVCSAYLGLHDNDRR	3528	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=10955	26.468	3	2062.9313	2062.9313	R	L	189	206
PSM	VDDHLMGK	3529	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5426	15.42	2	913.43275	913.4328	R	Q	208	216
PSM	VDGMDILCVR	3530	sp|P08559-3|ODPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	8-UNIMOD:4	ms_run[2]:scan=18105	40.049	2	1176.5631	1176.5631	R	E	223	233
PSM	VDNSSLTGESEPQTR	3531	sp|P05023-3|AT1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6977	18.537	2	1618.7435	1618.7435	K	S	182	197
PSM	VDPVYIHLAER	3532	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13362	31.073	3	1310.6983	1310.6983	R	L	2140	2151
PSM	VESTVIPESTIMR	3533	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14449	33.256	2	1460.7545	1460.7545	R	T	73	86
PSM	VETFSGVYK	3534	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10729	26.052	2	1028.5179	1028.5179	K	K	170	179
PSM	VETQFQNGHYDK	3535	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6167	16.842	2	1464.6634	1464.6634	R	C	997	1009
PSM	VEYDKLANEK	3536	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6762	18.079	3	1207.6085	1207.6085	K	T	45	55
PSM	VGEFSGANK	3537	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4949	14.557	2	907.43995	907.4399	K	E	86	95
PSM	VGMIPVPYVEK	3538	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17454	38.896	2	1230.6682	1230.6682	R	L	170	181
PSM	VHIEIGPDGR	3539	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=9062	22.676	2	1091.5724	1091.5724	R	V	317	327
PSM	VIKDFMIQGGDFTR	3540	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:35	ms_run[2]:scan=14131	32.698	3	1641.8185	1641.8185	R	G	96	110
PSM	VKELEEELQHLK	3541	sp|P82094|TMF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=12275	29.007	3	1493.809	1493.8090	K	Q	597	609
PSM	VLFSSNGGVVK	3542	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11610	27.667	2	1105.6132	1105.6132	K	G	472	483
PSM	VLIGNVQPGILR	3543	sp|Q5VT06|CE350_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=16890	37.824	2	1277.782	1277.7820	R	F	2503	2515
PSM	VLNTNIDGR	3544	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7678	19.975	2	1000.5302	1000.5302	R	R	15	24
PSM	VLQLGQEASTHQAQNEEHR	3545	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7193	18.983	3	2174.0465	2174.0465	R	V	1156	1175
PSM	VNGRPLEMIEPR	3546	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=11863	28.2	3	1409.7449	1409.7449	K	T	34	46
PSM	VNTLIRPDGEK	3547	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=6593	17.581	2	1240.6776	1240.6776	K	K	124	135
PSM	VQDAVQQHQQK	3548	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=2157	8.7537	3	1307.6582	1307.6582	R	M	558	569
PSM	VQFAPEKPGPQPSAETTR	3549	sp|P32121|ARRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=8619	21.899	3	1938.9799	1938.9799	K	H	172	190
PSM	VQVEYKGETK	3550	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=4652	14.003	2	1179.6136	1179.6136	K	S	103	113
PSM	VSGSPSSGFR	3551	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5815	16.18	2	979.47231	979.4723	R	S	27	37
PSM	VSLLETLLQTQK	3552	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=24628	52.721	2	1371.7973	1371.7973	R	E	928	940
PSM	VTDALNATR	3553	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=5929	16.377	2	959.50361	959.5036	R	A	421	430
PSM	VTHVEPWEK	3554	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=7717	20.087	3	1123.5662	1123.5662	K	G	93	102
PSM	WDHESVCK	3555	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=4725	14.148	2	1059.4444	1059.4444	R	Y	29	37
PSM	WDYPEGTPNGGSTTLPSAPPPASAGLK	3556	sp|A0A0U1RRE5|NBDY_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=17133	38.257	3	2667.2817	2667.2817	R	S	34	61
PSM	WLNENAVEK	3557	sp|P23526|SAHH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=10080	24.607	2	1101.5455	1101.5455	K	V	310	319
PSM	WVTALESVVAGGR	3558	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=20174	44.078	2	1343.7197	1343.7197	R	V	1596	1609
PSM	YDGIILPGK	3559	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=13683	31.753	2	974.54368	974.5437	K	-	170	179
PSM	YGLIGLNGIGK	3560	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=18016	39.876	2	1103.6339	1103.6339	R	S	114	125
PSM	YQEYTNELQETLPQK	3561	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=14398	33.169	2	1882.8949	1882.8949	K	M	647	662
PSM	YSSSFCTHDR	3562	sp|P04183|KITH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	6-UNIMOD:4	ms_run[2]:scan=5361	15.297	3	1258.5037	1258.5037	R	N	61	71
PSM	YVASYLLAALGGNSSPSAK	3563	sp|P05387|RLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0		ms_run[2]:scan=23594	50.715	3	1867.968	1867.9680	R	D	3	22
PSM	YWLCAATGPSIK	3564	sp|P63244|RACK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	4-UNIMOD:4	ms_run[2]:scan=16713	37.514	2	1365.6751	1365.6751	R	I	246	258
PSM	YYDAIACLK	3565	sp|O00170|AIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	20.0	7-UNIMOD:4	ms_run[2]:scan=14529	33.4	2	1115.5321	1115.5321	K	N	202	211
PSM	GMFTVSDHTPEQR	3566	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10040	24.52378	3	1503.678189	1503.677627	R	G	183	196
PSM	TQGTLEGFKVETADLK	3567	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14561	33.458059	3	1735.905356	1735.899230	K	E	1333	1349
PSM	IQEFEAALK	3568	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12528	29.500816	2	1047.559311	1047.560061	R	A	1856	1865
PSM	AAHSAELEAVLLALAR	3569	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24932	53.308098	3	1633.915950	1633.915155	K	I	1885	1901
PSM	QRLEHLQQAVAR	3570	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=5898	16.315515	3	1447.801000	1447.800794	R	L	2270	2282
PSM	NDSLLQTLSPDSEHVTLK	3571	sp|Q99996|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17414	38.807694	3	1997.014670	1996.011300	R	R	3682	3700
PSM	CQEIEIYLK	3572	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=15413	35.208584	2	1194.595078	1194.595461	K	Q	1055	1064
PSM	QLQEAEQEMEEMKEK	3573	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12134	28.738138	3	1879.842862	1878.833929	K	M	1663	1678
PSM	DHANEELDELKR	3574	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8107	20.915726	3	1467.696190	1467.695386	R	K	2748	2760
PSM	MRLEGQLEALSLEASQALK	3575	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24214	51.894122	3	2086.110703	2086.109240	K	E	415	434
PSM	SQLVASQEK	3576	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=3960	12.431911	2	988.520542	988.518925	K	V	1759	1768
PSM	AGMQLNLEELQK	3577	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35	ms_run[1]:scan=13662	31.711219	2	1389.700799	1388.696966	K	K	329	341
PSM	VQQVEDLLTKR	3578	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12060	28.571312	3	1328.749301	1327.745965	K	I	153	164
PSM	LILAEAVMEGRPTPDK	3579	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16265	36.717523	3	1738.928550	1738.928756	K	T	989	1005
PSM	NRDVDTDFVNEFYAYLR	3580	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=25432	54.393774	3	2138.003368	2135.991233	R	K	725	742
PSM	CCYDHVISTSHK	3581	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=8726	22.074739	3	1489.6132	1488.6122	K	L	952	964
PSM	CCYDHVISTSHK	3582	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=8322	21.290848	3	1488.6116	1488.6121	K	L	952	964
PSM	SHKPPISFPLCANGQVFGLYK	3583	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:4	ms_run[1]:scan=28261	61.304358	4	2359.213849	2359.214708	K	N	997	1018
PSM	LKLFAAETLK	3584	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14721	33.764279	3	1132.685249	1132.685596	R	A	1053	1063
PSM	SHFAIGLALYYPSAR	3585	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=25425	54.380693	3	1664.869760	1664.867477	K	I	1212	1227
PSM	CPAEIVDTVSALVYDNK	3586	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=24785	53.027864	3	1892.918651	1892.918980	R	L	1367	1384
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	3587	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	32-UNIMOD:4	ms_run[1]:scan=26610	57.189302	3	4031.889967	4030.885455	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	3588	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	32-UNIMOD:4	ms_run[1]:scan=23398	50.327929	5	4030.884543	4030.885455	K	F	1448	1484
PSM	VGILCIMSDR	3589	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=14127	32.689799	2	1178.577717	1178.578765	K	D	1493	1503
PSM	SHKTPISFPLCANGQVFGLYK	3590	cov|corona00646|ORF1b_Japan/Donner20/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	11-UNIMOD:4	ms_run[1]:scan=21539	46.650822	4	2364.228642	2363.209623	K	N	997	1018
PSM	TSTAPAASPNVR	3591	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4608	13.91548	2	1170.599498	1170.599300	R	R	19	31
PSM	ASPSPTDPVVPAVPIGPPPAGFR	3592	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=20602	44.958313	3	2225.184155	2225.184454	K	D	520	543
PSM	VFDYSEYWEGAR	3593	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19699	43.172488	2	1520.655319	1520.657209	R	G	831	843
PSM	KLLEGEESR	3594	sp|P17661|DESM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4264	13.118406	3	1059.557087	1059.556038	R	I	407	416
PSM	VINEPTAAALAYGLDKSEDK	3595	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17222	38.420682	3	2104.068089	2104.068815	R	V	219	239
PSM	MVSLLSVLLSMQGAVDINK	3596	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:35,11-UNIMOD:35	ms_run[1]:scan=26886	57.909797	3	2049.089634	2049.085000	K	L	3911	3930
PSM	STLGDLDTVAGLEK	3597	sp|Q5VU43|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17906	39.678338	2	1417.730281	1417.730040	R	E	740	754
PSM	AEPVEVVAPR	3598	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=9302	23.100338	2	1066.585557	1065.581859	K	G	487	497
PSM	TAVCDIPPR	3599	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=8834	22.256521	2	1027.512655	1027.512065	K	G	351	360
PSM	TAVCDIPPR	3600	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	4-UNIMOD:4	ms_run[1]:scan=7348	19.324075	2	1027.512540	1027.512065	K	G	351	360
PSM	ISEQFTAMFR	3601	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=19083	41.869212	2	1228.590425	1228.591044	R	R	381	391
PSM	AAILQTEVDALR	3602	sp|O15083|ERC2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17124	38.240954	2	1298.718939	1298.719415	R	L	485	497
PSM	KNFYFLEMNTR	3603	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16813	37.687018	3	1461.704976	1461.707471	K	L	343	354
PSM	VTEDTSSVLR	3604	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7894	20.536008	2	1105.561506	1105.561518	K	S	654	664
PSM	ALMLQGVDLLADAVAVTMGPK	3605	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	3-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=27324	59.200067	3	2144.121044	2144.122114	R	G	38	59
PSM	TLNDELEIIEGMK	3606	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=23184	49.904043	2	1503.749441	1503.749061	K	F	206	219
PSM	NSLVSENEMMNEK	3607	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11468	27.412595	2	1523.664080	1523.659594	K	L	216	229
PSM	LISQIVSSITASLR	3608	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=26584	57.129159	2	1486.870995	1486.871893	R	F	230	244
PSM	LDHKFDLMYAK	3609	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	8-UNIMOD:35	ms_run[1]:scan=11882	28.232468	3	1396.689606	1395.685673	R	R	391	402
PSM	DLYANTVLSGGTTMYPGIADR	3610	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	14-UNIMOD:35	ms_run[1]:scan=19566	42.924834	3	2232.060541	2230.057599	K	M	292	313
PSM	VEYDKLANEK	3611	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=6746	18.039378	3	1207.606868	1207.608468	K	T	45	55
PSM	SMPGKPPGMDPIGIMASALR	3612	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22877	49.337772	3	2025.019582	2025.020959	R	T	339	359
PSM	IPEQTYITLK	3613	sp|Q5SW79|CE170_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14010	32.488795	2	1204.670571	1204.670340	R	L	73	83
PSM	AGGPTTPLSPTR	3614	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7799	20.32208	2	1154.612278	1153.609137	R	L	15	27
PSM	SMYEEEINETR	3615	sp|P20700|LMNB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10550	25.619274	2	1399.592947	1399.592560	K	R	210	221
PSM	IESIQLMMDSETGR	3616	sp|Q14498|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	7-UNIMOD:35	ms_run[1]:scan=14350	33.085651	2	1624.744012	1624.743658	R	S	276	290
PSM	DLEKPFLLPVEAVYSVPGR	3617	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=24466	52.402407	3	2128.156962	2128.156842	R	G	253	272
PSM	CGESGHLAR	3618	sp|P62633-4|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=5285	15.170912	2	968.4131	968.4129	R	E	162	171
PSM	LCDLEIMPSSEAADGEK	3619	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:4	ms_run[1]:scan=15388	35.165953	2	1864.831653	1863.823031	K	A	459	476
PSM	QQQLLNEENLR	3620	sp|Q9NVI7|ATD3A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=11546	27.552636	2	1383.711301	1383.710642	K	K	195	206
PSM	LLSRPQDVLEGVVLSPSLEAR	3621	sp|Q5T9A4|ATD3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22085	47.713144	3	2277.269140	2277.269246	R	V	307	328
PSM	ASTEATELLQNIR	3622	sp|O14578|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=17535	39.031455	2	1445.754038	1444.752172	K	Q	651	664
PSM	VPAINVNDSVTK	3623	sp|P23526|SAHH_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10616	25.739192	2	1255.677440	1255.677216	K	S	175	187
PSM	KPNEGADGQWK	3624	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4078	12.751659	3	1228.584240	1228.583650	R	K	310	321
PSM	AEPTVCSFLTK	3625	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:1,6-UNIMOD:4	ms_run[1]:scan=21298	46.22036	2	1293.6272	1293.6270	M	V	2	13
PSM	IDEPLEGSEDR	3626	sp|P61978|HNRPK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8830	22.25086	2	1258.567900	1258.567725	K	I	423	434
PSM	PSETPQAEVGPTGCPHR	3627	sp|P0DN79|CBSL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	14-UNIMOD:4	ms_run[1]:scan=6430	17.309	3	1818.8314	1818.8314	M	S	2	19
PSM	CPFTGNVSIR	3628	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=18744	41.241402	2	1132.5323	1132.5330	K	G	60	70
PSM	CPFTGNVSIR	3629	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=18790	41.326314	2	1132.5323	1132.5330	K	G	60	70
PSM	EFHLNESGDPSSK	3630	sp|P0DME0|SETLP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8086	20.877968	3	1445.643101	1445.642287	K	S	165	178
PSM	KADIDLTK	3631	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=4994	14.652668	2	902.506762	902.507297	R	R	47	55
PSM	ARPAEVGGMQLR	3632	sp|P33316|DUT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8452	21.572049	3	1283.674300	1283.676839	R	F	104	116
PSM	TAFQEALDAAGDK	3633	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=15342	35.085874	2	1335.630774	1335.630660	K	L	9	22
PSM	LMGFASFDSTK	3634	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	2-UNIMOD:35	ms_run[1]:scan=14247	32.899404	2	1218.559130	1218.559075	K	G	106	117
PSM	FGYHIIMVEGR	3635	sp|Q9Y237|PIN4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=15013	34.394212	3	1321.667560	1320.664877	K	K	120	131
PSM	FQTMSDQIIGR	3636	sp|O75506|HSBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13474	31.273653	2	1294.635952	1294.633971	K	I	27	38
PSM	AMGIMNSFVNDIFER	3637	sp|P33778|H2B1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:35	ms_run[1]:scan=23924	51.327529	2	1759.808445	1758.806927	K	I	59	74
PSM	NVVHQLSVTLEDLYNGATR	3638	sp|P31689|DNJA1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=25861	55.34669	3	2128.092574	2128.091282	K	K	106	125
PSM	GAQDVAGGSNPGAHNPSANLAR	3639	sp|O14654|IRS4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7279	19.160541	3	2060.982631	2059.978377	R	G	1177	1199
PSM	AGQSVIGLQMGTNK	3640	sp|Q15417|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=12597	29.638415	2	1402.723750	1402.723849	K	C	159	173
PSM	CPLDPYFIMPDK	3641	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=20987	45.653729	2	1495.690891	1494.688709	K	C	207	219
PSM	ASLENSLEETK	3642	sp|P02533|K1C14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10139	24.705924	2	1219.592387	1219.593212	K	G	353	364
PSM	TSMETALALEK	3643	sp|Q8NEZ5|FBX22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13378	31.100075	2	1192.601143	1192.600940	R	L	127	138
PSM	GHAVGDIPGVR	3644	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7884	20.516735	2	1077.575468	1076.572691	K	F	109	120
PSM	CGHTNNLRPK	3645	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:4	ms_run[1]:scan=1980	8.4755907	4	1196.589462	1195.588024	K	K	115	125
PSM	CGHTNNLRPK	3646	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	20.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=3751	11.995518	3	1178.5607	1178.5610	K	K	115	125
PSM	GSLGGGFSSGGFSGGSFSR	3647	sp|P13645|K1C10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=16188	36.587022	2	1706.769664	1706.764862	K	G	41	60
PSM	DQWYNVLEFSR	3648	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=23572	50.675433	2	1455.688368	1455.678279	K	T	195	206
PSM	TAYSGGAEDLER	3649	sp|Q9Y388|RBMX2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=8360	21.353913	2	1267.568794	1267.568060	R	E	229	241
PSM	AAESVSKPDVSEEAPGPSK	3650	sp|Q9BY42|RTF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=6905	18.372665	3	1883.912313	1883.911252	K	V	204	223
PSM	NKPGVYTK	3651	sp|Q9BYE2|TMPSD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=2196	8.8162113	2	905.496451	905.497067	R	V	539	547
PSM	AGVNFSEFTGVWK	3652	sp|O75340|PDCD6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=22752	49.093567	2	1441.705844	1440.703765	K	Y	78	91
PSM	VTIAQGGVLPNIQAVLLPK	3653	sp|P04908|H2A1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=25359	54.185179	2	1930.160545	1930.161534	R	K	101	120
PSM	QNAVLQAAQDDLGHLR	3654	sp|Q15276|RABE1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=18760	41.272716	3	1747.900622	1747.896545	R	T	60	76
PSM	NSNLVGAAHEELQQSR	3655	sp|P02545|LMNA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10795	26.187331	3	1752.857987	1751.855074	R	I	281	297
PSM	KSAACQDDLTQALEK	3656	sp|Q8TBY8|PMFBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	5-UNIMOD:4	ms_run[1]:scan=18577	40.939721	2	1676.796140	1676.803950	R	L	737	752
PSM	ETEVQLKPLVEK	3657	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=10685	25.898303	3	1413.796878	1411.792246	R	N	324	336
PSM	MEAYEQVQK	3658	sp|Q9Y421|FA32A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	1-UNIMOD:1	ms_run[1]:scan=14164	32.752514	2	1168.524806	1166.527775	-	G	1	10
PSM	LLEAISETSSQLEHAK	3659	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=15050	34.487593	3	1754.905030	1754.905044	K	V	1857	1873
PSM	SNDEEAFTFAR	3660	sp|P0DN79|CBSL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=13834	32.055702	2	1287.560398	1285.557495	K	M	326	337
PSM	INQFIEEIR	3661	sp|Q96LB3|IFT74_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=15353	35.105295	2	1160.612420	1160.618973	K	Q	333	342
PSM	NGSDGEEMTFSSLHQVR	3662	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=14403	33.176158	3	1894.820215	1892.832290	K	Y	1162	1179
PSM	GSAVDASVQEESPVTKEDSALCGGGDICK	3663	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0	22-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=12957	30.332501	3	2968.337806	2965.328096	K	S	43	72
PSM	APLEVAQEH	3664	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	20.0		ms_run[1]:scan=7030	18.644532	2	993.496486	992.492710	K	-	267	276
PSM	AAFTAFEEAQLPR	3665	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18373	40.553	2	1449.7252	1449.7252	R	L	171	184
PSM	ADFCIIHYAGK	3666	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=13952	32.378	3	1293.6176	1293.6176	K	V	566	577
PSM	ADYEIASK	3667	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6327	17.123	2	895.42871	895.4287	R	E	69	77
PSM	AEAEASEDTK	3668	sp|Q76N32-2|CEP68_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2110	8.683	2	1049.4513	1049.4513	K	A	8	18
PSM	AEAESLYQSK	3669	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7016	18.619	2	1124.535	1124.5350	K	Y	367	377
PSM	AEALQEALGK	3670	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10495	25.507	2	1028.5502	1028.5502	R	A	1963	1973
PSM	AENSAALGKPTAGTTDAGEAAK	3671	sp|Q96T17-5|MA7D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5837	16.215	3	2029.9916	2029.9916	K	I	329	351
PSM	AFADAMEVIPSTLAENAGLNPISTVTELR	3672	sp|P50991-2|TCPD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=27769	60.457	3	3029.538	3029.5380	R	N	423	452
PSM	AFQIMQEELR	3673	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16659	37.416	2	1263.6282	1263.6282	K	Q	2935	2945
PSM	AIETTDIISR	3674	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11243	27	2	1117.5979	1117.5979	R	H	153	163
PSM	AISTGSLASSTLNK	3675	sp|Q12923-3|PTN13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10845	26.269	2	1348.7198	1348.7198	R	L	906	920
PSM	ALDLFSDNAPPPELLEIINEDIAKR	3676	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=27713	60.358	3	2792.4596	2792.4596	R	T	262	287
PSM	ALEAELAALR	3677	sp|Q16352|AINX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17194	38.368	2	1055.5975	1055.5975	R	Q	121	131
PSM	ALEHSALAINHK	3678	sp|P17812|PYRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5565	15.705	3	1302.7044	1302.7044	K	L	320	332
PSM	ALELDSNLYR	3679	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14885	34.078	2	1192.6088	1192.6088	K	I	746	756
PSM	ALEQQVEEMR	3680	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11493	27.458	2	1231.5867	1231.5867	R	T	1536	1546
PSM	ALKDEIDVLR	3681	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13625	31.635	3	1170.6608	1170.6608	R	A	259	269
PSM	ALSAVSTQQK	3682	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4593	13.885	2	1031.5611	1031.5611	R	K	271	281
PSM	ALSTVTQEK	3683	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4744	14.184	2	975.52368	975.5237	K	L	3058	3067
PSM	ANSSATETINK	3684	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3318	11.089	2	1134.5517	1134.5517	K	L	1517	1528
PSM	AQMVQEDLEK	3685	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8538	21.765	2	1189.5649	1189.5649	K	T	449	459
PSM	ASITALEAK	3686	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9176	22.872	2	902.5073	902.5073	K	I	1807	1816
PSM	ASLWAQEAK	3687	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10626	25.756	2	1002.5134	1002.5134	R	A	1140	1149
PSM	ATDVMIAGK	3688	sp|P23526|SAHH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7284	19.172	2	904.4688	904.4688	R	V	206	215
PSM	ATVEELKEK	3689	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4586	13.868	3	1045.5655	1045.5655	K	L	225	234
PSM	AVLVDLEPGTMDSVR	3690	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:35	ms_run[2]:scan=15440	35.255	2	1616.808	1616.8080	R	S	63	78
PSM	CAQGCICK	3691	sp|P80297|MT1X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=2911	10.22	2	995.39869	995.3987	K	G	44	52
PSM	CCYDHVISTSHK	3692	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4,2-UNIMOD:4	ms_run[2]:scan=5909	16.336	4	1505.6391	1505.6391	K	L	952	964
PSM	CEAAFATK	3693	sp|P56270-2|MAZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=5411	15.388	2	896.4062	896.4062	K	D	371	379
PSM	CGESGHLAK	3694	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=2061	8.5964	3	957.43381	957.4338	R	D	50	59
PSM	CGYPGHLTFECR	3695	sp|Q8N9Q2|SR1IP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=11469	27.414	3	1495.6337	1495.6337	K	N	18	30
PSM	CPFTGNVSIR	3696	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=11732	27.928	2	1149.5601	1149.5601	K	G	60	70
PSM	CSELLLSK	3697	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	1-UNIMOD:4	ms_run[2]:scan=10305	25.059	2	948.49502	948.4950	K	E	2125	2133
PSM	DANGNSFATR	3698	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5375	15.321	2	1051.4683	1051.4683	K	L	212	222
PSM	DANLHHVACNIVK	3699	sp|Q9BV19|CA050_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:4	ms_run[2]:scan=8313	21.275	3	1489.746	1489.7460	R	K	102	115
PSM	DAVTYTEHAK	3700	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4762	14.217	2	1133.5353	1133.5353	R	R	69	79
PSM	DDNMFQIGK	3701	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:35	ms_run[2]:scan=10267	24.956	2	1082.4703	1082.4703	R	M	60	69
PSM	DEILPTTPISEQK	3702	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13865	32.144	2	1469.7613	1469.7613	K	G	215	228
PSM	DFMIQGGDFTR	3703	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17437	38.866	2	1285.5761	1285.5761	K	G	99	110
PSM	DHGLEVLGLVR	3704	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17740	39.384	3	1206.6721	1206.6721	R	V	134	145
PSM	DHVDELEPER	3705	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6726	17.996	3	1237.5575	1237.5575	K	H	576	586
PSM	DIDEVSSLLR	3706	sp|P50990|TCPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19197	42.124	2	1145.5928	1145.5928	R	T	156	166
PSM	DIGFIKLD	3707	sp|P62273|RS29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20584	44.927	1	919.50148	919.5015	K	-	49	57
PSM	DKLNNLVLFDK	3708	sp|P62851|RS25_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16212	36.625	3	1317.7293	1317.7293	R	A	42	53
PSM	DKSAQCFK	3709	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:4	ms_run[2]:scan=2638	9.585	2	982.45422	982.4542	K	M	1389	1397
PSM	DLEEDHACIPIKK	3710	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=8952	22.479	4	1566.7712	1566.7712	K	S	560	573
PSM	DLEEFFSTVGK	3711	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=24117	51.707	2	1270.6081	1270.6081	R	V	168	179
PSM	DLYDKLQFTSLEIPR	3712	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23106	49.758	3	1836.9622	1836.9622	R	R	1503	1518
PSM	DNTVHDLR	3713	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4197	12.98	2	968.46756	968.4676	K	Q	530	538
PSM	DNYVPEVSALDQEIIEVDPDTKEMLK	3714	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25544	54.609	3	2989.4478	2989.4478	R	L	82	108
PSM	DQLEQAQEER	3715	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6074	16.683	2	1244.5633	1244.5633	R	D	570	580
PSM	DQLEQQLQGLHR	3716	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12950	30.32	3	1463.7481	1463.7481	K	K	1753	1765
PSM	DQMSHLFNVAHTLR	3717	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16026	36.3	3	1667.8202	1667.8202	K	M	1935	1949
PSM	DQQLEALQQEHLDLMK	3718	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	15-UNIMOD:35	ms_run[2]:scan=17139	38.266	3	1953.9466	1953.9466	R	Q	709	725
PSM	DQVTAGAMQR	3719	sp|P78549-3|NTH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5870	16.268	2	1075.508	1075.5080	K	L	129	139
PSM	EAIEGTYIDK	3720	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9887	24.241	2	1137.5554	1137.5554	K	K	49	59
PSM	EALESSHLEGELLR	3721	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13978	32.424	3	1581.7999	1581.7999	R	Q	547	561
PSM	EAYPGDVFYLHSR	3722	sp|P25705-2|ATPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15352	35.104	3	1552.731	1552.7310	R	L	285	298
PSM	EDAANNYAR	3723	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3936	12.384	2	1022.4417	1022.4417	K	G	97	106
PSM	EDAVLEYLK	3724	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17508	38.988	2	1078.5546	1078.5546	R	I	185	194
PSM	EGANLLSMLK	3725	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20533	44.838	2	1074.5743	1074.5743	R	A	1136	1146
PSM	EGLPLMVFANWR	3726	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26986	58.214	2	1431.7333	1431.7333	R	G	2036	2048
PSM	EGPMFEAMIMNR	3727	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21128	45.918	2	1424.6251	1424.6251	R	E	441	453
PSM	ELAENNHILER	3728	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8370	21.371	3	1336.6735	1336.6735	K	F	703	714
PSM	ELELKHEAEVTNYK	3729	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8981	22.536	3	1701.8574	1701.8574	K	I	584	598
PSM	ELGIWEPLAVK	3730	sp|P49368-2|TCPG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21812	47.142	2	1253.702	1253.7020	K	L	454	465
PSM	EMDEEDKAFK	3731	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35	ms_run[2]:scan=4584	13.865	3	1256.5231	1256.5231	K	Q	21	31
PSM	EMEAELEDER	3732	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9505	23.442	2	1249.5132	1249.5132	R	K	1593	1603
PSM	EPFTIAQGK	3733	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10193	24.799	2	989.5182	989.5182	R	G	76	85
PSM	EQESQAAAEK	3734	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2104	8.6744	2	1089.4938	1089.4938	R	L	819	829
PSM	EQLAIAEFAR	3735	sp|P17987|TCPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16863	37.775	2	1146.6033	1146.6033	R	S	434	444
PSM	EREEFLIPIYHQVAVQFADLHDTPGR	3736	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23791	51.081	5	3079.5516	3079.5516	K	M	2170	2196
PSM	EREGLQSSAWTEEK	3737	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9145	22.819	3	1648.7693	1648.7693	R	V	741	755
PSM	ERETEELYQVIEGQNDTMAK	3738	sp|Q5VU43-13|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17801	39.491	3	2382.1009	2382.1009	R	L	457	477
PSM	ERHPGSFDVVHVK	3739	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6862	18.29	4	1505.7739	1505.7739	R	D	199	212
PSM	ERQEAEEAK	3740	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1850	8.273	3	1088.5098	1088.5098	K	E	392	401
PSM	ESEVLEGAER	3741	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7261	19.117	2	1117.5251	1117.5251	K	V	849	859
PSM	ESQLTALQAAR	3742	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10606	25.719	2	1186.6306	1186.6306	R	A	929	940
PSM	ETEAAQMEHQK	3743	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3464	11.4	3	1300.5718	1300.5718	R	E	273	284
PSM	ETEQNYEAEIHCLQK	3744	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	12-UNIMOD:4	ms_run[2]:scan=12272	29	3	1890.8418	1890.8418	K	R	1356	1371
PSM	ETGQQIGDEVR	3745	sp|Q9GZT9|EGLN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6979	18.544	2	1230.584	1230.5840	K	A	217	228
PSM	ETNLDSLPLVDTHSK	3746	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14172	32.765	2	1667.8366	1667.8366	R	R	425	440
PSM	ETNMTSLQK	3747	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5968	16.461	2	1050.5016	1050.5016	K	D	2715	2724
PSM	EYVESQLQR	3748	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8501	21.696	2	1150.5619	1150.5619	R	T	288	297
PSM	EYWMDPEGEMKPGR	3749	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:35	ms_run[2]:scan=12201	28.874	3	1739.7283	1739.7283	R	K	87	101
PSM	EYWMDPEGEMKPGR	3750	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14654	33.626	3	1723.7334	1723.7334	R	K	87	101
PSM	FANYIDKVR	3751	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10079	24.605	3	1124.5978	1124.5978	R	F	114	123
PSM	FGAYIVDGLR	3752	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17455	38.898	2	1109.5869	1109.5869	K	E	2063	2073
PSM	FGDSNTVMR	3753	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7889	20.526	2	1025.46	1025.4600	K	F	917	926
PSM	FIGPSPEVVR	3754	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12054	28.561	2	1099.6026	1099.6026	R	K	138	148
PSM	FISTCACEIVGGQIVTCAK	3755	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4,7-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=17880	39.629	3	2113.0006	2113.0006	K	E	651	670
PSM	FKDPNAPK	3756	sp|P09429|HMGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3385	11.248	3	915.48142	915.4814	K	R	89	97
PSM	FLQDYFDGNLKR	3757	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16305	36.791	3	1514.7518	1514.7518	R	Y	352	364
PSM	FQDELESGK	3758	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8026	20.769	2	1051.4822	1051.4822	K	R	854	863
PSM	FSPNSSNPIIVSCGWDK	3759	sp|P63244|RACK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:4	ms_run[2]:scan=17685	39.289	2	1906.8883	1906.8883	R	L	156	173
PSM	FVLSQAKDEL	3760	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15225	34.851	2	1148.6077	1148.6077	R	-	423	433
PSM	FVVTGSKDETIHIYDMK	3761	sp|Q9NWT1|PK1IP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14024	32.511	4	1981.9819	1981.9819	R	K	54	71
PSM	FYSVNVDYSK	3762	sp|O00483|NDUA4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12985	30.379	2	1220.5714	1220.5714	K	L	64	74
PSM	GALQNIIPASTGAAK	3763	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14335	33.058	2	1410.7831	1410.7831	R	A	201	216
PSM	GDDETLHK	3764	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2267	8.9404	2	913.41412	913.4141	R	N	1099	1107
PSM	GGAYYPVTVK	3765	sp|Q9HCC0|MCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10344	25.158	2	1053.5495	1053.5495	K	K	142	152
PSM	GKDSLYAQGK	3766	sp|P83881|RL36A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3593	11.67	2	1065.5455	1065.5455	K	R	29	39
PSM	GPLMMYISK	3767	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15978	36.213	2	1038.5242	1038.5242	K	M	392	401
PSM	GQIGAPMPGK	3768	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7403	19.468	2	954.49569	954.4957	K	V	1110	1120
PSM	GSADYSMEAK	3769	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5905	16.328	2	1057.4386	1057.4386	R	K	216	226
PSM	GSPWVSVVDR	3770	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14956	34.212	2	1100.5615	1100.5615	R	V	264	274
PSM	GTPLDTEVPMER	3771	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	10-UNIMOD:35	ms_run[2]:scan=10431	25.369	2	1359.634	1359.6340	R	V	819	831
PSM	GVEICIATPGR	3772	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4	ms_run[2]:scan=13144	30.66	2	1171.6019	1171.6019	R	L	217	228
PSM	GVQTLVIGR	3773	sp|Q9H7C9|AAMDC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11622	27.688	2	941.56581	941.5658	K	G	61	70
PSM	HGGGGGGFGGGGFGSR	3774	sp|P35908|K22E_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7234	19.064	3	1319.5755	1319.5755	R	S	46	62
PSM	HLQLAIR	3775	sp|Q99878|H2A1J_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8765	22.142	2	849.51847	849.5185	R	N	83	90
PSM	HNNLDLVIIR	3776	sp|O43837|IDH3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14367	33.114	3	1205.6881	1205.6881	R	E	155	165
PSM	HSGSSHLPQQLK	3777	sp|Q08117|TLE5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4100	12.799	3	1317.6789	1317.6789	R	F	8	20
PSM	HVYTGGK	3778	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1948	8.4269	2	760.38679	760.3868	R	G	500	507
PSM	HWPFMVVNDAGRPK	3779	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14566	33.465	4	1652.8246	1652.8246	K	V	89	103
PSM	IAELNSVIR	3780	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12857	30.121	2	1013.5869	1013.5869	K	K	294	303
PSM	IAGLEEEKQK	3781	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5068	14.802	2	1143.6136	1143.6136	R	N	1854	1864
PSM	IAIPGLAGAGNSVLLVSNLNPER	3782	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25132	53.692	3	2274.2696	2274.2696	R	V	326	349
PSM	IAPYVAHNFSK	3783	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8933	22.43	2	1245.6506	1245.6506	K	L	590	601
PSM	IAPYVAHNFSK	3784	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8944	22.46	3	1245.6506	1245.6506	K	L	590	601
PSM	IEVLEEELR	3785	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15204	34.804	2	1128.6027	1128.6027	K	L	1034	1043
PSM	IKGEHPGLSIGDVAK	3786	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8922	22.409	4	1519.8358	1519.8358	K	K	113	128
PSM	IKLEMLEK	3787	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11951	28.35	3	1002.5784	1002.5784	K	E	598	606
PSM	IKSEHPGLSIGDTAK	3788	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6602	17.596	4	1551.8257	1551.8257	K	K	113	128
PSM	ILAEGGGAK	3789	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3859	12.22	2	814.45487	814.4549	K	F	80	89
PSM	ILFRPVASQLPR	3790	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14023	32.51	3	1395.8351	1395.8351	R	I	94	106
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	3791	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	32-UNIMOD:4	ms_run[2]:scan=23411	50.354	5	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	3792	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	32-UNIMOD:4	ms_run[2]:scan=29155	62.913	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILSLCPEIK	3793	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4	ms_run[2]:scan=15069	34.523	2	1071.5998	1071.5998	K	W	82	91
PSM	IMLPWDPTGK	3794	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21299	46.222	2	1156.5951	1156.5951	K	I	188	198
PSM	INGWAVECR	3795	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=11449	27.375	2	1103.5182	1103.5182	R	V	391	400
PSM	IPDWFLNR	3796	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20420	44.596	2	1059.5502	1059.5502	K	Q	79	87
PSM	IPVQAVWAGWGHASENPK	3797	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17866	39.605	3	1945.9799	1945.9799	R	L	200	218
PSM	IQLVEEELDRAQER	3798	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14534	33.408	3	1726.885	1726.8850	R	L	56	70
PSM	ITPSYVAFTPEGER	3799	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15363	35.124	2	1565.7726	1565.7726	R	L	61	75
PSM	IVELLNETEK	3800	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12874	30.172	2	1186.6445	1186.6445	R	Y	3351	3361
PSM	IYGADDIELLPEAQHK	3801	sp|P11586|C1TC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16971	37.969	3	1810.9101	1810.9101	K	A	833	849
PSM	KAAAPAPEEEMDECEQALAAEPK	3802	sp|P26641|EF1G_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	14-UNIMOD:4	ms_run[2]:scan=14491	33.332	3	2484.1149	2484.1149	K	A	253	276
PSM	KANLQIDQINTDLNLER	3803	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16481	37.102	3	1997.0542	1997.0542	K	S	1754	1771
PSM	KAQCPIVER	3804	sp|P46782|RS5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=4109	12.816	3	1099.5808	1099.5808	R	L	63	72
PSM	KDHVDELEPER	3805	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5115	14.883	3	1365.6525	1365.6525	R	H	575	586
PSM	KGDYLGK	3806	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2937	10.269	2	779.41775	779.4178	R	T	103	110
PSM	KGLTPSQIGVILR	3807	sp|P62277|RS13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15349	35.1	3	1380.8453	1380.8453	K	D	43	56
PSM	KGTHFVQLCCQR	3808	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=6465	17.371	4	1532.734	1532.7340	K	N	383	395
PSM	KICANDAIPK	3809	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4	ms_run[2]:scan=6147	16.807	2	1128.5961	1128.5961	R	T	160	170
PSM	KIEISQHAK	3810	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2583	9.4863	3	1052.5978	1052.5978	K	Y	28	37
PSM	KIEISQHAK	3811	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2585	9.489	2	1052.5978	1052.5978	K	Y	28	37
PSM	KLEDGPK	3812	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2093	8.6578	2	785.42832	785.4283	K	F	386	393
PSM	KLGELQEK	3813	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4272	13.14	2	943.53385	943.5338	K	L	583	591
PSM	KLQAALISR	3814	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7606	19.844	2	998.62366	998.6237	R	K	1489	1498
PSM	KLTVNPGTK	3815	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3537	11.551	2	956.56548	956.5655	K	S	654	663
PSM	KLVWVPSDK	3816	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10902	26.368	2	1070.6124	1070.6124	K	S	30	39
PSM	KPANDITSQLEINFGDLGR	3817	sp|Q8NC51-3|PAIRB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21521	46.62	3	2087.0647	2087.0647	R	P	331	350
PSM	KTQNDVLHAENVK	3818	sp|P35241|RADI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4941	14.543	3	1494.7791	1494.7791	K	A	544	557
PSM	KVDDDLGTIESLEEAK	3819	sp|P35580|MYH10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16424	36.998	3	1760.868	1760.8680	K	K	1379	1395
PSM	KVEAPFIPK	3820	sp|P17612|KAPCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10190	24.795	2	1027.6066	1027.6066	R	F	310	319
PSM	KVNNADDFPNLFR	3821	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16558	37.235	2	1548.7685	1548.7685	R	Q	323	336
PSM	LAALPNVYEVISK	3822	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=21405	46.411	2	1415.8024	1415.8024	R	S	325	338
PSM	LAAVDATVNQVLASR	3823	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19142	41.971	3	1526.8417	1526.8417	K	Y	214	229
PSM	LAGTSGSDK	3824	sp|Q9P016|THYN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2055	8.5861	2	834.40831	834.4083	R	G	8	17
PSM	LALGIPLPELR	3825	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23544	50.621	2	1190.7387	1190.7387	K	N	709	720
PSM	LDHKFDLMYAK	3826	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11846	28.173	4	1379.6908	1379.6908	R	R	391	402
PSM	LEAMCFDGVKR	3827	sp|P47813|IF1AX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4	ms_run[2]:scan=11451	27.382	3	1324.6268	1324.6268	R	L	47	58
PSM	LEGLTDEINFLR	3828	sp|P05787|K2C8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=22533	48.707	2	1418.7405	1418.7405	R	Q	214	226
PSM	LELALSMIK	3829	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19896	43.592	2	1016.594	1016.5940	K	G	288	297
PSM	LEPSEGHSQELPWVHLQGVQDGDLEADTER	3830	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18734	41.224	4	3370.5702	3370.5702	R	A	637	667
PSM	LESTVEIYR	3831	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11061	26.683	2	1108.5764	1108.5764	K	Q	277	286
PSM	LEVNLQAMK	3832	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13823	32.028	2	1044.5638	1044.5638	R	A	1558	1567
PSM	LFIVESNSSSSTR	3833	sp|P48507|GSH0_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11877	28.226	2	1425.71	1425.7100	K	S	95	108
PSM	LGFAGLVQEISFGTTK	3834	sp|P48643|TCPE_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26067	55.811	2	1666.893	1666.8930	K	D	353	369
PSM	LIADVAPSAIR	3835	sp|P39748|FEN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12907	30.245	2	1124.6554	1124.6554	K	E	9	20
PSM	LKLFAAETLK	3836	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13650	31.687	3	1132.6856	1132.6856	R	A	1053	1063
PSM	LKNEEVESER	3837	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3317	11.087	3	1231.6044	1231.6044	K	E	1390	1400
PSM	LLGELHTLR	3838	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11232	26.98	3	1050.6186	1050.6186	K	D	413	422
PSM	LLLPGELAK	3839	sp|Q99880|H2B1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15617	35.579	2	952.59572	952.5957	R	H	101	110
PSM	LLQAETASNSAR	3840	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6053	16.648	2	1259.647	1259.6470	R	A	1271	1283
PSM	LLQDFFNGR	3841	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18569	40.928	2	1108.5665	1108.5665	K	D	349	358
PSM	LLQSQLQVK	3842	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9904	24.271	2	1055.6339	1055.6339	K	K	25	34
PSM	LLTEQLSQR	3843	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9998	24.437	2	1086.6033	1086.6033	R	T	2766	2775
PSM	LNEMSYELK	3844	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11966	28.375	2	1125.5376	1125.5376	K	C	425	434
PSM	LNQQLLSK	3845	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7961	20.658	2	942.54983	942.5498	K	D	2811	2819
PSM	LPEMEPLVPR	3846	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16175	36.563	2	1179.6322	1179.6322	R	V	1908	1918
PSM	LPFPIIDDR	3847	sp|P30041|PRDX6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19641	43.063	2	1084.5917	1084.5917	K	N	98	107
PSM	LQAENTALQK	3848	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5861	16.255	2	1114.5982	1114.5982	R	N	140	150
PSM	LQATLNVLR	3849	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13821	32.022	2	1026.6186	1026.6186	R	D	113	122
PSM	LQEEERER	3850	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2263	8.9322	2	1087.5258	1087.5258	K	R	73	81
PSM	LQELQEEAAR	3851	sp|Q96CN9|GCC1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7804	20.337	2	1185.599	1185.5990	R	L	320	330
PSM	LQEMEGTVK	3852	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6474	17.387	2	1033.5114	1033.5114	K	S	1794	1803
PSM	LQFTSLEIPRR	3853	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15420	35.222	3	1358.767	1358.7670	K	N	1508	1519
PSM	LQSLTENLTK	3854	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11001	26.57	2	1145.6292	1145.6292	R	E	1706	1716
PSM	LSCEAQLVK	3855	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4	ms_run[2]:scan=8397	21.423	2	1046.543	1046.5430	K	A	851	860
PSM	LSKEDIER	3856	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4885	14.438	2	988.51892	988.5189	R	M	510	518
PSM	LSKEEIER	3857	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4344	13.332	2	1002.5346	1002.5346	R	M	510	518
PSM	LSNIFVIGK	3858	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17221	38.419	2	989.59097	989.5910	R	G	222	231
PSM	LSSSMNSIK	3859	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6542	17.5	2	965.48518	965.4852	K	T	179	188
PSM	LSYGIATVR	3860	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14774	33.873	2	978.54983	978.5498	K	E	1070	1079
PSM	LSYGIATVR	3861	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12281	29.015	2	978.54983	978.5498	K	E	1070	1079
PSM	LTGVFAPR	3862	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11032	26.634	2	859.49159	859.4916	K	P	23	31
PSM	LTVAENEAETK	3863	sp|P07814|SYEP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6232	16.956	2	1203.5983	1203.5983	K	L	1390	1401
PSM	LTVEDLEKER	3864	sp|Q15691|MARE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12437	29.287	3	1230.6456	1230.6456	K	D	205	215
PSM	LVEQLKEER	3865	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6067	16.673	2	1142.6295	1142.6295	K	E	161	170
PSM	LVHPGVAEVVFVK	3866	sp|Q9BY77-2|PDIP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14347	33.079	3	1392.8129	1392.8129	R	K	282	295
PSM	LVILANNCPALR	3867	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=15284	34.98	3	1352.7598	1352.7598	K	K	45	57
PSM	LVSYTPAYLEGSCK	3868	sp|Q9UKT4-2|FBX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:4	ms_run[2]:scan=14784	33.893	2	1586.765	1586.7650	R	D	25	39
PSM	LVTGHHLWASK	3869	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6859	18.286	3	1247.6775	1247.6775	R	N	1712	1723
PSM	MAVTFIGNSTAIQELFK	3870	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26211	56.133	2	1868.9706	1868.9706	K	R	363	380
PSM	MEETPTEYLQR	3871	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12623	29.687	2	1395.634	1395.6340	R	G	665	676
PSM	MFGGPGTASR	3872	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7524	19.693	2	979.45455	979.4546	R	P	14	24
PSM	MGDKVEAR	3873	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2359	9.1009	2	904.44365	904.4437	K	A	149	157
PSM	MLENTDNSSPSTEHSQGLEK	3874	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6580	17.56	3	2202.9699	2202.9699	K	Q	249	269
PSM	MLQQQEQLR	3875	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7181	18.963	2	1172.5972	1172.5972	R	A	286	295
PSM	MNVLADALK	3876	sp|P62244|RS15A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15610	35.567	2	973.52665	973.5267	R	S	4	13
PSM	NEETAQVVR	3877	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4771	14.233	2	1044.52	1044.5200	K	K	1299	1308
PSM	NFSDNQLQEGK	3878	sp|P37802|TAGL2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8130	20.955	2	1278.584	1278.5840	R	N	161	172
PSM	NHPGLLLMDTTFR	3879	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:35	ms_run[2]:scan=17946	39.75	3	1529.766	1529.7660	R	D	559	572
PSM	NLDIERPTYTNLNR	3880	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12353	29.143	2	1717.8747	1717.8747	R	L	216	230
PSM	NLNGTLHELLR	3881	sp|P54886-2|P5CS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16906	37.852	3	1278.7044	1278.7044	R	M	202	213
PSM	NMSVHLSPCFR	3882	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=9917	24.295	3	1362.6173	1362.6173	K	D	108	119
PSM	NQELSQSVSSTTRPLLR	3883	sp|P82094|TMF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11936	28.322	3	1915.0123	1915.0123	R	Q	757	774
PSM	NQIQDQEQLVSK	3884	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9261	23.026	2	1428.7209	1428.7209	K	L	2529	2541
PSM	NTQSNEDLK	3885	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2564	9.4547	2	1047.4833	1047.4833	K	Q	303	312
PSM	NVVHQLSVTLEDLYNGATR	3886	sp|P31689-2|DNJA1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25880	55.388	3	2128.0913	2128.0913	K	K	106	125
PSM	PAPPKPEPK	3887	sp|P05204|HMGN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2562	9.4518	2	959.54402	959.5440	K	P	32	41
PSM	PLISVYSEK	3888	sp|P36578|RL4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12367	29.166	2	1034.5648	1034.5648	R	G	6	15
PSM	PMFIVNTNVPR	3889	sp|P14174|MIF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=16154	36.526	2	1286.6805	1286.6805	M	A	2	13
PSM	QALSGFGYR	3890	sp|O75340|PDCD6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11952	28.351	2	997.49813	997.4981	K	L	117	126
PSM	QANPSVLER	3891	sp|Q8NDD1|CA131_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6855	18.278	2	1012.5302	1012.5302	K	D	151	160
PSM	QAVDVSPLR	3892	sp|P46782|RS5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9669	23.735	2	983.53999	983.5400	R	R	137	146
PSM	QDQQQLDRPFNR	3893	sp|Q92576-2|PHF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8097	20.899	3	1543.7492	1543.7492	R	G	1816	1828
PSM	QEYEQLIAK	3894	sp|P35527|K1C9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11034	26.637	2	1120.5764	1120.5764	R	N	328	337
PSM	QFQGHTDGASCIDISHDGTK	3895	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:4	ms_run[2]:scan=8211	21.099	4	2172.9494	2172.9494	R	L	613	633
PSM	QGPGPGGPK	3896	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2318	9.0287	2	793.40825	793.4083	K	G	200	209
PSM	QHLENDPGSNEDTDIPK	3897	sp|O43396|TXNL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7499	19.645	3	1907.8497	1907.8497	K	G	105	122
PSM	QIQDMAEEK	3898	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6397	17.253	2	1090.4965	1090.4965	K	G	544	553
PSM	QKPEEIGEESR	3899	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4031	12.635	3	1300.6259	1300.6259	K	A	1471	1482
PSM	QLEEAEEEATR	3900	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6976	18.535	2	1303.5892	1303.5892	R	A	1885	1896
PSM	QLFHPEQLITGK	3901	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15310	35.031	3	1409.7667	1409.7667	R	E	85	97
PSM	QLLEVQLQQNK	3902	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13283	30.928	2	1339.746	1339.7460	K	E	2558	2569
PSM	QLNENKQER	3903	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1985	8.4821	2	1157.5789	1157.5789	R	D	10	19
PSM	QLSQQLNGLVCESATCVNGEGPASSANLK	3904	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=18639	41.049	4	3031.4339	3031.4339	R	D	129	158
PSM	QQYESVAAK	3905	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4627	13.951	2	1022.5033	1022.5033	R	N	274	283
PSM	QVAQQEAER	3906	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2504	9.3563	2	1057.5152	1057.5152	K	A	187	196
PSM	QVDQLTNDK	3907	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4837	14.345	2	1059.5197	1059.5197	R	A	160	169
PSM	QVLDNLTMEK	3908	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:35	ms_run[2]:scan=10694	25.939	2	1205.5962	1205.5962	R	S	262	272
PSM	RAQELALLQSR	3909	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11327	27.154	3	1283.731	1283.7310	R	Q	288	299
PSM	RFVNVVPTFGK	3910	sp|P62861|RS30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14063	32.579	2	1262.7135	1262.7135	R	K	41	52
PSM	RGPCIIYNEDNGIIK	3911	sp|P36578|RL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=13064	30.513	3	1760.888	1760.8880	R	A	205	220
PSM	RLAHLLASAQK	3912	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5576	15.723	3	1206.7197	1206.7197	R	E	767	778
PSM	RLIDLHSPSEIVK	3913	sp|P60866|RS20_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12105	28.655	3	1505.8566	1505.8566	K	Q	87	100
PSM	RPVINAGDGVGEHPTQALLDIFTIR	3914	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23453	50.434	4	2688.4347	2688.4347	R	E	2040	2065
PSM	RQEEVLAR	3915	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3820	12.145	2	999.54614	999.5461	K	A	719	727
PSM	RQILETMQNDR	3916	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	7-UNIMOD:35	ms_run[2]:scan=4976	14.611	3	1418.6936	1418.6936	R	T	522	533
PSM	RQLQQAAQEQAALR	3917	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7159	18.921	3	1609.8649	1609.8649	R	E	1370	1384
PSM	RQVDQLTNDK	3918	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4015	12.598	3	1215.6208	1215.6208	R	A	159	169
PSM	RVDPVYIHLAER	3919	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11283	27.071	4	1466.7994	1466.7994	R	L	2139	2151
PSM	RVLQALEGLK	3920	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12158	28.794	3	1125.687	1125.6870	R	M	102	112
PSM	SALLSQMK	3921	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9765	23.97	2	876.47389	876.4739	R	I	1430	1438
PSM	SDGIYIINLK	3922	sp|P08865|RSSA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18478	40.755	2	1134.6285	1134.6285	K	R	43	53
PSM	SECQDMSLSSPTSVLGGSR	3923	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4	ms_run[2]:scan=15611	35.568	3	1996.883	1996.8830	K	H	2183	2202
PSM	SEHPGLSIGDTAK	3924	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7550	19.741	3	1310.6466	1310.6466	K	K	115	128
PSM	SEQEFQEQLESARR	3925	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11269	27.046	3	1735.8125	1735.8125	R	E	220	234
PSM	SESVVSGLDSPAK	3926	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9909	24.281	2	1274.6354	1274.6354	R	T	431	444
PSM	SETDKETSLVK	3927	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4943	14.546	3	1235.6245	1235.6245	K	Q	732	743
PSM	SFLLDLLNATGK	3928	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26558	57.054	2	1290.7184	1290.7184	R	D	413	425
PSM	SGDAAIVDMVPGKPMCVESFSDYPPLGR	3929	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:35,15-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=18530	40.859	3	3026.3824	3026.3824	K	F	396	424
PSM	SGGASHSELIHNLRK	3930	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5145	14.931	5	1604.8383	1604.8383	K	N	5	20
PSM	SHKPPISFPLCANGQVFGLYK	3931	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:4	ms_run[2]:scan=23685	50.889	4	2359.2147	2359.2147	K	N	997	1018
PSM	SIAPSIFGGTDMK	3932	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17037	38.083	2	1322.654	1322.6540	K	K	338	351
PSM	SICEVLDLER	3933	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4	ms_run[2]:scan=17634	39.201	2	1232.6071	1232.6071	K	S	159	169
PSM	SINPDEAVAYGAAVQAAILSGDK	3934	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=26293	56.364	3	2259.1383	2259.1383	K	S	362	385
PSM	SITNTTVCTK	3935	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=5416	15.399	2	1123.5543	1123.5543	R	C	272	282
PSM	SKTAGEEEMIK	3936	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4871	14.406	3	1221.5911	1221.5911	K	I	169	180
PSM	SLQEELSLAR	3937	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14955	34.211	2	1144.6088	1144.6088	K	G	1506	1516
PSM	SMQNHAAVFR	3938	sp|P31040-3|SDHA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6073	16.681	3	1159.5557	1159.5557	K	V	373	383
PSM	SPFAEGTSAR	3939	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6392	17.241	2	1021.4829	1021.4829	R	T	301	311
PSM	SPMVSFGAVGFDPHPPMR	3940	sp|Q04726|TLE3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18965	41.652	3	1927.9073	1927.9073	R	A	413	431
PSM	SPTNVSPNCPPAEATALPFSGPR	3941	sp|Q76N32-2|CEP68_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:4	ms_run[2]:scan=16397	36.951	3	2366.1325	2366.1325	K	E	349	372
PSM	SPYQEFTDHLVK	3942	sp|P15880|RS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15462	35.293	2	1462.7092	1462.7092	K	T	264	276
PSM	SQEAQSLQQQR	3943	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4347	13.336	3	1301.6324	1301.6324	K	D	602	613
PSM	SQLNDISSFK	3944	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12402	29.227	2	1137.5666	1137.5666	R	N	130	140
PSM	SQLVASQEK	3945	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3969	12.45	2	988.51892	988.5189	K	V	1759	1768
PSM	SQQIQQMADK	3946	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5865	16.261	2	1175.5605	1175.5605	K	I	725	735
PSM	SREETGLLMPLK	3947	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	9-UNIMOD:35	ms_run[2]:scan=10900	26.365	3	1388.7334	1388.7334	K	A	723	735
PSM	SRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVK	3948	sp|Q00013|EM55_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13090	30.56	4	3336.6045	3336.6045	R	G	31	63
PSM	SSATIQNETPK	3949	sp|Q5HYJ3|FA76B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4868	14.402	2	1174.583	1174.5830	K	K	207	218
PSM	SSPSDTRPK	3950	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1959	8.4472	2	973.48287	973.4829	R	C	169	178
PSM	STLLLLLTGK	3951	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=24026	51.535	2	1057.6747	1057.6747	K	L	627	637
PSM	STMKPVQK	3952	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2088	8.6481	2	917.50044	917.5004	R	V	337	345
PSM	SVHSSVPLLNSK	3953	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9220	22.95	3	1266.6932	1266.6932	K	D	1905	1917
PSM	TAEAELSR	3954	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4675	14.047	2	875.43486	875.4349	R	L	896	904
PSM	TALLGGGQR	3955	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6574	17.55	2	871.48756	871.4876	R	R	45	54
PSM	TAVCDIPPR	3956	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4	ms_run[2]:scan=8711	22.051	2	1027.5121	1027.5121	K	G	351	360
PSM	TAYSGGAEDLER	3957	sp|Q9Y388|RBMX2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8288	21.234	2	1267.5681	1267.5681	R	E	229	241
PSM	TGKPEEASLDSR	3958	sp|Q9BY42|RTF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4380	13.403	3	1288.6259	1288.6259	K	E	225	237
PSM	TGPGAHHGAAPR	3959	sp|Q16587-5|ZNF74_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=1877	8.3156	3	1127.5584	1127.5584	R	R	104	116
PSM	TGTAYTFFTPNNIK	3960	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=18069	39.976	2	1573.7777	1573.7777	K	Q	438	452
PSM	THNLEPYFESFINNLR	3961	sp|P04264|K2C1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=24998	53.433	3	1992.9694	1992.9694	R	R	224	240
PSM	TIAQDYGVLK	3962	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=12707	29.834	2	1106.5972	1106.5972	R	A	111	121
PSM	TIEDDLVSALVR	3963	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=24373	52.215	2	1329.714	1329.7140	K	S	83	95
PSM	TIGPDMFLGTCR	3964	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=15959	36.178	3	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	3965	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=18510	40.824	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TIGPDMFLGTCR	3966	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	11-UNIMOD:4	ms_run[2]:scan=21094	45.861	2	1366.6373	1366.6373	K	R	1354	1366
PSM	TIVITSHPGQIVK	3967	sp|P31689-2|DNJA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9959	24.368	3	1391.8136	1391.8136	R	H	284	297
PSM	TLLQQNQQLK	3968	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8994	22.56	2	1212.6826	1212.6826	K	L	1362	1372
PSM	TLQTEQEANTEGQKK	3969	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3622	11.724	3	1703.8326	1703.8326	K	M	3382	3397
PSM	TNQLMETLK	3970	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=11949	28.347	2	1076.5536	1076.5536	K	T	2443	2452
PSM	TPAQAAFEK	3971	sp|Q9Y421|FA32A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6455	17.352	2	961.4869	961.4869	R	M	59	68
PSM	TPETTESQVK	3972	sp|P82094|TMF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3505	11.485	2	1118.5455	1118.5455	R	D	144	154
PSM	TQEQNIQHLNHSLSHK	3973	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5558	15.693	4	1912.9504	1912.9504	R	E	594	610
PSM	TSEVNCYR	3974	sp|P62633-2|CNBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	6-UNIMOD:4	ms_run[2]:scan=4704	14.105	2	1027.4393	1027.4393	K	C	146	154
PSM	TSGQTFANSNSSR	3975	sp|Q99661-2|KIF2C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4183	12.955	2	1355.6066	1355.6066	R	S	403	416
PSM	TSMETALALEK	3976	sp|Q8NEZ5|FBX22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13357	31.065	2	1192.6009	1192.6009	R	L	127	138
PSM	TTAQYDQASTK	3977	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=3698	11.888	2	1212.5622	1212.5622	R	Y	346	357
PSM	TTGFGMIYDSLDYAKK	3978	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20091	43.928	3	1808.8655	1808.8655	K	N	69	85
PSM	TVAIHSDVDASSVHVK	3979	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8127	20.95	4	1663.8529	1663.8529	K	M	89	105
PSM	TVLDPVTGDLSDTR	3980	sp|Q15393|SF3B3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=14754	33.83	2	1487.7468	1487.7468	R	T	677	691
PSM	TYQAIKDFNR	3981	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=9050	22.656	3	1254.6357	1254.6357	K	E	2026	2036
PSM	VAAYDKLEK	3982	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6039	16.624	2	1035.5601	1035.5601	K	T	1405	1414
PSM	VADNSFDAK	3983	sp|Q14978|NOLC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5367	15.307	2	965.44543	965.4454	R	R	639	648
PSM	VASVESQGQEISGNR	3984	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=7608	19.847	2	1559.754	1559.7540	K	R	1004	1019
PSM	VECFDKFK	3985	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	3-UNIMOD:4	ms_run[2]:scan=8808	22.212	2	1071.5059	1071.5059	R	V	1263	1271
PSM	VFNNISFLRPVDVQMR	3986	sp|Q9UHD2|TBK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=20619	44.986	3	1934.0196	1934.0196	K	E	39	55
PSM	VGEVIVTK	3987	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6815	18.197	2	843.50657	843.5066	K	D	345	353
PSM	VGGTNLGAPGAFGQSPFSQPPAPPHQNTFPPR	3988	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=17505	38.983	4	3227.5901	3227.5901	K	S	425	457
PSM	VGSLGLPAHPR	3989	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8569	21.818	3	1102.6247	1102.6247	K	E	223	234
PSM	VGTVIGSNK	3990	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4675	14.047	2	873.49198	873.4920	R	L	592	601
PSM	VHELNEEIGK	3991	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6297	17.068	3	1166.5932	1166.5932	R	L	126	136
PSM	VHIEIGPDGR	3992	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8964	22.506	3	1091.5724	1091.5724	R	V	317	327
PSM	VIDPATATSVDLR	3993	sp|P50991-2|TCPD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=13708	31.801	2	1356.7249	1356.7249	K	D	164	177
PSM	VITIMQNPR	3994	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10993	26.555	2	1070.5906	1070.5906	R	Q	67	76
PSM	VKGGGHVAQIYAIR	3995	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8107	20.916	3	1467.831	1467.8310	R	Q	72	86
PSM	VLTVINQTQK	3996	sp|P42766|RL35_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8942	22.454	2	1142.6659	1142.6659	R	E	57	67
PSM	VNENKYENVDLLCK	3997	sp|Q9NSV4-1|DIAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	13-UNIMOD:4	ms_run[2]:scan=12006	28.444	3	1736.8403	1736.8403	K	L	405	419
PSM	VQENCIDLVGR	3998	sp|O75533|SF3B1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4	ms_run[2]:scan=11896	28.257	2	1301.6398	1301.6398	K	I	1031	1042
PSM	VQENMIQEK	3999	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:35	ms_run[2]:scan=3843	12.193	2	1133.5387	1133.5387	R	Q	2069	2078
PSM	VQENMIQEK	4000	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6558	17.525	2	1117.5438	1117.5438	R	Q	2069	2078
PSM	VQISPDSGGLPER	4001	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=10634	25.771	2	1353.6888	1353.6888	K	S	178	191
PSM	VQSSTLVSSLEAELSEVK	4002	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=25997	55.663	2	1904.9943	1904.9943	K	I	1649	1667
PSM	VRVELSNGEK	4003	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=5287	15.174	3	1129.6091	1129.6091	R	R	76	86
PSM	VSFELFADK	4004	sp|P62937|PPIA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=19206	42.145	2	1054.5335	1054.5335	R	V	20	29
PSM	VSRPENEQLR	4005	sp|Q8ND56-3|LS14A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4132	12.855	3	1226.6367	1226.6367	K	N	203	213
PSM	VTTHPLAK	4006	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=2617	9.5486	2	865.50215	865.5022	K	D	123	131
PSM	VVFAELACR	4007	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	8-UNIMOD:4	ms_run[2]:scan=14710	33.743	2	1063.5485	1063.5485	R	E	713	722
PSM	WENVEEPNLDELLVR	4008	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=23559	50.651	2	1853.9159	1853.9159	R	L	88	103
PSM	YAEDVGAVK	4009	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=6529	17.478	2	950.47091	950.4709	R	K	56	65
PSM	YEVTSGGGGTSR	4010	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=4608	13.915	2	1169.5313	1169.5313	R	M	28	40
PSM	YIDQEELNK	4011	sp|P07900|HS90A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=8027	20.771	2	1150.5506	1150.5506	K	T	284	293
PSM	YLYTLVITDKEK	4012	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0		ms_run[2]:scan=15483	35.331	3	1484.8126	1484.8126	R	A	41	53
PSM	YMACCLLYR	4013	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	2-UNIMOD:35,4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=13523	31.363	2	1264.5403	1264.5403	K	G	312	321
PSM	YMACCLLYR	4014	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=15228	34.86	2	1248.5454	1248.5454	K	G	312	321
PSM	YPLNCADPTSER	4015	sp|Q06124-1|PTN11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	19.0	5-UNIMOD:4	ms_run[2]:scan=9494	23.424	2	1421.6245	1421.6245	K	W	100	112
PSM	QQHELELLR	4016	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=14873	34.057702	2	1147.5990	1147.5980	R	E	299	308
PSM	HQLEALESPLCIQHEGHVSDR	4017	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:4	ms_run[1]:scan=11803	28.100771	5	2454.172532	2454.171006	R	C	603	624
PSM	LQEMLMGLEAK	4018	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17368	38.679153	2	1261.639974	1261.641030	R	Q	524	535
PSM	QKEHLTQDLER	4019	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=7857	20.46585	3	1378.6841	1378.6836	R	R	1645	1656
PSM	QYQEHQQATELLR	4020	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=12699	29.820138	2	1626.7772	1625.7792	R	Q	1597	1610
PSM	QVQAEVPGSPIFVMR	4021	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=23933	51.343401	2	1639.8346	1639.8387	R	L	336	351
PSM	VEVGTEVTDYR	4022	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11025	26.620769	2	1266.609474	1266.609196	K	F	1410	1421
PSM	LGTPELSTAER	4023	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9593	23.59483	2	1172.601389	1172.603717	R	K	2151	2162
PSM	GVISDILDWK	4024	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=24802	53.058531	2	1144.612954	1144.612825	K	T	2200	2210
PSM	LTQAQASFER	4025	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7858	20.467336	2	1149.579229	1149.577836	R	E	731	741
PSM	IGEDDEINFLSDQHLQQSNEIMK	4026	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19505	42.820749	3	2703.250506	2702.249375	K	D	715	738
PSM	LSYGIATVR	4027	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12254	28.969199	2	978.551189	978.549831	K	E	1070	1079
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	4028	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=25797	55.212955	4	3382.739167	3382.738384	K	I	1142	1172
PSM	TIGPDMFLGTCR	4029	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:4	ms_run[1]:scan=17314	38.581075	2	1366.636056	1366.637342	K	R	1354	1366
PSM	RCPAEIVDTVSALVYDNK	4030	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4	ms_run[1]:scan=28143	61.103695	3	2049.019560	2049.020091	R	L	1366	1384
PSM	AVFISPYNSQNAVASK	4031	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=14782	33.886937	2	1695.8652	1694.8622	K	I	1432	1448
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	4032	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	32-UNIMOD:4	ms_run[1]:scan=26851	57.822047	3	4031.889967	4030.885455	K	F	1448	1484
PSM	VGILCIMSDR	4033	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=18893	41.525054	2	1178.579697	1178.578765	K	D	1493	1503
PSM	ILGLPTQTVDSSQGSECDYVIFTQTTETAHSCNVNR	4034	cov|corona00371|ORF1b_USA/WA-UW228/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=26118	55.92385	3	4029.884773	4027.852775	K	F	1448	1484
PSM	YEVTSGGGGTSR	4035	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=4629	13.954017	2	1169.531623	1169.531280	R	M	28	40
PSM	GGGGYTCQSGSGWDEFTK	4036	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4	ms_run[1]:scan=14809	33.938934	2	1893.765286	1892.763542	K	H	168	186
PSM	FGDSNTVMR	4037	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7936	20.613289	2	1025.461655	1025.460029	K	F	917	926
PSM	TMIQSPSGVILQEAADVHAR	4038	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:35	ms_run[1]:scan=17364	38.670595	3	2138.063471	2138.079003	R	Y	983	1003
PSM	NLQEAEEWYK	4039	sp|P41219|PERI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14575	33.480642	2	1309.601795	1308.598632	K	S	279	289
PSM	AQFEGIVTDLIR	4040	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=22997	49.560633	2	1360.735008	1360.735065	R	R	349	361
PSM	ERVEAVNMAEGIIHDTETK	4041	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:35	ms_run[1]:scan=17692	39.301684	4	2157.037550	2157.037198	K	M	577	596
PSM	VTIQMLTQSLEEVVR	4042	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=27281	59.06038	2	1744.939553	1744.939321	R	S	1175	1190
PSM	TIAFGGCVFSYVGCHNK	4043	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=18919	41.569747	3	1915.870146	1915.870924	R	C	403	420
PSM	SILSPLYAFASEAAR	4044	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26245	56.233365	3	1594.835893	1594.835508	K	V	528	543
PSM	SQIHDIVLVGGSTR	4045	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11930	28.313243	3	1480.800107	1480.799791	K	I	329	343
PSM	TLGDFAAEYAK	4046	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15508	35.373133	2	1184.571630	1184.571354	K	S	109	120
PSM	TAVCDIPPR	4047	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	4-UNIMOD:4	ms_run[1]:scan=7437	19.536155	2	1027.512431	1027.512065	K	G	351	360
PSM	VETSEGLNSDLEMHADK	4048	sp|P49454|CENPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10807	26.207545	3	1874.843037	1873.836372	R	S	1860	1877
PSM	VETSEGLNSDLEMHADK	4049	sp|P49454|CENPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10780	26.160418	3	1874.843037	1873.836372	R	S	1860	1877
PSM	IEGMTQSLR	4050	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9202	22.918725	2	1034.530735	1033.522630	K	G	2373	2382
PSM	TGEPCVAELTEENFQR	4051	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	5-UNIMOD:4	ms_run[1]:scan=16855	37.760832	3	1878.841702	1878.841792	R	L	254	270
PSM	TVAIHSDVDASSVHVK	4052	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8102	20.905953	3	1663.854099	1663.852949	K	M	89	105
PSM	MADALDNYVIR	4053	sp|P05165|PCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=16645	37.3922	2	1279.622321	1279.623072	R	G	466	477
PSM	TLNDELEIIEGMK	4054	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23088	49.728044	3	1504.752515	1503.749061	K	F	206	219
PSM	VGEVIVTK	4055	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6961	18.502891	2	843.506703	843.506569	K	D	345	353
PSM	AAVEEGIVLGGGCALLR	4056	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	13-UNIMOD:4	ms_run[1]:scan=19990	43.75324	3	1683.900392	1683.897791	R	C	430	447
PSM	DDLNSQLQESLR	4057	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14785	33.894022	2	1417.685887	1416.684486	K	A	385	397
PSM	SGLEELVLSEMNSPSR	4058	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=23976	51.430215	3	1746.846599	1746.845815	R	T	643	659
PSM	MFESFIESVPLLK	4059	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26300	56.385595	2	1538.804179	1538.805453	K	S	251	264
PSM	LISQIVSSITASLR	4060	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26586	57.132136	3	1486.871382	1486.871893	R	F	230	244
PSM	AYHEQLTVAEITNACFEPANQMVK	4061	sp|Q9BQE3|TBA1C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	15-UNIMOD:4,22-UNIMOD:35	ms_run[1]:scan=17654	39.233774	3	2780.299723	2779.294552	K	C	281	305
PSM	AVFPSIVGRPR	4062	sp|P62736|ACTA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12529	29.501995	3	1197.697847	1197.698226	R	H	31	42
PSM	IGGIGTVPVGR	4063	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11533	27.528527	2	1024.603889	1024.602929	K	V	256	267
PSM	NPPNQSSNERPPSLLVIETK	4064	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13850	32.10587	3	2221.159802	2219.154610	K	K	169	189
PSM	KPGQSFQEQVEHYR	4065	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9499	23.430352	4	1731.834858	1731.832882	K	D	866	880
PSM	GSADYSMEAK	4066	sp|Q04726|TLE3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5900	16.31819	2	1057.439758	1057.438625	R	K	216	226
PSM	IMEFSAPLPLENETEISESGMTVR	4067	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=24045	51.574583	3	2680.277151	2679.277170	R	S	603	627
PSM	MMNGGHYTYSENR	4068	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:35	ms_run[1]:scan=5555	15.688919	3	1574.624248	1574.624212	K	V	133	146
PSM	TVGIVGNQPK	4069	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6584	17.56547	2	1011.572123	1011.571295	R	V	351	361
PSM	YALTGDEVK	4070	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8996	22.565671	2	994.497257	994.497127	K	K	54	63
PSM	CMLFSSGTVQLTTTSR	4071	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4	ms_run[1]:scan=18060	39.9597	2	1789.866795	1787.854605	K	A	242	258
PSM	DAALATALGDKK	4072	sp|P20700|LMNB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9256	23.01608	2	1172.640304	1172.640102	K	S	146	158
PSM	IGFPWSEIR	4073	sp|P15311|EZRI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=21896	47.295888	2	1103.575843	1103.576380	K	N	238	247
PSM	SSQSSSQQFSGIGR	4074	sp|Q92841|DDX17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8539	21.76681	2	1454.672861	1454.674984	R	S	671	685
PSM	VEQLGAEGNVEESQK	4075	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8683	22.005098	2	1616.778784	1615.768944	K	V	140	155
PSM	LASYLDKVQALEEANNDLENK	4076	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0		ms_run[1]:scan=19247	42.258392	3	2377.2082	2376.1802	R	I	164	185
PSM	WDHESVCK	4077	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	7-UNIMOD:4	ms_run[1]:scan=4752	14.197717	2	1059.444474	1059.444380	R	Y	29	37
PSM	LTEAAEQNK	4078	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=2679	9.6745679	2	1003.501194	1002.498189	K	E	299	308
PSM	LQELQEEAAR	4079	sp|Q96CN9|GCC1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7777	20.251304	2	1186.598972	1185.598966	R	L	320	330
PSM	QLNENKQER	4080	sp|P26368|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=4198	12.981017	2	1140.5525	1140.5518	R	D	10	19
PSM	LITEDVQGK	4081	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7273	19.149307	2	1001.540559	1001.539326	K	N	86	95
PSM	LMELHGEGSSSGK	4082	sp|P61247|RS3A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5956	16.428587	3	1330.619704	1330.618715	K	A	228	241
PSM	NSADYSSESK	4083	sp|Q04727|TLE4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=2636	9.5822706	2	1086.447239	1086.446548	R	K	221	231
PSM	NVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMR	4084	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=19462	42.740275	4	4152.857951	4150.857148	R	L	412	450
PSM	KPNEGADGQWK	4085	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=4132	12.854881	3	1228.584240	1228.583650	R	K	310	321
PSM	VHSQGPHHVCELCNK	4086	sp|P56270|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=2830	10.018434	3	1801.818220	1800.814806	K	G	412	427
PSM	KLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGK	4087	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	19-UNIMOD:4	ms_run[1]:scan=20697	45.127187	5	3560.789734	3560.787460	R	A	108	140
PSM	GMKDDDYDDQLC	4088	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	12-UNIMOD:4	ms_run[1]:scan=9965	24.379758	2	1474.543994	1473.538810	K	-	398	410
PSM	VTALQEECR	4089	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4	ms_run[1]:scan=6049	16.6431	2	1105.526096	1104.523358	R	A	1299	1308
PSM	VTVEPHPELR	4090	sp|Q5T440|CAF17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=7625	19.878098	3	1175.629114	1175.629872	K	V	149	159
PSM	SKFEDMAK	4091	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5354	15.28377	3	954.450945	954.448068	K	S	58	66
PSM	LNRLPAAGVGDMVMATVK	4092	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18696	41.152	3	1843.989001	1841.985560	R	K	49	67
PSM	KADIDLTK	4093	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=5090	14.837148	2	902.506762	902.507297	R	R	47	55
PSM	LSEHATAPTR	4094	sp|P33316|DUT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=3227	10.879409	3	1081.551210	1081.551622	R	G	119	129
PSM	LSEHATAPTR	4095	sp|P33316|DUT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=3319	11.089987	3	1081.551210	1081.551622	R	G	119	129
PSM	GQSPLDLCPDPNLCK	4096	sp|Q86YT6|MIB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	8-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=15668	35.665327	2	1713.793131	1712.786192	K	A	773	788
PSM	FAAATGATPIAGR	4097	sp|P08865|RSSA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9465	23.374605	2	1202.640848	1202.640771	K	F	90	103
PSM	VGEFSGANKEK	4098	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=3743	11.982393	2	1164.577998	1164.577502	K	L	86	97
PSM	GMGLGFTSSMR	4099	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15022	34.418977	2	1143.527317	1142.521250	R	G	419	430
PSM	QITEEDLEGKTEEEIEMMK	4100	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	19.0	1-UNIMOD:28	ms_run[1]:scan=22956	49.489162	3	2264.0064	2264.0071	R	L	87	106
PSM	QITEEDLEGKTEEEIEMMK	4101	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	17-UNIMOD:35	ms_run[1]:scan=19227	42.206501	3	2297.028172	2297.029060	R	L	87	106
PSM	KSEIEYYAMLAK	4102	sp|P62888|RL30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15641	35.618164	3	1444.727163	1444.727203	R	T	57	69
PSM	NIAVGKDPLEGQR	4103	sp|O00170|AIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9506	23.442771	3	1395.747194	1395.747027	R	H	107	120
PSM	SQNVMAAASIANIVK	4104	sp|P17987|TCPA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18639	41.048699	2	1515.807966	1515.807913	R	S	19	34
PSM	QCEINYVKK	4105	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	2-UNIMOD:4	ms_run[1]:scan=5420	15.40705	3	1181.594130	1180.591044	K	F	204	213
PSM	YLYTLVITDK	4106	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=18807	41.364992	2	1227.674951	1227.675091	R	E	41	51
PSM	QSLPPGLAVK	4107	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12568	29.583101	2	1008.597429	1008.596781	K	E	58	68
PSM	SRGPIQSSGPTIQDYLNR	4108	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14792	33.906714	3	1987.997157	1988.007552	R	P	19	37
PSM	GETAVPGAPEALR	4109	sp|A6NDG6|PGP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11050	26.665179	2	1267.658900	1266.656815	R	A	42	55
PSM	DANLHHVACNIVK	4110	sp|Q9BV19|CA050_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	9-UNIMOD:4	ms_run[1]:scan=8322	21.290848	3	1489.745249	1489.745982	R	K	102	115
PSM	LTEEFQNVR	4111	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10016	24.467947	2	1134.568256	1134.566937	R	I	208	217
PSM	YIDQEELNK	4112	sp|Q58FF8|H90B2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=8118	20.934509	2	1150.551040	1150.550619	K	T	198	207
PSM	CSDSSLLGK	4113	sp|Q9NYP9|MS18A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4	ms_run[1]:scan=7274	19.150486	2	965.449518	965.448796	K	R	25	34
PSM	NIANPTAMLLSASNMLR	4114	sp|O43837|IDH3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=26258	56.269648	2	1815.947209	1815.933524	R	H	318	335
PSM	YFQINQDEEEEEDED	4115	sp|P35268|RL22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=14761	33.843483	2	1930.723484	1930.722842	R	-	114	129
PSM	ALMDLLQLTR	4116	sp|Q14807|KIF22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=24374	52.216447	2	1172.658399	1172.658729	R	E	150	160
PSM	LVSESSDVLPK	4117	sp|P05787|K2C8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=10176	24.769459	2	1173.633908	1172.628869	K	-	473	484
PSM	PLISVYSEK	4118	sp|P36578|RL4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=12392	29.209138	2	1035.569695	1034.564812	R	G	6	15
PSM	LNISFPATGCQK	4119	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	10-UNIMOD:4	ms_run[1]:scan=14751	33.823329	2	1334.665265	1334.665272	K	L	3	15
PSM	MEAAAEPGNLAGVR	4120	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:1	ms_run[1]:scan=16922	37.88095	2	1426.685332	1426.687464	-	H	1	15
PSM	TLSSPSNRPSGETSVPPPPAVGR	4121	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=9544	23.507829	3	2290.173850	2289.171323	K	M	421	444
PSM	KTVGVEPAADGK	4122	sp|P46779|RL28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=3502	11.477409	3	1170.621414	1170.624452	R	G	47	59
PSM	TVMVQEGNVESAYR	4123	sp|P82921|RT21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11428	27.337865999999998	2	1582.747654	1581.745707	R	T	11	25
PSM	SWEEQMIEVGR	4124	sp|Q00059|TFAM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17921	39.705812	2	1362.633108	1362.623800	K	K	217	228
PSM	TDPGTVFVMNK	4125	sp|Q9NYK5|RM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=13355	31.059063	2	1208.598813	1207.590709	K	N	73	84
PSM	TTEMETIYDLGTK	4126	sp|Q9Y230|RUVB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=17731	39.367311	2	1500.691814	1500.701776	K	M	165	178
PSM	VLIAAHGNSLR	4127	sp|P18669|PGAM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=6795	18.1562	3	1149.661544	1149.661841	R	G	181	192
PSM	VYCGHEYTINNLK	4128	sp|Q16775|GLO2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	3-UNIMOD:4	ms_run[1]:scan=10204	24.82054	3	1611.773378	1609.755878	R	F	217	230
PSM	SNLELFKEELK	4129	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=15026	34.429345	3	1350.730731	1348.723832	K	Q	202	213
PSM	DGSLLEVEK	4130	sp|A7MCY6|TBKB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0		ms_run[1]:scan=11547	27.553815	2	989.515574	988.507691	K	V	95	104
PSM	SHKPPISFPLCANGQVFGLYK	4131	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	11-UNIMOD:4	ms_run[1]:scan=20816	45.343269	3	2360.197867	2359.214708	K	N	997	1018
PSM	CPAEIVDTVSALVYDNK	4132	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	19.0	1-UNIMOD:4	ms_run[1]:scan=27025	58.321265	2	1893.907165	1892.918980	R	L	1367	1384
PSM	AAAVAVAAASR	4133	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=15751	35.813	2	998.55089	998.5509	M	R	2	13
PSM	AAGTLYTYPENWR	4134	sp|P26641|EF1G_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=21853	47.22	2	1582.7416	1582.7416	M	A	2	15
PSM	AAQLLEEK	4135	sp|Q6PJ69|TRI65_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=16492	37.122	2	942.50221	942.5022	M	L	2	10
PSM	AAVSTNCR	4136	sp|P78346|RPP30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=2493	9.3386	2	877.4076	877.4076	K	A	219	227
PSM	ACGSEIMQK	4137	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4	ms_run[2]:scan=5245	15.098	2	1022.4525	1022.4525	K	K	1279	1288
PSM	ADDLDFETGDAGASATFPMQCSALR	4138	sp|P63241|IF5A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1,21-UNIMOD:4	ms_run[2]:scan=24562	52.586	3	2687.1479	2687.1479	M	K	2	27
PSM	ADEGISFR	4139	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9935	24.326	2	893.4243	893.4243	K	G	121	129
PSM	ADGYEPPVQESV	4140	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13121	30.616	2	1289.5776	1289.5776	R	-	253	265
PSM	AEEVATFFAK	4141	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15548	35.447	2	1111.555	1111.5550	K	M	253	263
PSM	AGIALNDNFVK	4142	sp|O14556|G3PT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14653	33.625	2	1160.619	1160.6190	K	L	371	382
PSM	AHASPFSGALTPSAPPGPEMNR	4143	sp|O15027-2|SC16A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14120	32.676	3	2191.048	2191.0480	R	S	119	141
PSM	AIVAGDQNVEYK	4144	sp|Q13642-1|FHL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8928	22.42	2	1305.6565	1305.6565	K	G	107	119
PSM	ALAAFLKK	4145	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10200	24.812	2	860.54837	860.5484	R	S	17	25
PSM	ALELSGTAVPPDLEK	4146	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15833	35.957	2	1538.8192	1538.8192	K	L	737	752
PSM	ALKEEIGNVQLEK	4147	sp|Q86UP2|KTN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11183	26.896	2	1469.809	1469.8090	K	A	840	853
PSM	ALMDLLQLTR	4148	sp|Q14807-2|KIF22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24343	52.158	2	1172.6587	1172.6587	R	E	82	92
PSM	AMQDAEVSK	4149	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3901	12.306	2	977.4488	977.4488	K	S	369	378
PSM	APAMFNIR	4150	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13886	32.197	2	918.47456	918.4746	K	N	35	43
PSM	APGFGDNRK	4151	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3314	11.08	3	960.47773	960.4777	K	N	302	311
PSM	AQEIAMQNR	4152	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5592	15.751	2	1059.5131	1059.5131	R	L	156	165
PSM	AQTEGINISEEALNHLGEIGTK	4153	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20232	44.185	3	2323.1656	2323.1656	R	T	379	401
PSM	AQYEDIAQK	4154	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6722	17.986	2	1064.5138	1064.5138	K	S	356	365
PSM	ARVECFDK	4155	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=4467	13.566	3	1023.4808	1023.4808	R	F	1261	1269
PSM	ARVECFDK	4156	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=4474	13.579	2	1023.4808	1023.4808	R	F	1261	1269
PSM	ASNLLYGQLK	4157	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13337	31.03	2	1105.6132	1105.6132	R	F	493	503
PSM	ATALYYQQELK	4158	sp|Q96CN9|GCC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12618	29.68	2	1326.682	1326.6820	K	Q	476	487
PSM	ATENDIYNFFSPLNPVR	4159	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=25662	54.875	2	1995.969	1995.9690	K	V	300	317
PSM	ATISALEAK	4160	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8759	22.131	2	902.5073	902.5073	K	I	1814	1823
PSM	ATLEMVNHEK	4161	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6059	16.66	3	1170.5703	1170.5703	R	A	159	169
PSM	ATVEELKEK	4162	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4558	13.796	2	1045.5655	1045.5655	K	L	225	234
PSM	ATVLNDLSSLR	4163	sp|Q66GS9|CP135_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17726	39.36	2	1187.651	1187.6510	K	E	968	979
PSM	AVIPQGAAESDGR	4164	sp|Q12923-3|PTN13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7477	19.606	2	1269.6313	1269.6313	K	I	1380	1393
PSM	AVIYNPATQADWTAK	4165	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15455	35.283	2	1647.8257	1647.8257	R	K	19	34
PSM	AWSHYQVPEESGCHTTTTSSLVSLCSSLR	4166	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=16697	37.484	4	3279.4925	3279.4925	K	L	282	311
PSM	AWSHYQVPEESGCHTTTTSSLVSLCSSLR	4167	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:4,25-UNIMOD:4	ms_run[2]:scan=16755	37.587	4	3279.4925	3279.4925	K	L	282	311
PSM	AYINTISSLK	4168	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13406	31.151	2	1108.6128	1108.6128	K	D	2978	2988
PSM	CGETGHVAINCSK	4169	sp|P62633-2|CNBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=4406	13.454	3	1431.6235	1431.6235	R	T	133	146
PSM	CGHTNNLRPK	4170	sp|P62987|RL40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=1963	8.4519	3	1195.588	1195.5880	K	K	115	125
PSM	CPAEIVDTVSALVYDNK	4171	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=25777	55.16	2	1892.919	1892.9190	R	L	1367	1384
PSM	CPLASTNKR	4172	sp|P0DPB5|RPC22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=2370	9.118	3	1045.5339	1045.5339	K	F	37	46
PSM	CQEVISWLDANTLAEKDEFEHK	4173	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:4	ms_run[2]:scan=20629	45.004	3	2661.2381	2661.2381	K	R	574	596
PSM	DAEALSQR	4174	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4640	13.975	2	888.43011	888.4301	K	L	1400	1408
PSM	DAHQSLLATR	4175	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7265	19.127	2	1110.5782	1110.5782	R	V	572	582
PSM	DDNMFQIGK	4176	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:35	ms_run[2]:scan=14554	33.445	2	1082.4703	1082.4703	R	M	60	69
PSM	DDNMFQIGK	4177	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14440	33.24	2	1066.4753	1066.4753	R	M	60	69
PSM	DGQILPVPNVVVR	4178	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19140	41.968	2	1404.8089	1404.8089	K	D	321	334
PSM	DIAAHIKK	4179	sp|P63167|DYL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3733	11.966	2	894.5287	894.5287	K	E	37	45
PSM	DKWSNFDPTGLER	4180	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15849	35.984	3	1563.7318	1563.7318	K	A	45	58
PSM	DLEEEIQMLK	4181	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21878	47.264	2	1246.6115	1246.6115	R	S	400	410
PSM	DLVKPGDENLR	4182	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8486	21.662	3	1254.6568	1254.6568	R	E	779	790
PSM	DLYANTVLSGGTTMYPGIADR	4183	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21518	46.616	3	2214.0627	2214.0627	K	M	292	313
PSM	DMIILPEMVGSMVGVYNGK	4184	sp|P62841|RS15_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27721	60.37	2	2052.0094	2052.0094	R	T	82	101
PSM	DNYVPEVSALDQEIIEVDPDTK	4185	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24918	53.282	3	2488.1857	2488.1857	R	E	82	104
PSM	DQELMLQK	4186	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9958	24.367	2	1003.5008	1003.5008	R	E	1657	1665
PSM	DVTAAQAELEK	4187	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9593	23.595	2	1173.5877	1173.5877	K	A	170	181
PSM	EAAEQDVEK	4188	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2933	10.263	2	1017.4615	1017.4615	K	K	201	210
PSM	EAEAELSGELSGLGALPAR	4189	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20157	44.049	2	1868.948	1868.9480	R	R	736	755
PSM	EAFSLFDKDGDGTITTK	4190	sp|P0DP25|CALM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16428	37.007	3	1843.884	1843.8840	K	E	15	32
PSM	EAHQLFLEPEVLDPESVELK	4191	sp|P39748|FEN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22129	47.793	3	2321.1791	2321.1791	K	W	278	298
PSM	EALLAALGYK	4192	sp|Q9BU76-4|MMTA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19983	43.743	2	1047.5964	1047.5964	R	N	76	86
PSM	EAPPMEKPEVVK	4193	sp|P62841|RS15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7352	19.333	3	1352.701	1352.7010	K	T	66	78
PSM	EASQVANEK	4194	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2188	8.8033	2	974.46689	974.4669	R	V	410	419
PSM	EDTICLLQNEK	4195	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=13667	31.721	2	1361.6497	1361.6497	R	I	765	776
PSM	EETQPPVALKK	4196	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5943	16.401	2	1238.6871	1238.6871	K	E	93	104
PSM	EGDVLTLLESER	4197	sp|P62857|RS28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21826	47.169	2	1359.6882	1359.6882	R	E	52	64
PSM	EGPYDVVVLPGGNLGAQNLSESAAVK	4198	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21185	46.02	4	2583.318	2583.3180	K	E	64	90
PSM	EHLMLEEELR	4199	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13325	31.008	3	1297.6336	1297.6336	K	N	1716	1726
PSM	EKAEEIEQLHEVIEK	4200	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12153	28.784	4	1822.9313	1822.9313	K	L	1734	1749
PSM	EKDQADFR	4201	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3320	11.091	2	1007.4672	1007.4672	R	G	234	242
PSM	EKESSAVPAR	4202	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2428	9.2242	2	1072.5513	1072.5513	R	S	678	688
PSM	ELAQQVQQVAAEYCR	4203	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	14-UNIMOD:4	ms_run[2]:scan=18306	40.43	3	1791.8574	1791.8574	R	A	178	193
PSM	ELHLSWEVGK	4204	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15249	34.907	3	1196.619	1196.6190	R	P	1085	1095
PSM	ELLTTMGDRFTDEEVDELYR	4205	sp|P19105|ML12A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21690	46.917	3	2431.1213	2431.1213	R	E	124	144
PSM	ELYVENAHLVR	4206	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11398	27.283	3	1341.7041	1341.7041	K	A	1332	1343
PSM	EPALGPHGPSR	4207	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5468	15.513	3	1116.5676	1116.5676	R	H	603	614
PSM	EPAQLLLLLAK	4208	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24679	52.816	2	1207.754	1207.7540	R	T	242	253
PSM	EPEAAAPAPGTGGDSVCGETHR	4209	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	17-UNIMOD:4	ms_run[2]:scan=7184	18.97	3	2164.9444	2164.9444	K	A	778	800
PSM	EPPEQELQR	4210	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6620	17.627	2	1124.5462	1124.5462	R	R	20	29
PSM	EQQIVIQSSGGLSKDDIENMVK	4211	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	20-UNIMOD:35	ms_run[2]:scan=17164	38.312	3	2433.2057	2433.2057	R	N	542	564
PSM	EQWEPVFQNGK	4212	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14253	32.911	2	1360.6412	1360.6412	R	M	136	147
PSM	ERDEAVMSR	4213	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3574	11.63	2	1091.503	1091.5030	K	L	176	185
PSM	ESYSIYVYK	4214	sp|Q8N257|H2B3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13689	31.765	2	1150.5546	1150.5546	K	V	36	45
PSM	ESYSVYVYK	4215	sp|Q99880|H2B1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12290	29.031	2	1136.539	1136.5390	K	V	36	45
PSM	ETQSQLETER	4216	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5171	14.973	2	1219.5681	1219.5681	R	S	1923	1933
PSM	EVEVVPSNMWGGQGLLGASVR	4217	sp|Q9BQQ3-2|GORS1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=23261	50.062	2	2184.0997	2184.0997	R	F	81	102
PSM	EYWMDPEGEMKPGR	4218	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14824	33.966	2	1723.7334	1723.7334	R	K	87	101
PSM	FANLNEQAAR	4219	sp|Q16352|AINX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8227	21.127	2	1132.5625	1132.5625	K	S	291	301
PSM	FFDEESYSLLR	4220	sp|P51571|SSRD_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19997	43.764	2	1404.6561	1404.6561	R	K	106	117
PSM	FFPEDVSEELIQEITQR	4221	sp|P35241|RADI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27831	60.563	3	2079.0161	2079.0161	K	L	84	101
PSM	FGALTAEK	4222	sp|O95372|LYPA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8076	20.857	2	835.44397	835.4440	R	L	183	191
PSM	FGFYEVFK	4223	sp|Q00325-2|MPCP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21537	46.648	2	1035.5066	1035.5066	K	V	137	145
PSM	FHDPDSAVVAQHLTNTVFVDR	4224	sp|Q05519-2|SRS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17054	38.111	3	2367.1608	2367.1608	K	A	83	104
PSM	FLDQNLQK	4225	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9330	23.149	2	1004.5291	1004.5291	K	Y	1057	1065
PSM	FMELMQEK	4226	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=9897	24.258	2	1070.4777	1070.4777	R	A	812	820
PSM	FNLKEELER	4227	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12910	30.249	3	1176.6139	1176.6139	K	C	1638	1647
PSM	FNSLNELVDYHR	4228	sp|P62993-2|GRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15860	36.003	3	1505.7263	1505.7263	K	S	84	96
PSM	FPSHFSSDLK	4229	sp|P17612|KAPCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10363	25.204	3	1163.5611	1163.5611	R	D	258	268
PSM	FQPISEHQTR	4230	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5827	16.201	3	1241.6153	1241.6153	R	E	2100	2110
PSM	FQPLPEAMKEK	4231	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10726	26.043	3	1316.6799	1316.6799	R	E	2375	2386
PSM	FQSFQDHK	4232	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5499	15.583	2	1035.4774	1035.4774	K	L	213	221
PSM	FTVLTESAAK	4233	sp|P07196|NFL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11016	26.605	2	1065.5706	1065.5706	R	N	284	294
PSM	FVVMVTPEDLK	4234	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:35	ms_run[2]:scan=16626	37.357	2	1292.6686	1292.6686	R	A	153	164
PSM	GAAGRPLELSDFR	4235	sp|P42167-2|LAP2B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13420	31.174	3	1387.7208	1387.7208	K	M	260	273
PSM	GAFGKPQGTVAR	4236	sp|P27635|RL10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5066	14.799	2	1187.6411	1187.6411	R	V	117	129
PSM	GDECGLALGR	4237	sp|P54886-2|P5CS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:4	ms_run[2]:scan=9578	23.567	2	1046.4815	1046.4815	R	L	85	95
PSM	GDYGDAVVYR	4238	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10165	24.751	2	1113.5091	1113.5091	K	G	1126	1136
PSM	GEATATDAEAR	4239	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2899	10.192	2	1090.4891	1090.4891	R	E	1393	1404
PSM	GGGHVAQIYAIR	4240	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9474	23.389	3	1240.6677	1240.6677	K	Q	74	86
PSM	GGNIGDGGGAADR	4241	sp|P55072|TERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3552	11.577	2	1115.4956	1115.4956	R	V	587	600
PSM	GKDSLYAQGR	4242	sp|Q969Q0|RL36L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4177	12.939	3	1093.5516	1093.5516	K	R	29	39
PSM	GLIAAICAGPTALLAHEIGFGSK	4243	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=26097	55.876	3	2266.2144	2266.2144	K	V	100	123
PSM	GMLREDAVLEYLK	4244	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19612	43.011	3	1535.8018	1535.8018	R	I	181	194
PSM	GPVFAPPYEPLPENVK	4245	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18699	41.157	2	1752.9087	1752.9087	K	F	224	240
PSM	GQLQDELEKGER	4246	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9626	23.654	3	1400.6896	1400.6896	R	D	1070	1082
PSM	GTQEVAPPTPLTPTSHTANTSPRPVSGMER	4247	sp|P48730|KC1D_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10870	26.313	4	3115.5357	3115.5357	R	E	336	366
PSM	GTVVTGTLER	4248	sp|P49411|EFTU_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8210	21.098	2	1031.5611	1031.5611	R	G	272	282
PSM	GWEEGVAQMSVGQR	4249	sp|P62942|FKB1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15401	35.188	3	1532.7042	1532.7042	R	A	59	73
PSM	GYISPYFINTSK	4250	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16959	37.946	2	1388.6976	1388.6976	R	G	222	234
PSM	HGEISFLNEEVK	4251	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13441	31.212	3	1400.6936	1400.6936	K	S	970	982
PSM	HGGVIHIYVDK	4252	sp|Q14498-2|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8122	20.94	3	1236.6615	1236.6615	K	N	451	462
PSM	HIILVLSGK	4253	sp|Q9Y5Y2|NUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11573	27.603	2	978.6226	978.6226	R	G	15	24
PSM	HILLYGPPGTGK	4254	sp|Q5T9A4|ATD3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11207	26.938	2	1251.6976	1251.6976	R	T	347	359
PSM	HKLDVTSVEDYK	4255	sp|P48643|TCPE_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9312	23.118	3	1432.7198	1432.7198	K	A	264	276
PSM	HLEEVLEMK	4256	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11105	26.759	2	1126.5692	1126.5692	K	Q	919	928
PSM	HMFHVAWVDPEDPYKGYR	4257	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15719	35.757	4	2246.0367	2246.0367	R	Y	1732	1750
PSM	HNFCFMEMNTR	4258	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:4	ms_run[2]:scan=14255	32.914	2	1485.5952	1485.5952	K	L	329	340
PSM	HNLIEDHQK	4259	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3425	11.329	3	1132.5625	1132.5625	K	E	721	730
PSM	HSDLVTK	4260	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2269	8.9431	2	798.42357	798.4236	R	E	1429	1436
PSM	HSHAVSTAAMTR	4261	sp|P51610-2|HCFC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2725	9.7656	3	1267.6092	1267.6092	R	S	1164	1176
PSM	HTLTQIK	4262	sp|P40227|TCPZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3715	11.933	2	839.4865	839.4865	K	D	382	389
PSM	HVPGGGNVQIQNKK	4263	sp|P27816|MAP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3524	11.53	3	1474.8005	1474.8005	K	V	1016	1030
PSM	HWPFQVINDGDKPK	4264	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13791	31.953	4	1679.842	1679.8420	K	V	89	103
PSM	IAGLEEEKQK	4265	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5041	14.753	3	1143.6136	1143.6136	R	N	1854	1864
PSM	IFDTSSGHLIQELR	4266	sp|Q5MNZ6|WIPI3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16286	36.755	3	1614.8366	1614.8366	R	R	212	226
PSM	IFGYPVGIVGNNGVLFSESAK	4267	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24515	52.495	2	2167.1314	2167.1314	R	K	362	383
PSM	IFYPEIEEVQALDDTER	4268	sp|P33316-2|DUT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22470	48.594	2	2065.9844	2065.9844	R	G	137	154
PSM	IGLAEEIR	4269	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11822	28.133	2	899.50763	899.5076	R	H	1724	1732
PSM	IGYNPDTVAFVPISGWNGDNMLEPSANMPWFK	4270	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=27806	60.519	3	3566.6639	3566.6639	K	G	181	213
PSM	IHFPLATYAPVISAEK	4271	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=19643	43.066	2	1755.956	1755.9560	R	A	265	281
PSM	IIDVVYNASNNELVR	4272	sp|P62241|RS8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16998	38.015	2	1717.8999	1717.8999	R	T	78	93
PSM	IIDVVYNASNNELVR	4273	sp|P62241|RS8_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17022	38.057	3	1717.8999	1717.8999	R	T	78	93
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	4274	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	32-UNIMOD:4	ms_run[2]:scan=22672	48.952	4	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	4275	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	32-UNIMOD:4	ms_run[2]:scan=29922	64.38	3	4030.8855	4030.8855	K	F	1448	1484
PSM	ILPSYQEPHLPR	4276	sp|Q14168-5|MPP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12608	29.66	3	1448.7776	1448.7776	K	Q	76	88
PSM	ILQAVNFPFLVK	4277	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24414	52.297	2	1387.8228	1387.8228	R	L	95	107
PSM	ILRPWQSSETR	4278	sp|Q15637-6|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9426	23.31	3	1371.7259	1371.7259	R	S	261	272
PSM	INFSDLDQR	4279	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14094	32.634	2	1106.5356	1106.5356	R	S	107	116
PSM	IQIEAIPLALQGR	4280	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21096	45.864	2	1420.8402	1420.8402	K	D	50	63
PSM	IQLVEEELDR	4281	sp|P06753-2|TPM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14699	33.721	2	1242.6456	1242.6456	R	A	56	66
PSM	IREESGAR	4282	sp|Q15365|PCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1947	8.4258	3	916.47264	916.4726	R	I	39	47
PSM	ISKEEAMR	4283	sp|P62913|RL11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2870	10.113	2	962.48552	962.4855	R	W	157	165
PSM	ITITNDKGR	4284	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3845	12.196	3	1016.5615	1016.5615	K	L	501	510
PSM	IWGQQTDGMK	4285	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9893	24.25	2	1162.5441	1162.5441	K	L	1280	1290
PSM	KESESCDCLQGFQLTHSLGGGTGSGMGTLLISK	4286	sp|Q9BVA1|TBB2B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=20055	43.869	4	3454.6167	3454.6167	R	I	122	155
PSM	KGVITVK	4287	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3292	11.034	2	743.49052	743.4905	R	D	196	203
PSM	KIFVGTK	4288	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4316	13.264	2	791.49052	791.4905	R	G	128	135
PSM	KLAVNMVPFPR	4289	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15172	34.721	3	1270.722	1270.7220	R	L	252	263
PSM	KLTPEQFYVTR	4290	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12282	29.017	3	1380.7402	1380.7402	K	E	57	68
PSM	KPGQSFQEQVEHYR	4291	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9507	23.444	4	1731.8329	1731.8329	K	D	866	880
PSM	KPVTVHSR	4292	sp|P84098|RL19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1846	8.2679	3	922.53485	922.5348	R	A	53	61
PSM	KSLESINSR	4293	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4148	12.881	2	1032.5564	1032.5564	K	L	9	18
PSM	KTATAVAHCK	4294	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:4	ms_run[2]:scan=1806	8.2093	3	1085.5652	1085.5652	K	R	17	27
PSM	KVNVLQK	4295	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3348	11.151	2	827.52289	827.5229	R	K	572	579
PSM	KYGLNMCR	4296	sp|P62273|RS29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=7431	19.523	3	1040.4896	1040.4896	R	Q	33	41
PSM	LAAEDATNEK	4297	sp|P07196|NFL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4159	12.902	2	1060.5037	1060.5037	R	Q	148	158
PSM	LALELEHEK	4298	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9638	23.677	3	1080.5815	1080.5815	K	G	1110	1119
PSM	LALSQNQQSSGAAGPTGKNEEK	4299	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5857	16.246	3	2214.0877	2214.0877	R	I	107	129
PSM	LAQFDYGR	4300	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10734	26.064	2	968.47158	968.4716	K	K	506	514
PSM	LATQLTGPVMPVR	4301	sp|P26373|RL13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14936	34.172	2	1381.7752	1381.7752	K	N	146	159
PSM	LCLNICVGESGDR	4302	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=15787	35.874	2	1491.681	1491.6810	K	L	20	33
PSM	LDDCGLTEAR	4303	sp|P13489|RINI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:4	ms_run[2]:scan=9059	22.672	2	1148.5132	1148.5132	R	C	35	45
PSM	LDPHLVLDQLR	4304	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18461	40.72	2	1317.7405	1317.7405	K	C	683	694
PSM	LEAPELPVK	4305	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13114	30.603	2	994.5699	994.5699	R	V	60	69
PSM	LEWFSTLFPR	4306	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=26088	55.857	2	1294.671	1294.6710	K	I	211	221
PSM	LFSDLVHTTESLR	4307	sp|Q66GS9|CP135_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17430	38.851	3	1516.7886	1516.7886	K	Q	36	49
PSM	LFSTLDPELMLNPENLPR	4308	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:35	ms_run[2]:scan=23708	50.93	3	2114.0718	2114.0718	R	A	183	201
PSM	LGVTVLSR	4309	sp|O75828|CBR3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11006	26.585	2	843.5178	843.5178	K	I	199	207
PSM	LHQDLWK	4310	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8897	22.362	2	938.4974	938.4974	K	T	1248	1255
PSM	LHSPGATSTAELGSR	4311	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6507	17.44	2	1482.7427	1482.7427	R	G	2227	2242
PSM	LIDHLENTK	4312	sp|Q9H0S4-2|DDX47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6196	16.892	3	1081.5768	1081.5768	R	G	153	162
PSM	LKEEYQSLIR	4313	sp|Q9Y3C8|UFC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10997	26.564	3	1277.698	1277.6980	R	Y	32	42
PSM	LKLFAAETLK	4314	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15326	35.06	3	1132.6856	1132.6856	R	A	1053	1063
PSM	LKLFAAETLK	4315	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15686	35.697	3	1132.6856	1132.6856	R	A	1053	1063
PSM	LKNEEVESER	4316	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3325	11.105	2	1231.6044	1231.6044	K	E	1390	1400
PSM	LLGQIVDR	4317	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11436	27.351	2	912.53927	912.5393	R	C	140	148
PSM	LLIHQSLAGGIIGVK	4318	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16347	36.864	3	1517.9293	1517.9293	R	G	125	140
PSM	LLLEDLVK	4319	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20300	44.334	2	941.57973	941.5797	R	K	2222	2230
PSM	LLLQVQHASK	4320	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8415	21.461	2	1135.6713	1135.6713	K	Q	34	44
PSM	LLYEDVSRENDCLQEELR	4321	sp|Q8N4C6-7|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	12-UNIMOD:4	ms_run[2]:scan=17997	39.84	3	2280.0692	2280.0692	K	M	1250	1268
PSM	LMADNYEDDHFK	4322	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10170	24.761	3	1496.6242	1496.6242	K	S	982	994
PSM	LNISFPATGCQK	4323	sp|P62753|RS6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:4	ms_run[2]:scan=14770	33.864	2	1334.6653	1334.6653	K	L	3	15
PSM	LNPASAEIMLLR	4324	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20675	45.085	2	1326.733	1326.7330	K	K	582	594
PSM	LNRLETLAAIGGGELESVR	4325	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20953	45.591	3	1997.0906	1997.0906	R	I	1091	1110
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	4326	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24647	52.757	5	3382.7384	3382.7384	K	I	1142	1172
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	4327	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=25533	54.588	4	3382.7384	3382.7384	K	I	1142	1172
PSM	LNYVPLEK	4328	sp|Q7L014|DDX46_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11913	28.285	2	974.54368	974.5437	K	Q	908	916
PSM	LPASFDAR	4329	sp|P07858|CATB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9533	23.489	2	875.45012	875.4501	K	E	80	88
PSM	LPLQDVYK	4330	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12585	29.616	2	974.54368	974.5437	R	I	248	256
PSM	LQAEADDLQIR	4331	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11794	28.083	2	1270.6517	1270.6517	K	E	1233	1244
PSM	LQIVEMPLAHK	4332	sp|P50454|SERPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14495	33.34	3	1277.7166	1277.7166	K	L	253	264
PSM	LQNSYQPTNK	4333	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4919	14.5	2	1191.5884	1191.5884	R	G	1016	1026
PSM	LQQEGSENERIEELQEQLEQK	4334	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16847	37.746	3	2556.2304	2556.2304	R	H	437	458
PSM	LQQELEAANQSLAELR	4335	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17899	39.665	3	1811.9377	1811.9377	K	D	281	297
PSM	LQWFQNHLDPQK	4336	sp|Q96EY4|TMA16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14762	33.845	2	1552.7787	1552.7787	K	K	55	67
PSM	LREDLQSEHGR	4337	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3603	11.691	3	1338.664	1338.6640	K	C	419	430
PSM	LSLSNMHTAQLELTQANLQK	4338	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:35	ms_run[2]:scan=14109	32.66	3	2255.158	2255.1580	R	E	252	272
PSM	LTEMLCQK	4339	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4	ms_run[2]:scan=8789	22.183	2	1021.4936	1021.4936	R	E	1614	1622
PSM	LTEVHEELQK	4340	sp|Q9UJC3-2|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5930	16.378	3	1224.635	1224.6350	K	K	515	525
PSM	LVAGEMGQNEPDQGGQR	4341	sp|Q99714|HCD2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8031	20.777	2	1784.8112	1784.8112	R	G	131	148
PSM	LVEQLKEER	4342	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6001	16.543	3	1142.6295	1142.6295	K	E	161	170
PSM	LVQSTLSDLR	4343	sp|Q9BYN0|SRXN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11938	28.325	2	1130.6295	1130.6295	K	V	117	127
PSM	LYSPSQIGAFVLMK	4344	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	13-UNIMOD:35	ms_run[2]:scan=22475	48.604	3	1568.8273	1568.8273	K	M	160	174
PSM	LYSPSQIGAFVLMK	4345	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24022	51.53	3	1552.8323	1552.8323	K	M	160	174
PSM	MANSSPVLSK	4346	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6114	16.75	2	1032.5274	1032.5274	K	V	214	224
PSM	MDHLLVENIER	4347	sp|Q96MN5-2|TEAN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12972	30.358	3	1367.6867	1367.6867	K	E	60	71
PSM	MEGTISQQTK	4348	sp|O14578-4|CTRO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4450	13.537	2	1121.5387	1121.5387	K	L	1254	1264
PSM	MEVEQEQR	4349	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=9684	23.766	2	1089.4761	1089.4761	-	R	1	9
PSM	MGAYHTIELEPNR	4350	sp|Q9BRX2|PELO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11091	26.735	3	1529.7297	1529.7297	K	Q	96	109
PSM	MGGMVSFR	4351	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	4-UNIMOD:35	ms_run[2]:scan=8791	22.186	2	899.39934	899.3993	R	T	1233	1241
PSM	MIFDVESMKK	4352	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13960	32.392	3	1226.6039	1226.6039	K	A	675	685
PSM	MIKPFFHSLSEK	4353	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12198	28.87	4	1462.7643	1462.7643	K	Y	37	49
PSM	MKETAENYLGHTAK	4354	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6521	17.464	3	1591.7664	1591.7664	K	N	174	188
PSM	MMNGGHYTYSENRVEK	4355	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=5203	15.026	4	1930.8302	1930.8302	K	D	133	149
PSM	MNDTVTIR	4356	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=13404	31.148	2	990.48043	990.4804	-	T	1	9
PSM	MNVDHEVNLLVEEIHR	4357	sp|Q9P1F3|ABRAL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=24881	53.211	3	1987.9786	1987.9786	-	L	1	17
PSM	MQQMSEQVHTLR	4358	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7973	20.68	3	1486.7021	1486.7021	R	E	411	423
PSM	MVNHFIAEFK	4359	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:35	ms_run[2]:scan=12364	29.162	3	1250.6118	1250.6118	R	R	237	247
PSM	NGVMPSHFSR	4360	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7446	19.552	2	1130.5291	1130.5291	R	G	85	95
PSM	NIELICQENEGENDPVLQR	4361	sp|Q15691|MARE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	6-UNIMOD:4	ms_run[2]:scan=16413	36.98	3	2269.0645	2269.0645	R	I	223	242
PSM	NIIQQAIDAGEVPSYNAFVK	4362	sp|Q8WXX5|DNJC9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24583	52.628	3	2176.1164	2176.1164	R	E	161	181
PSM	NILFVITKPDVYK	4363	sp|Q13765|NACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18791	41.328	3	1548.8916	1548.8916	K	S	101	114
PSM	NISHYEEQLVK	4364	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10090	24.626	3	1358.683	1358.6830	R	M	381	392
PSM	NKIEELQQR	4365	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5548	15.676	3	1156.62	1156.6200	R	K	258	267
PSM	NLEIDALNQR	4366	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13587	31.538	2	1184.6149	1184.6149	R	K	1874	1884
PSM	NLENELELTK	4367	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14726	33.774	2	1201.619	1201.6190	K	M	2592	2602
PSM	NLNSCLQQLK	4368	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:4	ms_run[2]:scan=12661	29.754	2	1216.6234	1216.6234	K	Q	1427	1437
PSM	NNQESDCVSK	4369	sp|A6NDG6|PGP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	7-UNIMOD:4	ms_run[2]:scan=2314	9.0234	2	1179.4826	1179.4826	K	K	291	301
PSM	NPPGFAFVEFEDPRDAADAVR	4370	sp|P84103-2|SRSF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21765	47.06	3	2319.092	2319.0920	R	E	44	65
PSM	NPQQQESLK	4371	sp|O95816-2|BAG2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3476	11.422	2	1070.5356	1070.5356	R	H	70	79
PSM	NSEGWEQNGLYEFFR	4372	sp|Q8IWX8|CHERP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24594	52.651	2	1874.8224	1874.8224	R	A	704	719
PSM	NSPGVPTGAK	4373	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4222	13.031	2	926.48214	926.4821	R	K	36	46
PSM	NTSQETMLR	4374	sp|P49454|CENPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6360	17.181	2	1078.5077	1078.5077	K	D	530	539
PSM	NVIGLQMGTNR	4375	sp|P37802|TAGL2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12673	29.779	2	1201.6237	1201.6237	K	G	172	183
PSM	NYVFTGYR	4376	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12424	29.267	2	1018.4872	1018.4872	R	V	1102	1110
PSM	QKQEATESLK	4377	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2519	9.382	2	1160.6037	1160.6037	R	C	1885	1895
PSM	QLESNLLPK	4378	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12207	28.886	2	1040.5866	1040.5866	R	H	1879	1888
PSM	QLIVGVNK	4379	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9116	22.771	2	869.53345	869.5335	K	M	147	155
PSM	QLLEELER	4380	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14277	32.954	2	1028.5502	1028.5502	K	Q	171	179
PSM	QLLQANPILEAFGNAK	4381	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24502	52.469	3	1725.9414	1725.9414	R	T	210	226
PSM	QLLQEQESVK	4382	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8342	21.325	2	1200.635	1200.6350	R	Q	1667	1677
PSM	QLTLEQLHAVEISAVHSR	4383	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16410	36.973	3	2030.0909	2030.0909	R	D	116	134
PSM	QMEGEGIAPIK	4384	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10063	24.579	2	1171.5907	1171.5907	K	M	605	616
PSM	QMNQTLQDK	4385	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4598	13.894	2	1104.5234	1104.5234	K	T	1101	1110
PSM	QMSGAQIK	4386	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3998	12.537	2	861.43784	861.4378	R	I	307	315
PSM	QPVLSQTEAR	4387	sp|P28070|PSB4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6318	17.108	2	1127.5935	1127.5935	K	D	202	212
PSM	QQNQALEK	4388	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2484	9.3236	2	957.48796	957.4880	R	Q	2053	2061
PSM	QSGEAFVELGSEDDVK	4389	sp|P52597|HNRPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14811	33.945	2	1708.7792	1708.7792	R	M	53	69
PSM	QSLPPGLAVK	4390	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11190	26.909	2	1008.5968	1008.5968	K	E	58	68
PSM	QSLPPGLAVK	4391	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11541	27.543	2	1008.5968	1008.5968	K	E	58	68
PSM	QTIAEQESK	4392	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3231	10.889	2	1032.5088	1032.5088	R	L	549	558
PSM	QTVAVGVIK	4393	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9213	22.937	2	913.55967	913.5597	R	A	431	440
PSM	QVEEQSAAANEEVLFPFCR	4394	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	18-UNIMOD:4	ms_run[2]:scan=21481	46.546	3	2223.0266	2223.0266	K	E	218	237
PSM	QYPISLVLAPTR	4395	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20316	44.373	2	1356.7765	1356.7765	K	E	249	261
PSM	RFVNVVPTFGK	4396	sp|P62861|RS30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14060	32.574	3	1262.7135	1262.7135	R	K	41	52
PSM	RGDLPFVVPR	4397	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13896	32.221	3	1154.656	1154.6560	R	R	1923	1933
PSM	RGSLPSHLQLADPQGSWQEQLAAPEEGETK	4398	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16758	37.591	4	3258.5905	3258.5905	R	I	1019	1049
PSM	RLDTSLGSAR	4399	sp|Q9Y3D2|MSRB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5999	16.536	2	1074.5782	1074.5782	R	T	132	142
PSM	RLEEMNINIR	4400	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11880	28.229	3	1286.6765	1286.6765	K	K	1566	1576
PSM	RLLLEDLVK	4401	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17625	39.185	2	1097.6808	1097.6808	R	K	2221	2230
PSM	RLQEALAAK	4402	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4798	14.279	2	998.58728	998.5873	R	E	1009	1018
PSM	SDLLLEGFNNYR	4403	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20592	44.939	2	1439.7045	1439.7045	K	F	297	309
PSM	SFSRPDHLNSHVR	4404	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5169	14.97	5	1550.7702	1550.7702	K	Q	345	358
PSM	SGEGMGIR	4405	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5398	15.36	2	805.37524	805.3752	R	L	399	407
PSM	SGNIVAGIANESK	4406	sp|P49915-2|GUAA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11147	26.831	2	1258.6517	1258.6517	R	K	71	84
PSM	SHKPPISFPLCANGQVFGLYK	4407	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:4	ms_run[2]:scan=24667	52.795	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHKPPISFPLCANGQVFGLYK	4408	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:4	ms_run[2]:scan=27355	59.286	4	2359.2147	2359.2147	K	N	997	1018
PSM	SHKPPISFPLCANGQVFGLYK	4409	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:4	ms_run[2]:scan=19816	43.442	5	2359.2147	2359.2147	K	N	997	1018
PSM	SIYGERFPDENFK	4410	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13582	31.52	3	1600.7522	1600.7522	K	L	117	130
PSM	SKAEEQFK	4411	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2592	9.5017	2	965.48181	965.4818	R	F	175	183
PSM	SLTQMEDVLK	4412	sp|Q9NYP9|MS18A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16268	36.722	2	1162.5904	1162.5904	K	A	204	214
PSM	SMSSLQDDRDR	4413	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4950	14.558	3	1308.5728	1308.5728	K	V	2198	2209
PSM	SMYEEEINETR	4414	sp|P20700|LMNB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=10535	25.593	2	1399.5926	1399.5926	K	R	210	221
PSM	SNILLLGPTGSGK	4415	sp|O76031|CLPX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15396	35.177	2	1255.7136	1255.7136	K	T	287	300
PSM	SQEVIWGLQEQLQDTAR	4416	sp|Q9Y2I6|NINL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21155	45.965	2	1999.9963	1999.9963	K	G	686	703
PSM	SSTAISSIAADGEFLHELEEK	4417	sp|O75694|NU155_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22735	49.063	3	2233.075	2233.0750	K	M	1127	1148
PSM	STNTAVSR	4418	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2133	8.7191	2	834.41954	834.4195	R	R	60	68
PSM	STQPDEQLTMNSEK	4419	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:35	ms_run[2]:scan=6251	16.988	2	1622.7094	1622.7094	K	S	23	37
PSM	SVEEVASEIQPFLR	4420	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=22940	49.459	3	1602.8253	1602.8253	K	G	2000	2014
PSM	SVELEEALPVTTAEGMAK	4421	sp|Q92522|H1X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=23994	51.469	2	1915.9449	1915.9449	M	K	2	20
PSM	SVHHVIEECK	4422	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:4	ms_run[2]:scan=2596	9.5119	3	1236.5921	1236.5921	R	Q	1379	1389
PSM	TADGIVSHLK	4423	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8157	21.001	3	1039.5662	1039.5662	R	K	120	130
PSM	TAEHEAAQQDLQSK	4424	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3776	12.043	3	1554.7274	1554.7274	R	F	508	522
PSM	TAGEEEMIK	4425	sp|Q14331|FRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=6601	17.595	2	1006.4641	1006.4641	K	I	171	180
PSM	TATESFASDPILYRPVAVALDTK	4426	sp|P14618-2|KPYM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21801	47.122	3	2464.285	2464.2850	R	G	93	116
PSM	TATQLAVNK	4427	sp|Q99832|TCPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5179	14.987	2	944.5291	944.5291	R	I	127	136
PSM	TAVAPIER	4428	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5963	16.449	2	855.48142	855.4814	K	V	24	32
PSM	TDQVIQSLIALVNDPQPEHPLR	4429	sp|P68036-2|UB2L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=26287	56.342	3	2482.318	2482.3180	K	A	69	91
PSM	TEADVNPK	4430	sp|P55769|NH2L1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	1-UNIMOD:1	ms_run[2]:scan=6180	16.863	2	914.43453	914.4345	M	A	2	10
PSM	TEVNYTQLVDLHAR	4431	sp|P36969-2|GPX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15695	35.711	3	1657.8424	1657.8424	K	Y	49	63
PSM	TIGPDMFLGTCR	4432	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:4	ms_run[2]:scan=19399	42.609	3	1366.6373	1366.6373	K	R	1354	1366
PSM	TLSGMESYCVR	4433	sp|P50991-2|TCPD_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	9-UNIMOD:4	ms_run[2]:scan=11916	28.289	2	1301.5744	1301.5744	R	A	412	423
PSM	TLTAVHDAILEDLVFPSEIVGKR	4434	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=24785	53.028	4	2522.3744	2522.3744	R	I	121	144
PSM	TPCNAGTFSQPEK	4435	sp|O43684-2|BUB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	3-UNIMOD:4	ms_run[2]:scan=6884	18.329	2	1435.6402	1435.6402	R	V	127	140
PSM	TSHILSLQK	4436	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7495	19.64	3	1025.5869	1025.5869	K	T	383	392
PSM	TSLSANNATLEK	4437	sp|O75330-4|HMMR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7587	19.812	2	1247.6357	1247.6357	K	Q	41	53
PSM	TSTAPAASPNVR	4438	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4629	13.954	2	1170.5993	1170.5993	R	R	19	31
PSM	TTPDVIFVFGFR	4439	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=26023	55.719	2	1397.7343	1397.7343	K	T	50	62
PSM	TVELSIPADPANLDSEAK	4440	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17955	39.768	3	1868.9367	1868.9367	R	I	1992	2010
PSM	TVGVEPAADGK	4441	sp|P46779|RL28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5054	14.774	2	1042.5295	1042.5295	K	G	48	59
PSM	TVNDWTSSNEK	4442	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7123	18.85	2	1279.5681	1279.5681	R	A	3000	3011
PSM	TVPVEAVTSK	4443	sp|Q14247-3|SRC8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7458	19.575	2	1029.5706	1029.5706	K	T	300	310
PSM	TVYHAEEVQCDGR	4444	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	10-UNIMOD:4	ms_run[2]:scan=5796	16.147	2	1562.6784	1562.6784	R	S	16	29
PSM	TYHEVVDEIYFK	4445	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15196	34.782	3	1541.7402	1541.7402	K	V	81	93
PSM	VAAYDKLEK	4446	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5998	16.535	3	1035.5601	1035.5601	K	T	1405	1414
PSM	VCNPIITK	4447	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:4	ms_run[2]:scan=8007	20.737	2	943.51609	943.5161	K	L	602	610
PSM	VDFTFYPR	4448	sp|Q9H857-2|NT5D2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17664	39.251	2	1043.5076	1043.5076	R	R	518	526
PSM	VEDSNPQK	4449	sp|Q9P016|THYN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2018	8.5305	2	915.42977	915.4298	K	T	35	43
PSM	VEEAEMILK	4450	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12622	29.685	2	1060.5474	1060.5474	R	N	1295	1304
PSM	VEEIAASK	4451	sp|Q02543|RL18A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4092	12.782	2	845.44945	845.4494	K	C	129	137
PSM	VETFSGVYKK	4452	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8025	20.768	3	1156.6128	1156.6128	K	L	170	180
PSM	VETFSGVYKK	4453	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8037	20.787	2	1156.6128	1156.6128	K	L	170	180
PSM	VFSWGFGGYGR	4454	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=20770	45.256	2	1231.5774	1231.5774	R	L	351	362
PSM	VGLSGAPADACSTAQK	4455	sp|Q8NFW8|NEUA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	11-UNIMOD:4	ms_run[2]:scan=8143	20.978	2	1531.7301	1531.7301	R	A	384	400
PSM	VHDLALR	4456	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5978	16.49	2	822.47119	822.4712	K	A	62	69
PSM	VHQVTPQTHFIS	4457	sp|Q9GZP4-2|PITH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9111	22.762	3	1392.715	1392.7150	R	-	199	211
PSM	VHVGDEDFVHLR	4458	sp|P04080|CYTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11821	28.132	4	1421.7052	1421.7052	K	V	57	69
PSM	VIGIDHIK	4459	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=8626	21.913	2	893.53345	893.5335	K	E	106	114
PSM	VLEGMEVVR	4460	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	5-UNIMOD:35	ms_run[2]:scan=12197	28.868	2	1046.543	1046.5430	K	K	172	181
PSM	VLGLETEHK	4461	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7380	19.406	2	1024.5553	1024.5553	R	V	670	679
PSM	VLLGETGKEK	4462	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5065	14.798	2	1072.6128	1072.6128	R	L	23	33
PSM	VLSIGDGIAR	4463	sp|P25705-2|ATPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12772	29.944	2	999.57129	999.5713	R	V	24	34
PSM	VMLGETNPADSKPGTIR	4464	sp|P22392|NDKB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0	2-UNIMOD:35	ms_run[2]:scan=9021	22.605	3	1800.904	1800.9040	R	G	89	106
PSM	VNINIVGDFK	4465	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17994	39.835	2	1117.6132	1117.6132	K	L	459	469
PSM	VPEWVDTVK	4466	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=13860	32.132	2	1071.5601	1071.5601	K	L	30	39
PSM	VPSPPPGHK	4467	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2655	9.6159	3	914.4974	914.4974	K	W	392	401
PSM	VQIGEYTFEK	4468	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=14844	34.006	2	1212.6027	1212.6027	K	G	1116	1126
PSM	VQIGEYTFEK	4469	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15131	34.636	2	1212.6027	1212.6027	K	G	1116	1126
PSM	VQIGEYTFEKGDYGDAVVYR	4470	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=25268	53.97	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	4471	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21489	46.561	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	4472	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=23664	50.845	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQQTVQDLFGR	4473	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15406	35.196	3	1289.6728	1289.6728	K	A	395	406
PSM	VQTESSTGSVGSNR	4474	sp|Q9BRX2|PELO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3463	11.399	2	1407.659	1407.6590	K	V	47	61
PSM	VREYELR	4475	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5723	16.015	2	963.51378	963.5138	K	K	89	96
PSM	VRVELSNGEK	4476	sp|P84103-2|SRSF3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=5265	15.135	2	1129.6091	1129.6091	R	R	76	86
PSM	VSHYIINSLPNR	4477	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=11444	27.365	3	1411.7572	1411.7572	R	R	58	70
PSM	VSHYIINSLPNRR	4478	sp|P46109|CRKL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9364	23.206	3	1567.8583	1567.8583	R	F	58	71
PSM	VTLTSEEEAR	4479	sp|P00338-4|LDHA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7196	18.99	2	1133.5564	1133.5564	K	L	248	258
PSM	VTSHAIVK	4480	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2528	9.3977	2	853.50215	853.5022	K	E	903	911
PSM	VTVEPHPELR	4481	sp|Q5T440|CAF17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=7644	19.911	3	1175.6299	1175.6299	K	V	149	159
PSM	VVVDSDSLAFVK	4482	sp|Q86U28|ISCA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16120	36.468	2	1277.6867	1277.6867	R	G	106	118
PSM	VYALPEDLVEVKPK	4483	sp|P13797-3|PLST_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16799	37.664	3	1598.892	1598.8920	R	M	555	569
PSM	WFQPVANAADAEAVR	4484	sp|O14654|IRS4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=16454	37.054	2	1643.8056	1643.8056	R	G	1162	1177
PSM	WSMVDVQFVR	4485	sp|Q9P016|THYN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=21262	46.156	2	1265.6227	1265.6227	K	M	158	168
PSM	YAEEDRR	4486	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=2171	8.7754	2	937.42536	937.4254	K	K	568	575
PSM	YALYDATYETK	4487	sp|P23528|COF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=12949	30.318	2	1336.6187	1336.6187	R	E	82	93
PSM	YKAEDEK	4488	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=1937	8.4035	2	881.41306	881.4131	K	Q	525	532
PSM	YLAEFATGNDRK	4489	sp|P62258|1433E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=9520	23.468	3	1383.6783	1383.6783	R	E	131	143
PSM	YLSSVSSQETQGGPLAPMTGTIEK	4490	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17071	38.141	2	2480.2105	2480.2105	K	V	636	660
PSM	YLYLTPQDYK	4491	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=15629	35.598	2	1302.6496	1302.6496	R	R	1750	1760
PSM	YLYTLVITDKEK	4492	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=17558	39.072	3	1484.8126	1484.8126	R	A	41	53
PSM	YQEDVQQLQQALAQRDEELR	4493	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=18243	40.306	3	2459.2041	2459.2041	R	H	2033	2053
PSM	YSEMSEEKR	4494	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=3420	11.319	3	1157.5023	1157.5023	K	A	833	842
PSM	YYKVDENGK	4495	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	18.0		ms_run[2]:scan=4395	13.432	2	1114.5295	1114.5295	K	I	105	114
PSM	TLSECAEMSSVAEISSHMR	4496	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=18322	40.458593	3	2123.927758	2123.928575	R	E	1221	1240
PSM	ERLQEMLMGLEAK	4497	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20006	43.782909	3	1546.785012	1546.784735	R	Q	522	535
PSM	QDMQEAQGEQK	4498	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=6313	17.098011	2	1273.5245	1273.5240	R	E	1087	1098
PSM	SQVHTELQDLQR	4499	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9308	23.11155	3	1452.733656	1452.732105	K	Q	1281	1293
PSM	AQALQEQGELK	4500	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7022	18.630376	2	1213.631048	1213.630266	R	V	1402	1413
PSM	LALEQQVETANEEMTFMK	4501	sp|Q99996|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=21654	46.852533	2	2111.994717	2110.991493	K	N	2396	2414
PSM	DNTCVVEFQFMLPTSHPNR	4502	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4	ms_run[1]:scan=21964	47.434616	3	2291.042187	2291.046322	K	G	1173	1192
PSM	TIQVENSHLILTGAGALNK	4503	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15618	35.580316	3	1979.088020	1978.084740	R	V	1838	1857
PSM	EYEILLQSYENVSNEAER	4504	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=21861	47.232214	3	2184.995935	2185.017508	K	I	1614	1632
PSM	AMTDLQNMLEAK	4505	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=18980	41.679084	2	1363.646712	1363.647572	R	N	483	495
PSM	ISSVLSYNEK	4506	sp|Q8N4C6|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10565	25.645941	2	1138.587762	1138.587004	K	L	1702	1712
PSM	QILETMQNDR	4507	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=17160	38.306229	2	1230.5702	1229.5702	R	T	523	533
PSM	QELQETQER	4508	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=8056	20.82365	2	1142.5209	1142.5199	R	L	666	675
PSM	HSQAVEELAEQLEQTKR	4509	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15153	34.68005	4	1995.007604	1995.002132	K	V	1194	1211
PSM	EMEAELEDER	4510	sp|P35579|MYH9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9461	23.36923	2	1249.512197	1249.513247	R	K	1593	1603
PSM	SLLSESNKK	4511	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4220	13.028232	2	1004.550396	1004.550225	K	L	463	472
PSM	CCYDHVISTSHK	4512	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=10494	25.505446	3	1488.6129	1488.6121	K	L	952	964
PSM	LKLFAAETLK	4513	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15019	34.410118	3	1133.688392	1132.685596	R	A	1053	1063
PSM	EVLSDRELHLSWEVGK	4514	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:27	ms_run[1]:scan=16432	37.012809	4	1877.9609	1877.9630	R	P	1079	1095
PSM	GDYGDAVVYR	4515	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10251	24.919254	2	1113.510616	1113.509088	K	G	1126	1136
PSM	ITGLYPTLNISDEFSSNVANYQK	4516	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=31812	72.70172	3	2574.264202	2573.264949	R	V	1172	1195
PSM	SHFAIGLALYYPSAR	4517	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=29195	62.984624	3	1665.870427	1664.867477	K	I	1212	1227
PSM	HYVYIGDPAQLPAPR	4518	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16447	37.043698	3	1695.876582	1695.873290	K	T	1318	1333
PSM	TIGPDMFLGTCR	4519	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=16448	37.044877	2	1382.631129	1382.632257	K	R	1354	1366
PSM	TIGPDMFLGTCR	4520	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4	ms_run[1]:scan=24098	51.673428	2	1367.639741	1366.637342	K	R	1354	1366
PSM	TIGPDMFLGTCR	4521	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4	ms_run[1]:scan=18980	41.679084	2	1366.635867	1366.637342	K	R	1354	1366
PSM	TIGPDMFLGTCR	4522	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:4	ms_run[1]:scan=20195	44.116625	2	1366.635867	1366.637342	K	R	1354	1366
PSM	CPAEIVDTVSALVYDNK	4523	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=20595	44.943305	2	1875.9102	1875.8922	R	L	1367	1384
PSM	GVITHDVSSAINRPQIGVVR	4524	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13341	31.036128	4	2118.161664	2117.170535	K	E	1401	1421
PSM	HGEEVTPEDVLSAAMYPDVFAHFK	4525	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=25612	54.755936	4	2688.252394	2688.253004	R	D	998	1022
PSM	HCVYIGDPAQLPAPR	4526	cov|corona00277|ORF1b_USA/MA1/2020_travel_history	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:4	ms_run[1]:scan=13300	30.959001	2	1694.863084	1692.840610	K	T	1318	1333
PSM	HQNQNTIQELLQNCSDCLMR	4527	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=21319	46.254669	3	2502.123242	2501.120961	R	A	65	85
PSM	VLLQEEGTR	4528	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7950	20.639059	2	1043.561043	1043.561124	R	K	1176	1185
PSM	EHLMLEEELR	4529	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13315	30.990399	3	1297.635067	1297.633637	K	N	1716	1726
PSM	EHLMLEEELR	4530	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13331	31.019224	3	1297.635067	1297.633637	K	N	1716	1726
PSM	ETQSQLETER	4531	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=5162	14.958601	2	1219.563377	1219.568060	R	S	1923	1933
PSM	QVDQLTNDK	4532	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=10365	25.211738	2	1042.4936	1042.4926	R	A	160	169
PSM	LQEEMLQR	4533	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9154	22.834823	2	1045.522826	1045.522630	K	E	189	197
PSM	LQEEMLQR	4534	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:35	ms_run[1]:scan=6009	16.562871	2	1062.520413	1061.517545	K	E	189	197
PSM	QDVDNASLAR	4535	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=9701	23.809304	2	1070.4973	1070.4987	R	L	208	218
PSM	QVQSLTCEVDALK	4536	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=21708	46.953497	2	1472.7189	1472.7176	R	G	322	335
PSM	LLGQFTLIGIPPAPR	4537	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=24358	52.190195	2	1591.943948	1591.944999	K	G	499	514
PSM	LLGQFTLIGIPPAPR	4538	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=24682	52.822658	2	1591.943948	1591.944999	K	G	499	514
PSM	KFGDPVVQSDMK	4539	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	11-UNIMOD:35	ms_run[1]:scan=6876	18.314869	3	1365.660692	1365.659852	R	H	77	89
PSM	NTSQETMLR	4540	sp|P49454|CENPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6388	17.232515	2	1078.508989	1078.507708	K	D	530	539
PSM	EIEELTQENGTLK	4541	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11671	27.770186	2	1504.753079	1502.746418	R	E	968	981
PSM	LSSTQQSLAEKETHLTNLR	4542	sp|Q8IUD2|RB6I2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11164	26.86443	3	2156.125042	2155.123310	K	A	895	914
PSM	CEFQDAYVLLSEKK	4543	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:4	ms_run[1]:scan=17907	39.679834	3	1728.840622	1728.839273	K	I	237	251
PSM	GVPQQIEVAR	4544	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9610	23.623759	2	1095.604428	1095.603657	R	Q	409	419
PSM	ALVNQLHER	4545	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6499	17.428386	3	1078.588330	1078.588342	K	V	51	60
PSM	MFESFIESVPLLK	4546	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:35	ms_run[1]:scan=25034	53.501444	2	1555.803833	1554.800368	K	S	251	264
PSM	LESTVEIYR	4547	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0		ms_run[1]:scan=11051	26.666677	2	1108.5792	1108.5759	K	Q	319	328
PSM	QELIEDLQPDINQNVQK	4548	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17201	38.381824	3	2024.020193	2023.022199	K	I	568	585
PSM	AFVHWYVGEGMEEGEFSEAR	4549	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=20577	44.913876	3	2329.029460	2329.010983	R	E	403	423
PSM	QTVAVGVIK	4550	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=14050	32.557336	2	896.5328	896.5326	R	A	431	440
PSM	QTVAVGVIK	4551	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=14052	32.560352	1	896.5325	896.5326	R	A	431	440
PSM	AVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPR	4552	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=22656	48.920535	4	3696.919805	3694.915637	K	E	355	389
PSM	TLSQAIVK	4553	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7901	20.548414	2	858.518007	858.517468	K	V	411	419
PSM	IKEQEDYIR	4554	sp|Q96L14|C170L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6400	17.256762	3	1192.609305	1192.608802	R	D	11	20
PSM	GAEEMETVIPVDVMR	4555	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:35	ms_run[1]:scan=20410	44.56273	2	1690.788360	1690.790608	K	R	13	28
PSM	GEVAYIDGQVLVPPGYGQDVR	4556	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=19960	43.705053	3	2232.124825	2231.122248	R	K	1790	1811
PSM	ERHPGSFDVVHVK	4557	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6810	18.185691	3	1505.775342	1505.773911	R	D	199	212
PSM	HPGSFDVVHVK	4558	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8003	20.731225	3	1220.630977	1220.630206	R	D	201	212
PSM	LMCSLCHCPGATIGCDVK	4559	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,3-UNIMOD:4,6-UNIMOD:4,8-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=10350	25.169627	3	2093.884421	2093.882494	K	T	80	98
PSM	FVDGLMIHSGDPVNYYVDTAVR	4560	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:35	ms_run[1]:scan=19948	43.683685	3	2483.177635	2483.179111	K	H	152	174
PSM	QEQVTAAVAHAVEQQMQK	4561	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:28	ms_run[1]:scan=23967	51.409809	3	1977.9611	1977.9573	R	L	128	146
PSM	HGGVIHIYVDK	4562	sp|Q14498|RBM39_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8243	21.153318	3	1236.660968	1236.661507	K	N	457	468
PSM	ILAEGGGAK	4563	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=3839	12.185204	2	814.455137	814.454868	K	F	80	89
PSM	VQQACEMVMDILR	4564	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=23270	50.080531	3	1592.757298	1591.752055	K	E	292	305
PSM	AMLDQLMGTSR	4565	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	2-UNIMOD:35,7-UNIMOD:35	ms_run[1]:scan=17241	38.457	2	1254.574660	1253.574408	R	D	9	20
PSM	LILPVGPAGGNQMLEQYDKLQDGSIK	4566	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	13-UNIMOD:35	ms_run[1]:scan=19391	42.591546	3	2801.454489	2799.447681	R	M	179	205
PSM	TLNDMRQEYEQLIAK	4567	sp|P35527|K1C9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:35	ms_run[1]:scan=14064	32.58005	3	1867.916499	1866.914563	K	N	322	337
PSM	RVLQALEGLK	4568	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12245	28.951219	3	1125.687669	1125.686993	R	M	102	112
PSM	ELAQQVQQVAAEYCR	4569	sp|P17844|DDX5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:4	ms_run[1]:scan=18337	40.485982	3	1791.855317	1791.857383	R	A	178	193
PSM	GPADSLSTAAGAAELSAEGAGK	4570	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16512	37.157741	3	1930.932527	1929.927964	R	S	268	290
PSM	GHVFEESQVAGTPMFVVK	4571	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	14-UNIMOD:35	ms_run[1]:scan=14469	33.294539	3	1978.975773	1976.966599	R	A	768	786
PSM	AFITNIPFDVK	4572	sp|P52272|HNRPM_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=21262	46.155571	2	1263.686957	1263.686324	R	W	73	84
PSM	VAHEDPMYDIIR	4573	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14563	33.460752	3	1457.697793	1457.697300	R	D	135	147
PSM	TLTAVHDAILEDLVFPSEIVGKR	4574	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=24793	53.042416	4	2522.374194	2522.374440	R	I	121	144
PSM	VLLGETGKEK	4575	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=5048	14.762974	2	1072.614161	1072.612825	R	L	23	33
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	4576	sp|Q15366|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:35	ms_run[1]:scan=12729	29.871911	5	3397.580772	3397.581960	K	G	246	277
PSM	FPSHFSSDLK	4577	sp|P17612|KAPCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10359	25.194661	3	1163.562147	1163.561124	R	D	258	268
PSM	GSGGFGSTGKN	4578	sp|P33316|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=3174	10.753141	2	967.435954	967.435923	R	-	242	253
PSM	WWEEERYPEGIK	4579	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14290	32.978237	3	1620.760188	1620.757258	K	W	205	217
PSM	SGALDVLQMK	4580	sp|P08865|RSSA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=21740	47.011984	2	1103.5762	1102.5692	M	E	2	12
PSM	KSDGIYIINLK	4581	sp|P08865|RSSA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14887	34.081231	3	1262.722661	1262.723438	R	R	42	53
PSM	SGVSLAALKK	4582	sp|P16403|H12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8903	22.372957	3	972.596288	972.596781	R	A	55	65
PSM	YLYTLVITDKEK	4583	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15993	36.241101	3	1484.812871	1484.812647	R	A	41	53
PSM	LKQSLPPGLAVK	4584	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=10439	25.385141	3	1249.776578	1249.775808	K	E	56	68
PSM	EQIVPKPEEEVAQK	4585	sp|P18621|RL17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8500	21.694298	2	1623.850071	1622.851552	K	K	154	168
PSM	MDGIVPDIAVGTK	4586	sp|P26599|PTBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	1-UNIMOD:1	ms_run[1]:scan=23659	50.837361	2	1356.695750	1356.695903	-	R	1	14
PSM	FLDGIYVSEK	4587	sp|P32969|RL9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16227	36.653149	2	1169.596165	1169.596841	K	G	175	185
PSM	AAHSEGNTTAGLDMR	4588	sp|P78371|TCPB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6277	17.035187	3	1529.690387	1529.689254	R	E	467	482
PSM	RADVILSDMAPNATGFR	4589	sp|Q9UI43|MRM2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16524	37.174812	3	1832.921256	1832.920317	R	D	147	164
PSM	RPLGDSLSWVASQEDTNCILLR	4590	sp|Q9NYP9|MS18A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	18-UNIMOD:4	ms_run[1]:scan=21644	46.834892	3	2530.270699	2529.264572	R	C	90	112
PSM	ESYSIYVYK	4591	sp|P33778|H2B1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13748	31.870005	2	1150.554855	1150.554641	K	V	36	45
PSM	LIVNVNDLR	4592	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15559	35.466249	2	1054.613504	1054.613494	R	R	47	56
PSM	MGAYHTIELEPNR	4593	sp|Q9BRX2|PELO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11084	26.722179	3	1529.730746	1529.729663	K	Q	96	109
PSM	YVASYLLAALGGNSSPSAK	4594	sp|P05387|RLA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=23621	50.765612	2	1867.967670	1867.967979	R	D	3	22
PSM	NAGNCLSPAVIVGLLK	4595	sp|O43175|SERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=25088	53.605806	2	1625.898071	1624.897063	K	E	365	381
PSM	VTISYAEYIASR	4596	sp|Q6DCA0|AMERL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=17131	38.254056	2	1372.701754	1371.703431	K	Q	280	292
PSM	TNVVTMPTAHPR	4597	sp|Q13428|TCOF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=8006	20.735067	3	1322.676446	1322.676505	R	I	1019	1031
PSM	AGNLGGGVVTIER	4598	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11883	28.233985	2	1241.673999	1241.672800	K	S	53	66
PSM	KGLTPSQIGVILR	4599	sp|P62277|RS13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15246	34.899836	3	1380.846460	1380.845285	K	D	43	56
PSM	QHTENIQELLEDTNVR	4600	sp|Q8N8E3|CE112_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=18120	40.078227	3	1937.942785	1937.944283	K	L	376	392
PSM	IKDDGPSQSESATETAMTLPSESR	4601	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=11820	28.130415	3	2536.150190	2536.159891	K	V	369	393
PSM	VSRPENEQLR	4602	sp|Q8ND56|LS14A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=4238	13.061875	3	1226.637107	1226.636748	K	N	244	254
PSM	SQGGEPTYNVAVGR	4603	sp|P35080|PROF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9439	23.33334	2	1433.690171	1433.689906	K	A	92	106
PSM	YIQQTKPLTLER	4604	sp|O43809|CPSF5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=9470	23.384375	3	1489.833376	1488.830029	K	T	24	36
PSM	EGDVLTLLESER	4605	sp|P62857|RS28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=21822	47.162543	2	1359.687488	1359.688175	R	E	52	64
PSM	SVTEQGAELSNEER	4606	sp|P63104|1433Z_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=7951	20.640574	2	1548.709568	1547.706344	K	N	28	42
PSM	NHIILQENAQHATR	4607	sp|Q69YN2|C19L1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=5331	15.246454	3	1643.849153	1643.849201	R	F	209	223
PSM	IFVGGLSPDTPEEK	4608	sp|Q14103|HNRPD_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14276	32.952929	2	1487.746013	1487.750775	K	I	184	198
PSM	IMNVIGEPIDER	4609	sp|P06576|ATPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=15118	34.611103	2	1385.706761	1384.702051	R	G	144	156
PSM	LSTPAGVQVILR	4610	sp|Q9BQ48|RM34_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=16821	37.70161	2	1252.750227	1252.750322	R	R	70	82
PSM	KSAACQDDLTQALEK	4611	sp|Q8TBY8|PMFBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	5-UNIMOD:4	ms_run[1]:scan=18596	40.972945	2	1676.796140	1676.803950	R	L	737	752
PSM	MGGMVSFR	4612	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=12087	28.617103	2	884.407316	883.404429	R	T	1233	1241
PSM	IAELSEDDQK	4613	sp|Q9BZE4|NOG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=6423	17.296325	2	1148.547310	1146.540448	R	I	296	306
PSM	GTQAGEIHDLK	4614	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=5299	15.193639	3	1167.595427	1167.588401	K	D	553	564
PSM	KTQEQLALEMAELTAR	4615	sp|P26038|MOES_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=18892	41.523585	3	1830.952711	1830.950948	K	I	412	428
PSM	IAEGAQQGDPLSR	4616	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=13069	30.523231	2	1342.673702	1340.668442	K	Y	220	233
PSM	DLNHVCVISETGK	4617	sp|P00492|HPRT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	6-UNIMOD:4	ms_run[1]:scan=10226	24.865032	3	1473.738010	1470.713678	R	A	201	214
PSM	EKLDEFNELAIQK	4618	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0		ms_run[1]:scan=14576	33.481965	3	1576.818829	1575.814438	R	E	1538	1551
PSM	HSQCSEAIITVLCGTEGAQDGLSKPK	4619	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	18.0	4-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=16684	37.459151	4	2785.336134	2785.337479	K	N	1136	1162
PSM	AAAETQSLR	4620	sp|Q13523|PRP4B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:1	ms_run[2]:scan=9288	23.075	2	987.49852	987.4985	M	E	2	11
PSM	AAFTAFEEAQLPR	4621	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18410	40.621	3	1449.7252	1449.7252	R	L	171	184
PSM	AAFTAFEEAQLPR	4622	sp|Q96CT7|CC124_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18469	40.734	3	1449.7252	1449.7252	R	L	171	184
PSM	AAITILDGISQYSLR	4623	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23625	50.776	3	1619.8883	1619.8883	K	L	565	580
PSM	AALEWDVGR	4624	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14313	33.021	2	1015.5087	1015.5087	R	L	470	479
PSM	AALVLEDGSVLR	4625	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:1	ms_run[2]:scan=25050	53.531	2	1283.7085	1283.7085	M	G	2	14
PSM	AAQELQEGQR	4626	sp|P0DN79|CBSL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4022	12.615	2	1128.5523	1128.5523	K	C	360	370
PSM	ACDESVLMDLK	4627	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=16025	36.299	2	1279.5788	1279.5788	K	A	539	550
PSM	ACQSIYPLHDVFVR	4628	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=17195	38.369	3	1703.8454	1703.8454	K	K	200	214
PSM	ACTELGIR	4629	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=8353	21.344	2	918.4593	918.4593	R	T	55	63
PSM	ADENDEVK	4630	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2270	8.9442	2	918.39306	918.3931	R	I	991	999
PSM	AEGALEPGCHK	4631	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=3442	11.362	2	1167.5343	1167.5343	R	H	1001	1012
PSM	AGTHILCIK	4632	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=8195	21.069	3	1011.5535	1011.5535	R	D	733	742
PSM	AHLGTALK	4633	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3948	12.409	2	809.47594	809.4759	K	A	30	38
PSM	AIAALISEK	4634	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11805	28.103	2	914.54368	914.5437	K	L	770	779
PSM	ALAEFEEK	4635	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9496	23.427	2	935.46001	935.4600	K	M	57	65
PSM	ALAVSDLNR	4636	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9825	24.111	2	957.52434	957.5243	K	A	1062	1071
PSM	ALDMSLPSLVLK	4637	sp|Q12923-3|PTN13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23265	50.07	2	1285.7316	1285.7316	R	A	1931	1943
PSM	ALEEALEAKEEFER	4638	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14025	32.513	3	1662.8101	1662.8101	R	Q	1491	1505
PSM	ALEEAMEQK	4639	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7051	18.693	2	1047.4907	1047.4907	R	A	1484	1493
PSM	ALGAEIVR	4640	sp|P0DN79|CBSL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9407	23.277	2	827.4865	827.4865	R	T	183	191
PSM	ALGFMYIR	4641	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18861	41.468	2	969.51061	969.5106	R	Y	159	167
PSM	ALIVVPYAEGVIPDEAK	4642	sp|Q05519-2|SRS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22071	47.684	3	1782.9768	1782.9768	R	A	104	121
PSM	ALQENLALLTQTLAER	4643	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24618	52.7	3	1782.984	1782.9840	K	E	1418	1434
PSM	ALQENLALLTQTLAEREEEVETLR	4644	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26204	56.113	4	2768.4556	2768.4556	K	G	1418	1442
PSM	AMVNKDDIQK	4645	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4811	14.301	3	1160.586	1160.5860	K	M	69	79
PSM	AQAELASFK	4646	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9843	24.15	2	963.50255	963.5025	K	V	2078	2087
PSM	AQAVHPGYGFLSENKEFAR	4647	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13183	30.733	4	2120.0439	2120.0439	R	C	136	155
PSM	AQIHDLVLVGGSTR	4648	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12467	29.34	3	1464.8049	1464.8049	K	I	329	343
PSM	ARAEALQEALGK	4649	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9170	22.861	3	1255.6884	1255.6884	R	A	1961	1973
PSM	ASDPGLPAEEPKEK	4650	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6336	17.141	3	1466.7253	1466.7253	R	S	1858	1872
PSM	ATCETADRER	4651	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=2060	8.5952	3	1207.5251	1207.5251	K	A	996	1006
PSM	ATFDAISK	4652	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8567	21.815	2	851.43888	851.4389	K	T	239	247
PSM	ATIENLQENQK	4653	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7220	19.042	2	1286.6466	1286.6466	K	R	1719	1730
PSM	AVLLAGPPGTGK	4654	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11004	26.578	2	1079.6339	1079.6339	R	T	65	77
PSM	AVLVDLEPGTMDSVR	4655	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18316	40.447	3	1600.8131	1600.8131	R	S	63	78
PSM	AYVEANQMLGDLIK	4656	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21836	47.184	2	1563.7967	1563.7967	K	V	893	907
PSM	CNAVINEDPNAK	4657	sp|O60333-3|KIF1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4	ms_run[2]:scan=6520	17.463	2	1343.614	1343.6140	K	L	350	362
PSM	CQLLFALK	4658	sp|Q9BRJ7|TIRR_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4	ms_run[2]:scan=18773	41.296	2	991.55247	991.5525	K	V	171	179
PSM	CSVNGVASK	4659	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4	ms_run[2]:scan=3140	10.674	2	920.43857	920.4386	K	A	600	609
PSM	CVGNYDNR	4660	sp|P31323|KAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:4	ms_run[2]:scan=4087	12.772	2	996.40833	996.4083	R	G	211	219
PSM	DAGVIAGLNVLR	4661	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20003	43.778	3	1196.6877	1196.6877	K	I	160	172
PSM	DALRLELYK	4662	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14098	32.64	3	1119.6288	1119.6288	R	N	294	303
PSM	DDIENMVK	4663	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11270	27.047	2	962.4379	962.4379	K	N	556	564
PSM	DEDDADYKPK	4664	sp|P11387|TOP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3952	12.418	3	1194.5041	1194.5041	R	K	141	151
PSM	DEPIHILNVAIK	4665	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17915	39.697	3	1360.7715	1360.7715	R	T	1283	1295
PSM	DEQEIEFLR	4666	sp|Q96N16|JKIP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16503	37.141	2	1177.5615	1177.5615	R	L	391	400
PSM	DEQEIEFLR	4667	sp|Q96N16|JKIP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16532	37.19	2	1177.5615	1177.5615	R	L	391	400
PSM	DKDPVNK	4668	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1924	8.385	2	814.41848	814.4185	K	S	19	26
PSM	DLDPNNVIIEQEERR	4669	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14217	32.845	3	1838.9123	1838.9123	K	R	73	88
PSM	DLKPQNLLINR	4670	sp|Q00535|CDK5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14036	32.534	3	1322.767	1322.7670	R	N	126	137
PSM	DLLSTQPSETLASSDSFASTQPTHSWK	4671	sp|O75940|SPF30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18404	40.612	3	2920.3727	2920.3727	K	V	48	75
PSM	DNLAEDIMR	4672	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16738	37.558	2	1075.4968	1075.4968	R	L	176	185
PSM	DNYQAFCK	4673	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=8606	21.877	2	1044.4335	1044.4335	R	W	893	901
PSM	DQNELLEFR	4674	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16999	38.017	2	1162.5619	1162.5619	K	V	589	598
PSM	DSINFLDHINGK	4675	sp|Q96NC0|ZMAT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16415	36.982	3	1371.6783	1371.6783	K	K	91	103
PSM	DSLHQTILTQELEK	4676	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14511	33.368	2	1653.8574	1653.8574	K	L	1005	1019
PSM	DSQQAPLDGEVELLQQK	4677	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18347	40.503	3	1896.9429	1896.9429	R	L	1519	1536
PSM	DSYVGDEAQSKR	4678	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4727	14.155	3	1353.6161	1353.6161	K	G	51	63
PSM	DTDSEEEIR	4679	sp|P0DP25|CALM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5417	15.4	2	1092.4571	1092.4571	K	E	79	88
PSM	DVNQQEFVR	4680	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9329	23.148	2	1133.5465	1133.5465	K	A	8	17
PSM	EAAASGLPLMVIIHK	4681	sp|O95881|TXD12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20006	43.783	3	1548.8698	1548.8698	K	S	49	64
PSM	EAETPQAK	4682	sp|Q14978|NOLC1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2187	8.8022	2	872.42396	872.4240	K	K	594	602
PSM	EAPDTAEK	4683	sp|Q96CT7|CC124_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2150	8.7449	2	859.39233	859.3923	R	A	112	120
PSM	EAQTLDSQIQETSI	4684	sp|P27816|MAP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16325	36.824	2	1561.7471	1561.7471	R	-	1139	1153
PSM	EDMAALEK	4685	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:35	ms_run[2]:scan=3929	12.367	2	921.41135	921.4113	R	D	423	431
PSM	EDMAALEKDYEEVGADSADGEDEGEEY	4686	sp|Q9BQE3|TBA1C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20588	44.933	3	2965.1455	2965.1455	R	-	423	450
PSM	EEQLQAECER	4687	sp|A7MCY6|TBKB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:4	ms_run[2]:scan=5647	15.846	2	1290.551	1290.5510	R	L	247	257
PSM	EETGLLMPLK	4688	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16447	37.044	2	1129.6053	1129.6053	R	A	725	735
PSM	EETQPPVALKK	4689	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5962	16.448	3	1238.6871	1238.6871	K	E	93	104
PSM	EFLAHAPTK	4690	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6560	17.528	3	1012.5342	1012.5342	R	G	82	91
PSM	EHALLAYTLGVK	4691	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15543	35.436	2	1313.7343	1313.7343	R	Q	135	147
PSM	EHVIEALR	4692	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7302	19.206	3	965.52943	965.5294	K	R	146	154
PSM	EKLELSQR	4693	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5492	15.566	3	1001.5506	1001.5506	R	L	951	959
PSM	EKLLSGSESSSK	4694	sp|Q5BKY9|F133B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3846	12.197	3	1250.6354	1250.6354	R	K	78	90
PSM	ELEEENTSLK	4695	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6994	18.572	2	1190.5667	1190.5667	R	V	1696	1706
PSM	ELLAALQK	4696	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12860	30.129	2	884.53312	884.5331	R	V	232	240
PSM	ELLLTGPGLEER	4697	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16706	37.5	2	1325.7191	1325.7191	R	V	23	35
PSM	ELLQNGMNGR	4698	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8742	22.1	2	1130.5502	1130.5502	K	T	3533	3543
PSM	ELNSNHDGADETSEKEQQEAIEHIDEVQNEIDR	4699	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17577	39.103	4	3820.6896	3820.6896	K	L	12	45
PSM	ELSVLLLEMK	4700	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23033	49.624	2	1173.6679	1173.6679	K	E	563	573
PSM	EMVLELIR	4701	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18424	40.647	2	1001.558	1001.5580	K	D	249	257
PSM	ENFCNIHVSLVPQPSSTGEQK	4702	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=15638	35.614	3	2370.1274	2370.1274	R	T	173	194
PSM	ENTQTTIK	4703	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2731	9.7733	2	933.47673	933.4767	R	L	148	156
PSM	EPLSLINVR	4704	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15884	36.047	2	1039.6026	1039.6026	R	K	66	75
PSM	EPVETAVDNNSK	4705	sp|Q6FI81|CPIN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5596	15.759	2	1301.6099	1301.6099	K	V	97	109
PSM	EQASTEHQSR	4706	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1784	8.1731	2	1171.5218	1171.5218	K	T	643	653
PSM	EQGDLQEK	4707	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2672	9.6525	2	945.44034	945.4403	R	S	2497	2505
PSM	EQGWDHIQTIDSLLR	4708	sp|Q9Y4X0-3|AMMR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20853	45.412	3	1809.901	1809.9010	K	K	225	240
PSM	EQQIVIQSSGGLSK	4709	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10571	25.655	2	1472.7835	1472.7835	R	D	542	556
PSM	ERDQELEALR	4710	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8596	21.863	3	1257.6313	1257.6313	K	A	1937	1947
PSM	ESEVLDLK	4711	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10883	26.334	2	931.48623	931.4862	R	E	1652	1660
PSM	ESLCDSPHQNLSRPLLENK	4712	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=10146	24.72	3	2236.0906	2236.0906	R	L	62	81
PSM	ETAENYLGHTAK	4713	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7267	19.134	3	1332.631	1332.6310	K	N	176	188
PSM	ETALTELR	4714	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10131	24.694	2	931.49746	931.4975	K	E	274	282
PSM	ETAVQQYK	4715	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4678	14.053	2	965.48181	965.4818	R	K	323	331
PSM	ETGNHYAMK	4716	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2936	10.267	3	1049.46	1049.4600	K	I	65	74
PSM	EVLSDRELHLSWEVGK	4717	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16567	37.25	3	1895.9741	1895.9741	R	P	1079	1095
PSM	EVLSLLQEK	4718	sp|Q6UB35|C1TM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15665	35.658	2	1057.6019	1057.6019	K	N	84	93
PSM	EYASVKEENER	4719	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4162	12.909	2	1352.6208	1352.6208	R	L	1497	1508
PSM	FACNGTVIEHPEYGEVIQLQGDQR	4720	sp|P41567|EIF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=16577	37.27	3	2759.2973	2759.2973	K	K	67	91
PSM	FADLSEAANRNNDALR	4721	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11104	26.757	3	1775.8551	1775.8551	K	Q	295	311
PSM	FANPFPAAVR	4722	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15856	35.997	2	1088.5767	1088.5767	K	G	490	500
PSM	FAQIIQEK	4723	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9979	24.405	2	975.53893	975.5389	K	E	2275	2283
PSM	FHPEPYGLEDDQR	4724	sp|O60716|CTND1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10829	26.242	3	1601.711	1601.7110	R	S	275	288
PSM	FKIGDQEFDHLPALLEFYK	4725	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24992	53.424	4	2309.1732	2309.1732	R	I	71	90
PSM	FMELMQEK	4726	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:35	ms_run[2]:scan=10240	24.896	2	1070.4777	1070.4777	R	A	812	820
PSM	FMELMQEK	4727	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13699	31.782	2	1054.4827	1054.4827	R	A	812	820
PSM	FQGPDNGQGPK	4728	sp|O43396|TXNL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5103	14.863	2	1143.5309	1143.5309	K	Y	182	193
PSM	FRDYEEK	4729	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4260	13.105	3	985.45051	985.4505	K	L	615	622
PSM	FVADGIFK	4730	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15266	34.939	2	895.48035	895.4804	K	A	11	19
PSM	FVLSQAKDEL	4731	sp|Q8NBS9|TXND5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15159	34.692	2	1148.6077	1148.6077	R	-	423	433
PSM	FVNVVPTFGKK	4732	sp|P62861|RS30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13414	31.166	3	1234.7074	1234.7074	R	K	42	53
PSM	GATQQILDEAER	4733	sp|P78371|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12306	29.057	2	1329.6525	1329.6525	R	S	377	389
PSM	GAVGNCVTTMVHNR	4734	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	6-UNIMOD:4	ms_run[2]:scan=9383	23.236	3	1514.7082	1514.7082	K	Y	176	190
PSM	GAWNIGEQK	4735	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10040	24.524	2	1001.493	1001.4930	K	S	519	528
PSM	GCEVVVSGK	4736	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=4931	14.522	2	933.45897	933.4590	K	L	133	142
PSM	GDLESKNEEILHLNLK	4737	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14337	33.061	3	1850.9738	1850.9738	K	L	1667	1683
PSM	GDTGGEDTAAPGR	4738	sp|Q9H773|DCTP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3215	10.849	2	1202.5164	1202.5164	R	F	10	23
PSM	GDYGDAVVYR	4739	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9829	24.119	2	1113.5091	1113.5091	K	G	1126	1136
PSM	GELPDFQDGTK	4740	sp|O00170|AIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12186	28.85	2	1205.5564	1205.5564	R	A	23	34
PSM	GELPDFQDGTK	4741	sp|O00170|AIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12228	28.924	2	1205.5564	1205.5564	R	A	23	34
PSM	GGAGVGSMTK	4742	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4053	12.701	2	863.4171	863.4171	R	I	68	78
PSM	GGGQIIPTAR	4743	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8376	21.382	2	968.54033	968.5403	R	R	717	727
PSM	GGKPEPPAMPQPVPTA	4744	sp|P23396|RS3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:35	ms_run[2]:scan=8586	21.846	2	1588.7919	1588.7919	K	-	228	244
PSM	GHVIAAR	4745	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2190	8.8057	2	722.41876	722.4188	R	I	503	510
PSM	GHVQPIR	4746	sp|P62854|RS26_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2425	9.2172	2	805.45587	805.4559	R	C	16	23
PSM	GKLHIFNAK	4747	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6224	16.942	3	1026.5974	1026.5974	R	K	192	201
PSM	GLFIIDPNGVIK	4748	sp|P30048-2|PRDX3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22456	48.567	2	1284.7442	1284.7442	R	H	167	179
PSM	GLRDLEEEIQMLK	4749	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22701	49	3	1572.8181	1572.8181	R	S	397	410
PSM	GPIQSSGPTIQDYLNRPR	4750	sp|Q5BKY9|F133B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15280	34.969	3	1998.0283	1998.0283	R	P	21	39
PSM	GSAFAIGSDGLCCQSR	4751	sp|Q92499|DDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=14252	32.909	2	1684.7297	1684.7297	R	E	99	115
PSM	GSAITGPVAK	4752	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5557	15.692	2	899.50763	899.5076	K	E	114	124
PSM	GSPQQIDHAK	4753	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2315	9.0249	2	1079.536	1079.5360	R	Q	479	489
PSM	GTGASGSFK	4754	sp|P16403|H12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2981	10.344	2	810.38718	810.3872	K	L	98	107
PSM	GTLEPEYFNSVCR	4755	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	12-UNIMOD:4	ms_run[2]:scan=16242	36.681	2	1570.7086	1570.7086	K	L	1338	1351
PSM	GVAELGVTK	4756	sp|Q9Y421|FA32A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8142	20.977	2	872.49673	872.4967	K	R	16	25
PSM	GVPQQIEVAR	4757	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9425	23.309	2	1095.6037	1095.6037	R	Q	409	419
PSM	GVVLCTFTR	4758	sp|O15235|RT12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:4	ms_run[2]:scan=13262	30.887	2	1051.5485	1051.5485	K	K	60	69
PSM	HAIPIIK	4759	sp|O00571-2|DDX3X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7291	19.185	2	790.50651	790.5065	K	E	193	200
PSM	HESGASIK	4760	sp|P61978-3|HNRPK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1906	8.3594	2	827.41373	827.4137	R	I	391	399
PSM	HGDEIYIAPSGVQK	4761	sp|Q96GX9|MTNB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9589	23.586	3	1512.7573	1512.7573	K	E	52	66
PSM	HISETETLKR	4762	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3674	11.837	3	1212.6463	1212.6463	R	E	2838	2848
PSM	HKETGNHYAMK	4763	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1966	8.4554	3	1314.6139	1314.6139	K	I	63	74
PSM	HMEMSLK	4764	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6357	17.177	2	874.40409	874.4041	K	V	201	208
PSM	HNFCFMEMNTR	4765	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=14183	32.785	3	1485.5952	1485.5952	K	L	329	340
PSM	HNNLDLVIIR	4766	sp|O43837|IDH3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14410	33.19	2	1205.6881	1205.6881	R	E	155	165
PSM	HPELADK	4767	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2503	9.3548	2	808.40792	808.4079	K	N	32	39
PSM	HSQYHVDGSLEKDR	4768	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4961	14.581	4	1669.7808	1669.7808	R	T	105	119
PSM	HVLGLIEDYEALLK	4769	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25007	53.452	3	1611.8872	1611.8872	R	Q	1726	1740
PSM	IANPVEGSTDR	4770	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7019	18.623	2	1157.5677	1157.5677	K	Q	289	300
PSM	IDLLAQPR	4771	sp|Q5SW79|CE170_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12653	29.739	2	924.53927	924.5393	R	R	1147	1155
PSM	IDTGWLDR	4772	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14764	33.851	2	974.48214	974.4821	R	L	608	616
PSM	IDTQQLDR	4773	sp|Q15154|PCM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6770	18.098	2	987.49852	987.4985	R	Q	1588	1596
PSM	IDVAHVTSK	4774	sp|Q8N3C7-3|CLIP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5832	16.208	3	968.5291	968.5291	K	V	377	386
PSM	IEISELNR	4775	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11306	27.111	2	972.52401	972.5240	K	V	396	404
PSM	IFVGGLSPDTPEEK	4776	sp|Q14103-4|HNRPD_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14232	32.872	2	1487.7508	1487.7508	K	I	165	179
PSM	IGDEDVGR	4777	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4897	14.46	2	859.40356	859.4036	R	V	52	60
PSM	IGHPAPNFK	4778	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5685	15.922	3	979.52395	979.5240	K	A	8	17
PSM	IGIEIIKR	4779	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11036	26.642	3	940.60695	940.6070	K	T	463	471
PSM	IHGTEEGQQILK	4780	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7054	18.7	3	1351.7096	1351.7096	R	Q	43	55
PSM	IHTPVSQEER	4781	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4628	13.953	3	1194.5993	1194.5993	K	L	793	803
PSM	IHVQGTDLPDPIATFQQLDQEYK	4782	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24577	52.616	3	2655.318	2655.3180	K	I	149	172
PSM	IIECTHCGCR	4783	sp|P41223|BUD31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3639	11.755	3	1304.5424	1304.5424	R	G	131	141
PSM	IILEAALQAAK	4784	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16896	37.835	2	1139.6914	1139.6914	K	S	776	787
PSM	IILLAEGR	4785	sp|P23526|SAHH_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13225	30.814	2	883.5491	883.5491	R	L	336	344
PSM	IIQLIEGK	4786	sp|O95861-3|BPNT1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12756	29.914	2	912.56442	912.5644	K	A	170	178
PSM	IITEGFEAAK	4787	sp|P40227|TCPZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10843	26.266	2	1077.5706	1077.5706	R	E	118	128
PSM	IKFSDDR	4788	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5323	15.231	2	879.44503	879.4450	R	V	28	35
PSM	ILATAGWDHR	4789	sp|Q9BYB4|GNB1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9864	24.189	3	1138.5883	1138.5883	K	I	267	277
PSM	IPAMTIAK	4790	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10266	24.955	2	843.48881	843.4888	K	N	474	482
PSM	IQEQGVEYQAAMECLQK	4791	sp|Q99996-3|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	14-UNIMOD:4	ms_run[2]:scan=16169	36.554	3	2023.9343	2023.9343	R	A	3060	3077
PSM	IQHVVEAVR	4792	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5324	15.233	2	1049.5982	1049.5982	R	Q	1637	1646
PSM	IQNDAGVR	4793	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3115	10.614	2	871.45118	871.4512	K	I	348	356
PSM	IQTEIIEQEDLIK	4794	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16828	37.715	3	1570.8454	1570.8454	K	A	1430	1443
PSM	IQVLEDQR	4795	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8535	21.761	2	999.53491	999.5349	R	T	1667	1675
PSM	ISEDVEER	4796	sp|P55081|MFAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5347	15.272	2	975.4509	975.4509	R	L	93	101
PSM	ISEVKDEEEDS	4797	sp|Q96C92-4|ENTR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4881	14.428	2	1278.5463	1278.5463	R	-	352	363
PSM	ISLPLPNFSSLNLR	4798	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25171	53.767	2	1569.8879	1569.8879	R	E	411	425
PSM	ITVLEALR	4799	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16762	37.6	2	913.55967	913.5597	R	H	291	299
PSM	IVDVIGEK	4800	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9625	23.653	2	871.50148	871.5015	K	I	273	281
PSM	IVEMSTSK	4801	sp|P63241|IF5A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5052	14.771	2	893.45282	893.4528	K	T	40	48
PSM	IVNEQLQR	4802	sp|Q66GS9|CP135_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5833	16.209	2	998.55089	998.5509	R	S	671	679
PSM	IWGLGFLPQVSTDLTPQTFSEK	4803	sp|Q8IXB1|DJC10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=27522	59.863	3	2463.2686	2463.2686	R	V	662	684
PSM	IYQYVINK	4804	sp|P17812|PYRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10763	26.127	2	1039.5702	1039.5702	K	E	93	101
PSM	KAAQITR	4805	sp|Q96EY4|TMA16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1955	8.4384	2	786.47119	786.4712	R	E	23	30
PSM	KAIIIFVPVPQLK	4806	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20684	45.103	3	1464.9432	1464.9432	R	S	58	71
PSM	KGTDIMYTGTLDCWR	4807	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:4	ms_run[2]:scan=16707	37.501	3	1815.8284	1815.8284	R	K	245	260
PSM	KLGQHAHPFFFTIPQNLPCSVTLQPGPEDTGK	4808	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	19-UNIMOD:4	ms_run[2]:scan=20623	44.992	4	3560.7875	3560.7875	R	A	108	140
PSM	KLQEALTSR	4809	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5234	15.08	3	1044.5928	1044.5928	K	K	1184	1193
PSM	KMFESFIESVPLLK	4810	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23707	50.928	3	1666.9004	1666.9004	R	S	250	264
PSM	KQGTIFLAGPPLVK	4811	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15931	36.129	3	1467.8813	1467.8813	R	A	235	249
PSM	KQMVIDVLHPGK	4812	sp|P62847-2|RS24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10808	26.209	4	1363.7646	1363.7646	R	A	21	33
PSM	KSQGTSAEGSVR	4813	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2060	8.5952	3	1205.6	1205.6000	R	K	106	118
PSM	KVEAPFIPK	4814	sp|P17612|KAPCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10142	24.71	3	1027.6066	1027.6066	R	F	310	319
PSM	KVEELNSEIEK	4815	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6922	18.41	3	1316.6824	1316.6824	K	L	333	344
PSM	KVEPVPVTK	4816	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4218	13.023	2	995.60153	995.6015	K	Q	142	151
PSM	KVGETSLLLSQR	4817	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10422	25.349	3	1329.7616	1329.7616	R	E	1765	1777
PSM	KVGIVGK	4818	sp|P61513|RL37A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3119	10.623	2	699.46431	699.4643	K	Y	7	14
PSM	LAALEEQR	4819	sp|O00541-2|PESC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7015	18.618	2	928.49779	928.4978	R	M	491	499
PSM	LAAPLLK	4820	sp|P54886-2|P5CS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10987	26.544	2	724.48471	724.4847	R	R	416	423
PSM	LALNQISQISMK	4821	sp|Q96E11-7|RRFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17411	38.799	2	1344.7435	1344.7435	K	S	84	96
PSM	LAQDKEEMK	4822	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2556	9.4444	3	1090.5329	1090.5329	R	V	871	880
PSM	LASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEK	4823	sp|P05387|RLA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13079	30.541	3	2773.4246	2773.4246	K	K	62	95
PSM	LCQALAINK	4824	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4	ms_run[2]:scan=9289	23.076	2	1029.5641	1029.5641	K	S	204	213
PSM	LDHYAIIK	4825	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8903	22.373	3	971.54402	971.5440	K	F	71	79
PSM	LDYILGLK	4826	sp|P46781|RS9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=18119	40.077	2	933.55352	933.5535	K	I	94	102
PSM	LEATGGPIPQR	4827	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8271	21.204	2	1137.6142	1137.6142	R	W	77	88
PSM	LFAAETLK	4828	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11797	28.09	2	891.50657	891.5066	K	A	1055	1063
PSM	LGGIPDALPTVAAPRPVCQR	4829	sp|Q9BRP1|PDD2L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	18-UNIMOD:4	ms_run[2]:scan=16497	37.132	3	2087.131	2087.1310	K	C	32	52
PSM	LGIYEAMK	4830	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12631	29.701	2	923.47864	923.4786	K	I	2272	2280
PSM	LGWVRPDLGELSK	4831	sp|P51970|NDUA8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17119	38.233	3	1468.8038	1468.8038	K	V	115	128
PSM	LGYPVLVR	4832	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14496	33.342	2	915.55419	915.5542	R	A	548	556
PSM	LHSQEEDFR	4833	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5130	14.907	2	1159.5258	1159.5258	K	L	82	91
PSM	LIDFLECGK	4834	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	7-UNIMOD:4	ms_run[2]:scan=18336	40.484	2	1093.5478	1093.5478	R	T	228	237
PSM	LIEEETAR	4835	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5589	15.747	2	959.49238	959.4924	K	R	125	133
PSM	LISGEEHFSSK	4836	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6681	17.836	3	1232.6037	1232.6037	R	K	39	50
PSM	LLAVSLLDCTVK	4837	sp|Q9UNX4|WDR3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=15280	34.969	2	1330.753	1330.7530	K	I	563	575
PSM	LLEEEDSK	4838	sp|Q96CT7|CC124_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5176	14.983	2	961.46041	961.4604	R	L	73	81
PSM	LLEGEDAHLSSSQFSSGSQSSR	4839	sp|P02533|K1C14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11403	27.293	3	2308.0567	2308.0567	R	D	418	440
PSM	LLEGEESR	4840	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5332	15.248	2	931.46108	931.4611	K	I	403	411
PSM	LLEVEHPAAK	4841	sp|P17987|TCPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6512	17.451	3	1105.6132	1105.6132	K	V	64	74
PSM	LLPALTVLDIHDNQLTSLPSAIR	4842	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25346	54.156	3	2499.4061	2499.4061	R	E	103	126
PSM	LLQLVEDR	4843	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13221	30.808	2	984.5604	984.5604	K	G	471	479
PSM	LLYAFAEATVPK	4844	sp|P05166|PCCB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19009	41.73	2	1321.7282	1321.7282	K	V	415	427
PSM	LLYNRPGTVSSLK	4845	sp|P35659|DEK_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9856	24.174	3	1446.8195	1446.8195	K	K	112	125
PSM	LMDLDVEQLGIPEQEYSCVVK	4846	sp|P12004|PCNA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	18-UNIMOD:4	ms_run[2]:scan=24042	51.568	3	2464.1866	2464.1866	K	M	118	139
PSM	LMGFASFDSTK	4847	sp|Q8WVK2|SNR27_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17676	39.275	2	1202.5642	1202.5642	K	G	106	117
PSM	LMKTIGPDMFLGTCR	4848	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	14-UNIMOD:4	ms_run[2]:scan=18733	41.222	3	1738.8569	1738.8569	R	R	1351	1366
PSM	LMQLVDHR	4849	sp|Q92841-1|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8739	22.096	2	1010.5331	1010.5331	K	G	469	477
PSM	LNKENDTLK	4850	sp|Q9BQQ3-2|GORS1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2685	9.6905	3	1073.5717	1073.5717	R	A	48	57
PSM	LNVDFALIHK	4851	sp|P60891|PRPS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16393	36.941	3	1168.6604	1168.6604	R	E	185	195
PSM	LNVGDYFVLTSHTVMPLSAPTLVPQEHYVR	4852	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=27727	60.382	4	3382.7384	3382.7384	K	I	1142	1172
PSM	LPGAEEAPVR	4853	sp|Q2M1P5|KIF7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8106	20.915	2	1037.5506	1037.5506	R	V	8	18
PSM	LPILIKPSR	4854	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11422	27.329	3	1035.6805	1035.6805	R	S	938	947
PSM	LQAALINR	4855	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9197	22.909	2	897.5396	897.5396	K	K	1000	1008
PSM	LQAIQEER	4856	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6119	16.759	2	985.51926	985.5193	R	A	975	983
PSM	LQEEMLQR	4857	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8993	22.559	2	1045.5226	1045.5226	K	E	189	197
PSM	LRELELQR	4858	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8576	21.828	3	1055.6087	1055.6087	K	Q	2917	2925
PSM	LRNEVNER	4859	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2490	9.3319	2	1028.5363	1028.5363	K	E	446	454
PSM	LRQPFFQK	4860	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9530	23.485	3	1062.5974	1062.5974	K	R	63	71
PSM	LSDGGLLLSYDGSSYTTYMKEEVDR	4861	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21837	47.185	3	2798.2957	2798.2957	R	Y	709	734
PSM	LSDGVAVLK	4862	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10153	24.729	2	900.52803	900.5280	K	V	397	406
PSM	LSKEDIER	4863	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4891	14.449	3	988.51892	988.5189	R	M	510	518
PSM	LSKEEIER	4864	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4330	13.293	3	1002.5346	1002.5346	R	M	510	518
PSM	LSLQQVIK	4865	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14848	34.012	2	927.57532	927.5753	K	D	339	347
PSM	LSLVDLAGSER	4866	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17216	38.409	2	1158.6245	1158.6245	K	A	249	260
PSM	LSSDDGDSSTMR	4867	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4456	13.548	2	1269.5143	1269.5143	R	N	254	266
PSM	LTDTLVSK	4868	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7685	19.987	2	875.4964	875.4964	K	Q	536	544
PSM	LTEGMSGR	4869	sp|Q9NVI7-2|ATD3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4338	13.317	2	849.40145	849.4015	R	E	521	529
PSM	LTFLVAQK	4870	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14091	32.63	2	918.55385	918.5539	R	D	1327	1335
PSM	LTTPTYGDLNHLVSATMSGVTTCLR	4871	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	17-UNIMOD:35,23-UNIMOD:4	ms_run[2]:scan=21832	47.178	3	2723.3259	2723.3259	K	F	217	242
PSM	LVLELESLR	4872	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19289	42.348	2	1070.6336	1070.6336	R	R	1361	1370
PSM	LVLVGDGGTGK	4873	sp|P62826|RAN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9848	24.16	2	1014.571	1014.5710	K	T	13	24
PSM	LVVWAADR	4874	sp|Q96RQ3|MCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13031	30.459	2	928.51305	928.5131	K	Q	437	445
PSM	LYDIDVAK	4875	sp|P62750|RL23A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12047	28.544	2	935.4964	935.4964	K	V	116	124
PSM	LYLADPMK	4876	sp|P49458|SRP09_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13912	32.271	2	949.49429	949.4943	K	A	17	25
PSM	LYPAAVDTIVAIMAEGK	4877	sp|Q9ULC4-2|MCTS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=27773	60.463	3	1760.9383	1760.9383	K	Q	111	128
PSM	MAVTFIGNSTAIQELFK	4878	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26220	56.162	3	1868.9706	1868.9706	K	R	363	380
PSM	MDLGECLK	4879	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=8602	21.871	2	980.4307	980.4307	R	V	54	62
PSM	MDSTEPPYSQK	4880	sp|P68104|EF1A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6505	17.437	2	1281.5547	1281.5547	K	R	155	166
PSM	MEAAEQAR	4881	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2804	9.9439	2	904.40727	904.4073	R	N	633	641
PSM	MELEVAER	4882	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10296	25.034	2	975.46953	975.4695	K	K	329	337
PSM	MFDMGFEPQVMR	4883	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21443	46.48	2	1486.6407	1486.6407	R	I	534	546
PSM	MKPLMGVIYVPLTDK	4884	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20560	44.882	3	1703.9354	1703.9354	K	E	205	220
PSM	MQLDNPSK	4885	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6100	16.728	2	931.44332	931.4433	K	V	818	826
PSM	MQNDAGEFVDLYVPR	4886	sp|P63220|RS21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	1-UNIMOD:1	ms_run[2]:scan=25847	55.316	2	1794.8247	1794.8247	-	K	1	16
PSM	MRLEGQLEALSLEASQALK	4887	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24173	51.809	3	2086.1092	2086.1092	K	E	415	434
PSM	MTSQDEEAHVMK	4888	sp|Q66GS9|CP135_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5568	15.709	3	1404.6014	1404.6014	K	K	715	727
PSM	MVGFIIGR	4889	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16791	37.649	2	891.50004	891.5000	K	G	88	96
PSM	MVQEAEKYK	4890	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4481	13.596	3	1124.5536	1124.5536	R	A	518	527
PSM	NAAALSQALR	4891	sp|Q8IZQ5|SELH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10084	24.615	2	1013.5618	1013.5618	R	L	50	60
PSM	NEEVESERER	4892	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2579	9.4781	3	1275.5691	1275.5691	K	A	1392	1402
PSM	NGVELTSLR	4893	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11547	27.554	2	987.53491	987.5349	K	Q	34	43
PSM	NKEDFEK	4894	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2488	9.3288	2	908.42396	908.4240	K	T	404	411
PSM	NKIEELQQR	4895	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5518	15.617	2	1156.62	1156.6200	R	K	258	267
PSM	NLDLDSIIAEVK	4896	sp|P35908|K22E_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24719	52.897	2	1328.7187	1328.7187	R	A	342	354
PSM	NMMAACDPR	4897	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=4644	13.984	2	1080.4151	1080.4151	K	H	298	307
PSM	NNQITNNQR	4898	sp|P00558-2|PGK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2522	9.3861	2	1100.5323	1100.5323	K	I	3	12
PSM	NQEDIILFR	4899	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=17497	38.972	2	1146.6033	1146.6033	K	D	103	112
PSM	NQTAEKEEFEHQQK	4900	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3743	11.982	3	1744.8016	1744.8016	K	E	584	598
PSM	NSCVQQSDNLK	4901	sp|Q92576-2|PHF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=4442	13.519	2	1291.5827	1291.5827	K	V	1619	1630
PSM	NSELQALR	4902	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8757	22.128	2	929.49304	929.4930	R	Q	837	845
PSM	NSFLGSPR	4903	sp|Q8IWQ3-3|BRSK2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9104	22.748	2	876.44537	876.4454	K	F	484	492
PSM	NWDSLIPDEMPDSPIQEK	4904	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=22984	49.538	2	2112.9674	2112.9674	K	S	2165	2183
PSM	PGASLPPLDLQALEK	4905	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21174	45.999	2	1547.8559	1547.8559	R	E	978	993
PSM	PLEMIEPR	4906	sp|P62249|RS16_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12204	28.881	2	983.511	983.5110	R	T	38	46
PSM	PLPEPSEQEGESVK	4907	sp|Q96CP2|FWCH2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9045	22.649	2	1524.7308	1524.7308	M	A	2	16
PSM	PRPPLNR	4908	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13119	30.613	2	848.49807	848.4981	K	N	1095	1102
PSM	PVQDLIK	4909	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10014	24.465	2	811.48035	811.4804	K	M	668	675
PSM	PVWGGGNK	4910	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6452	17.348	2	813.41334	813.4133	M	C	2	10
PSM	QAENGMYIR	4911	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8192	21.064	2	1080.5022	1080.5022	R	M	2206	2215
PSM	QEALLAAISEK	4912	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16307	36.794	2	1171.6449	1171.6449	K	D	928	939
PSM	QEEELQAKDEELLK	4913	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10933	26.423	3	1700.8469	1700.8469	R	V	850	864
PSM	QFMDEQAAER	4914	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:35	ms_run[2]:scan=5622	15.803	2	1239.519	1239.5190	R	E	1479	1489
PSM	QGALLAAR	4915	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6904	18.371	2	798.47119	798.4712	K	V	938	946
PSM	QLDETVVSCKK	4916	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:4	ms_run[2]:scan=6028	16.603	3	1305.6599	1305.6599	K	A	639	650
PSM	QLNENKQER	4917	sp|P26368-2|U2AF2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1971	8.4647	3	1157.5789	1157.5789	R	D	10	19
PSM	QLQSELLLVK	4918	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16385	36.929	2	1169.702	1169.7020	R	N	2029	2039
PSM	QLTQEMMTEK	4919	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9401	23.267	2	1237.5683	1237.5683	K	E	357	367
PSM	QLYSSLVK	4920	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11441	27.361	2	936.52803	936.5280	R	F	1045	1053
PSM	QMSGAQIK	4921	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:35	ms_run[2]:scan=2304	9.0071	2	877.43275	877.4328	R	I	307	315
PSM	QMVIDVLHPGK	4922	sp|P62847-2|RS24_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13914	32.278	3	1235.6696	1235.6696	K	A	22	33
PSM	QNSLESELMELHETMASLQSR	4923	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25768	55.137	3	2432.1312	2432.1312	K	L	1308	1329
PSM	QNYDEMSPAGQISK	4924	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10491	25.498	2	1566.6984	1566.6984	K	E	966	980
PSM	QQLEEQEYK	4925	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6078	16.692	2	1193.5564	1193.5564	K	L	1204	1213
PSM	QQQDQVDR	4926	sp|Q15233-2|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2261	8.9298	2	1015.4683	1015.4683	K	N	191	199
PSM	QRLELEQEIEK	4927	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10875	26.32	3	1413.7464	1413.7464	K	A	451	462
PSM	QSEDTNTESK	4928	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1897	8.3447	2	1137.4786	1137.4786	K	E	399	409
PSM	QVLVAPGNAGTACSEK	4929	sp|P22102-2|PUR2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:4	ms_run[2]:scan=8693	22.023	2	1600.7879	1600.7879	K	I	29	45
PSM	QVQELQAVSK	4930	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7539	19.72	2	1128.6139	1128.6139	K	E	3101	3111
PSM	RAGELTEDEVER	4931	sp|P62269|RS18_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6292	17.058	2	1402.6688	1402.6688	K	V	55	67
PSM	RGVYCCR	4932	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	5-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=2802	9.9372	2	969.42729	969.4273	K	E	226	233
PSM	RLEEELAVEGR	4933	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9499	23.43	3	1299.6783	1299.6783	R	R	1870	1881
PSM	RLGSDLTSAQK	4934	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5252	15.112	2	1174.6306	1174.6306	R	E	980	991
PSM	RPASVSSSAAVEHEQR	4935	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3813	12.129	4	1709.8445	1709.8445	K	E	237	253
PSM	RPDQQLQGEGK	4936	sp|Q8NC51-3|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3131	10.654	3	1254.6317	1254.6317	R	I	112	123
PSM	RYDDPEVQK	4937	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4157	12.899	3	1148.5462	1148.5462	R	D	127	136
PSM	SAAQPSTSPAEVQSLK	4938	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9137	22.805	2	1599.8104	1599.8104	R	K	2870	2886
PSM	SAQMLEEAR	4939	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7412	19.484	2	1033.4862	1033.4862	K	R	807	816
PSM	SCNCLLLK	4940	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=10536	25.594	2	1006.494	1006.4940	K	V	336	344
PSM	SDLETELR	4941	sp|A7MCY6|TBKB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10128	24.691	2	961.47164	961.4716	K	E	142	150
PSM	SEGLITEK	4942	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6456	17.353	2	875.46001	875.4600	R	C	520	528
PSM	SEPIPESNDGPVK	4943	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8341	21.323	2	1367.6569	1367.6569	K	V	367	380
PSM	SGHIHHHDVR	4944	sp|Q12834|CDC20_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1717	8.0076	3	1193.5802	1193.5802	R	V	287	297
PSM	SGLGSVLR	4945	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10678	25.876	2	787.4552	787.4552	R	D	771	779
PSM	SGQVEHLQQETAALKK	4946	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8371	21.373	4	1765.9323	1765.9323	K	Q	821	837
PSM	SGVIQDALKK	4947	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8240	21.149	3	1057.6132	1057.6132	K	S	312	322
PSM	SGVSLAALKK	4948	sp|P16403|H12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8860	22.297	3	972.59678	972.5968	R	A	55	65
PSM	SHFAIGLALYYPSAR	4949	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=27573	60.013	3	1664.8675	1664.8675	K	I	1212	1227
PSM	SHIMAAK	4950	sp|P48643|TCPE_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2177	8.7869	2	756.39524	756.3952	K	A	36	43
PSM	SHKPPISFPLCANGQVFGLYK	4951	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	11-UNIMOD:4	ms_run[2]:scan=19593	42.974	2	2359.2147	2359.2147	K	N	997	1018
PSM	SHKPPISFPLCANGQVFGLYK	4952	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	11-UNIMOD:4	ms_run[2]:scan=27546	59.917	4	2359.2147	2359.2147	K	N	997	1018
PSM	SLDDDLDGVPLDATEDSKK	4953	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15039	34.46	3	2031.9484	2031.9484	K	N	731	750
PSM	SLQADTTNTDTALTTLEEALAEK	4954	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26083	55.844	3	2435.1915	2435.1915	K	E	603	626
PSM	SLTPSASTPYR	4955	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8669	21.982	2	1178.5932	1178.5932	K	Q	252	263
PSM	SLVQANPEVAMDSIIHMTQHISPTQR	4956	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24186	51.837	4	2902.4429	2902.4429	R	A	2306	2332
PSM	SMGGAAIAPPTSLVEK	4957	sp|Q96I25|SPF45_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14734	33.788	2	1527.7967	1527.7967	R	D	169	185
PSM	SMLALLLGR	4958	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24868	53.186	2	972.57902	972.5790	K	T	164	173
PSM	SPLPFQNR	4959	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11087	26.729	2	957.50321	957.5032	R	Y	3834	3842
PSM	SQDSMSSDTAR	4960	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3098	10.571	2	1183.4775	1183.4775	R	T	599	610
PSM	SQHKEELGAVR	4961	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2867	10.106	3	1252.6524	1252.6524	K	L	445	456
PSM	SQSAEIWEK	4962	sp|Q7L4I2-2|RSRC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9880	24.228	2	1076.5138	1076.5138	K	L	300	309
PSM	SQVFSTAADGQTQVEIK	4963	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14139	32.709	2	1807.8952	1807.8952	K	V	469	486
PSM	SRLGDLYEEEMR	4964	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=13941	32.351	3	1496.6929	1496.6929	K	E	144	156
PSM	SSEIEELK	4965	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8163	21.012	2	933.46549	933.4655	R	A	1711	1719
PSM	SSMSGLHLVK	4966	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9365	23.207	3	1057.559	1057.5590	R	Q	77	87
PSM	STLEQVER	4967	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6338	17.143	2	960.48762	960.4876	R	E	2298	2306
PSM	STSHTSDFNPNSGSDQR	4968	sp|Q99700-2|ATX2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4815	14.31	3	1835.767	1835.7670	R	V	528	545
PSM	STTTGHLIYK	4969	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5845	16.23	3	1119.5924	1119.5924	K	C	21	31
PSM	STVEALHTQK	4970	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3865	12.231	2	1112.5826	1112.5826	K	R	2845	2855
PSM	SVFEPEDSSIVDNELWSEMR	4971	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=24892	53.23	3	2368.0529	2368.0529	K	R	808	828
PSM	SVHELEK	4972	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2487	9.3274	2	840.43413	840.4341	K	S	1519	1526
PSM	SVLEHLPMAVQER	4973	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14368	33.116	2	1507.7817	1507.7817	R	E	1487	1500
PSM	SVPDEIILLR	4974	sp|Q9H9A6|LRC40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19568	42.928	2	1153.6707	1153.6707	K	S	303	313
PSM	SWCQELEK	4975	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=11318	27.134	2	1078.4753	1078.4753	R	R	68	76
PSM	SYVTTSTR	4976	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4684	14.067	2	913.45051	913.4505	R	T	29	37
PSM	TDIIDRLEQELLCASNR	4977	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	13-UNIMOD:4	ms_run[2]:scan=27181	58.766	3	2045.0212	2045.0212	K	L	1942	1959
PSM	TDKVFEVMLATDR	4978	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16854	37.759	3	1523.7654	1523.7654	K	S	25	38
PSM	TDSFYHSSGGLELYGEPR	4979	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15423	35.226	3	2013.9068	2013.9068	K	H	3802	3820
PSM	TEDSNAGNSGGNVPAPDSTK	4980	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5200	15.022	3	1916.8348	1916.8348	R	G	251	271
PSM	TFGENYVQELLEK	4981	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=23632	50.789	2	1568.7722	1568.7722	R	A	64	77
PSM	TIQFVDWCPTGFK	4982	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	8-UNIMOD:4	ms_run[2]:scan=22506	48.659	3	1597.7599	1597.7599	R	V	305	318
PSM	TISSLKQEVK	4983	sp|Q4V328|GRAP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5993	16.525	3	1131.6499	1131.6499	K	D	585	595
PSM	TKELQALR	4984	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5233	15.079	3	957.56073	957.5607	K	E	81	89
PSM	TLSQAIVK	4985	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7862	20.476	2	858.51747	858.5175	K	V	411	419
PSM	TQNVLGEK	4986	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5156	14.95	2	887.47125	887.4712	R	G	55	63
PSM	TSNCVVLK	4987	sp|Q9H3J6|CL065_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=5875	16.278	2	919.4797	919.4797	K	H	78	86
PSM	TSPMEEQSLK	4988	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7222	19.045	2	1148.5383	1148.5383	K	L	2131	2141
PSM	TVDGPSGK	4989	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2140	8.7283	2	759.37628	759.3763	K	L	187	195
PSM	VECFDKFK	4990	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=8839	22.266	2	1071.5059	1071.5059	R	V	1263	1271
PSM	VEDLEQLK	4991	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10044	24.533	2	972.51278	972.5128	R	Q	498	506
PSM	VEEIAASK	4992	sp|Q02543|RL18A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4116	12.828	2	845.44945	845.4494	K	C	129	137
PSM	VFLENVIR	4993	sp|P62805|H4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16716	37.521	2	988.57057	988.5706	K	D	61	69
PSM	VGDVYIPR	4994	sp|Q01130-2|SRSF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=10944	26.444	2	917.49707	917.4971	R	D	40	48
PSM	VGHVTER	4995	sp|Q14498-2|RBM39_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1963	8.4519	2	796.41915	796.4192	K	T	323	330
PSM	VISGVLQLGNIVFK	4996	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=25149	53.725	2	1485.8919	1485.8919	R	K	342	356
PSM	VKEGMNIVEAMER	4997	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14244	32.895	3	1504.7378	1504.7378	K	F	132	145
PSM	VKQIESK	4998	sp|P10599|THIO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=1935	8.4012	2	830.48617	830.4862	M	T	2	9
PSM	VLPSIVNEVLK	4999	sp|Q99623|PHB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21274	46.176	2	1209.7333	1209.7333	R	S	132	143
PSM	VMTIPYQPMPASSPVICAGGQDR	5000	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	9-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=17158	38.301	3	2490.1705	2490.1705	R	C	178	201
PSM	VPCHVCGK	5001	sp|P56270-2|MAZ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=2392	9.1551	3	955.43679	955.4368	K	M	392	400
PSM	VQEQELTR	5002	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5077	14.817	2	1001.5142	1001.5142	K	L	1530	1538
PSM	VQIGEYTFEK	5003	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14931	34.162	3	1212.6027	1212.6027	K	G	1116	1126
PSM	VQIGEYTFEKGDYGDAVVYR	5004	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26037	55.75	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	5005	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=26300	56.386	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	5006	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=30028	64.632	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQLVVGDGR	5007	sp|P22061|PIMT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9388	23.245	2	941.52943	941.5294	R	M	136	145
PSM	VREYELR	5008	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=5709	15.979	3	963.51378	963.5138	K	K	89	96
PSM	VSLEDLYNGK	5009	sp|O60884|DNJA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16229	36.656	2	1136.5714	1136.5714	K	T	122	132
PSM	VSSTTSELTK	5010	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4724	14.147	2	1051.5397	1051.5397	K	K	1330	1340
PSM	VSVPSNLSYGEWLHGFEK	5011	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=21524	46.625	3	2048.0003	2048.0003	K	K	1083	1101
PSM	VTADVINAAEK	5012	sp|O43175|SERA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9212	22.936	2	1129.5979	1129.5979	K	L	59	70
PSM	VTLAVSDLQK	5013	sp|Q9HC38-2|GLOD4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=12315	29.073	2	1072.6128	1072.6128	K	S	141	151
PSM	VTNLLMLK	5014	sp|P26599|PTBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15965	36.189	2	930.55722	930.5572	K	G	85	93
PSM	VVAEELENVR	5015	sp|Q8NEZ5|FBX22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=11269	27.046	2	1156.6088	1156.6088	R	I	87	97
PSM	VVDVIGTK	5016	sp|P31323|KAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=8066	20.84	2	829.49092	829.4909	K	V	288	296
PSM	VVELENEK	5017	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6121	16.762	2	958.49713	958.4971	R	G	482	490
PSM	VVGAVIDQGLITR	5018	sp|E9PRG8|CK098_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15423	35.226	2	1339.7823	1339.7823	R	H	36	49
PSM	WIGLDLSNGKPR	5019	sp|P17987|TCPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=14943	34.184	3	1354.7357	1354.7357	K	D	485	497
PSM	WVSELSYVEEK	5020	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=16349	36.867	2	1367.6609	1367.6609	R	E	986	997
PSM	YALTGDEVKK	5021	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=6437	17.321	3	1122.5921	1122.5921	K	I	54	64
PSM	YEEIDNAPEER	5022	sp|P49411|EFTU_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7988	20.704	2	1363.5892	1363.5892	K	A	92	103
PSM	YEKDIAAYR	5023	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=7145	18.895	3	1127.5611	1127.5611	K	A	155	164
PSM	YFIRDEFLR	5024	sp|P63092|GNAS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=15597	35.542	3	1257.6506	1257.6506	K	I	339	348
PSM	YGCLAGVR	5025	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	3-UNIMOD:4	ms_run[2]:scan=8469	21.62	2	894.43817	894.4382	R	V	142	150
PSM	YKAEDEVQR	5026	sp|P0DMV9|HS71B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=3925	12.358	3	1136.5462	1136.5462	K	E	525	534
PSM	YLTVAAVFR	5027	sp|P04350|TBB4A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=19198	42.126	2	1038.5862	1038.5862	R	G	310	319
PSM	YQTDLYER	5028	sp|Q8WUA2|PPIL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9090	22.726	2	1086.4982	1086.4982	K	E	461	469
PSM	YSFLQFDPAPR	5029	sp|P62714|PP2AB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=20809	45.33	2	1339.6561	1339.6561	K	R	284	295
PSM	YTSDKDVPSER	5030	sp|Q9HCG8|CWC22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4229	13.044	3	1295.5994	1295.5994	K	N	784	795
PSM	YTTPEDATPEPGEDPR	5031	sp|P63092|GNAS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=9097	22.739	2	1773.7693	1773.7693	R	V	318	334
PSM	YVDEASKK	5032	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2052	8.5825	2	938.47091	938.4709	K	E	99	107
PSM	YVDEASKK	5033	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=2059	8.594	3	938.47091	938.4709	K	E	99	107
PSM	YVLCTAPR	5034	sp|P25205|MCM3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0	4-UNIMOD:4	ms_run[2]:scan=9074	22.698	2	978.49569	978.4957	R	A	357	365
PSM	YYKVDENGK	5035	sp|P62979|RS27A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	17.0		ms_run[2]:scan=4407	13.456	3	1114.5295	1114.5295	K	I	105	114
PSM	GMFTVSDHPPEQHGMFTVSDHPPEQR	5036	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13765	31.899955	4	2963.315021	2962.312661	R	G	144	170
PSM	TQHESELEQLR	5037	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7944	20.627832	3	1368.662697	1368.663357	K	I	510	521
PSM	TYQEDLTLLQQR	5038	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16969	37.965673	3	1506.768299	1506.767822	K	L	533	545
PSM	LSLEDGGKGK	5039	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4895	14.454138	3	1003.536683	1002.534575	R	E	2043	2053
PSM	CEALLAQER	5040	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=8807	22.210732	2	1089.530696	1088.528444	R	S	2729	2738
PSM	LPPAASEEAHTSNVK	5041	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5569	15.710798	3	1549.775775	1549.773636	R	M	3117	3132
PSM	LEATGGPIPQR	5042	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8415	21.460756	2	1137.614414	1137.614222	R	W	77	88
PSM	RLEEELAVEGR	5043	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9507	23.44395	3	1299.678595	1299.678279	R	R	1870	1881
PSM	TTAAVEETIGR	5044	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8662	21.972281	2	1146.586300	1146.588067	K	H	1741	1752
PSM	FQPISEHQTR	5045	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5897	16.314336	3	1241.615344	1241.615285	R	E	2100	2110
PSM	MDEPSPLAQPLELNQHSR	5046	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=16543	37.209672	2	2120.001521	2119.000418	-	F	1	19
PSM	MSFSSNLNHYGMTHVASVSDVLLDNSFTPPCQR	5047	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	31-UNIMOD:4	ms_run[1]:scan=22552	48.741795	4	3712.695568	3710.691587	R	M	1200	1233
PSM	GGSWVVIDSSINPR	5048	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17886	39.640875	2	1485.757707	1485.757592	R	H	2090	2104
PSM	SGLHLVK	5049	sp|Q13085-3|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=10224	24.859473	2	794.4653	794.4645	M	Q	2	9
PSM	LSLPMQETQLCSTDSPLPLEKEEQVR	5050	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4	ms_run[1]:scan=19724	43.221746	3	3029.489936	3027.489288	R	L	126	152
PSM	CPDLSDFQQK	5051	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=11551	27.559781	2	1236.545909	1236.544488	R	I	1692	1702
PSM	KLGELQEK	5052	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=4315	13.262568	2	943.535045	943.533846	K	L	583	591
PSM	CSGQELSR	5053	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=2978	10.34013	2	935.412616	935.413080	R	V	1528	1536
PSM	CCYDHVISTSHK	5054	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=8313	21.275011	3	1488.6116	1488.6121	K	L	952	964
PSM	SHKPPISFPLCANGQVFGLYK	5055	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4	ms_run[1]:scan=28431	61.583302	4	2359.211929	2359.214708	K	N	997	1018
PSM	LFAAETLK	5056	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=12359	29.154393	2	891.5062	891.5060	K	A	1055	1063
PSM	ELHLSWEVGK	5057	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=15010	34.386829	3	1178.6080	1178.6079	R	P	1085	1095
PSM	VQIGEYTFEKGDYGDAVVYR	5058	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=26787	57.655876	3	2309.102732	2308.101178	K	G	1116	1136
PSM	IVYTACSHAAVDALCEK	5059	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=28096	61.026404	3	1908.894594	1906.891719	R	A	1227	1244
PSM	HYVYIGDPAQLPAPR	5060	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16225	36.65048	3	1695.876582	1695.873290	K	T	1318	1333
PSM	CPAEIVDTVSALVYDNK	5061	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=29301	63.171724	3	1892.918800	1892.918980	R	L	1367	1384
PSM	GVITHDVSSAINRPQIGVVR	5062	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14614	33.54935	4	2117.172351	2117.170535	K	E	1401	1421
PSM	AVFISPYNSQNAVASK	5063	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14812	33.94602	2	1696.868504	1694.862785	K	I	1432	1448
PSM	VGILCIMSDR	5064	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,7-UNIMOD:35	ms_run[1]:scan=13833	32.054204	2	1178.577717	1178.578765	K	D	1493	1503
PSM	VGILCIMSDR	5065	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=19847	43.505723	2	1163.588895	1162.583850	K	D	1493	1503
PSM	IQIGEYTFEKGDYGDAVVYR	5066	cov|corona09406|ORF1b_USA/WA-S1067/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10075	24.596946	3	2324.132883	2322.116828	K	G	1116	1136
PSM	CPVEIVDTVSALVYDNK	5067	cov|corona00756|ORF1b_India/1104/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4	ms_run[1]:scan=25237	53.903983	3	1920.963736	1920.950280	R	L	1367	1384
PSM	ENDKQETWMLMELQK	5068	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18859	41.465538	3	1922.890605	1921.891385	R	I	660	675
PSM	LLEAQACTGGIIHPTTGQK	5069	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=11417	27.319212	3	1994.026098	1994.025511	R	L	2650	2669
PSM	QQYESVAAK	5070	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=8369	21.369892	2	1005.4761	1005.4762	R	N	274	283
PSM	QVQSLTCEVDALKGTNESLER	5071	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=21113	45.892134	2	2359.1330	2359.1320	R	Q	322	343
PSM	NAVITVPAYFNDSQR	5072	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18239	40.299538	2	1693.842262	1693.842384	K	Q	188	203
PSM	EQQIVIQSSGGLSKDDIENMVK	5073	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17337	38.617589	3	2419.220473	2417.210805	R	N	542	564
PSM	LKEEISK	5074	sp|P38646|GRP75_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2935	10.265618	2	845.485845	845.485834	K	M	611	618
PSM	FVLALLSDLQDLK	5075	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=27790	60.491793	2	1473.843475	1473.844282	R	W	4180	4193
PSM	ERETEELYQVIEGQNDTMAK	5076	sp|Q5VU43|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	18-UNIMOD:35	ms_run[1]:scan=16525	37.176328	3	2398.092487	2398.095835	R	L	294	314
PSM	ERETEELYQVIEGQNDTMAK	5077	sp|Q5VU43|MYOME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17959	39.774037	3	2382.099962	2382.100920	R	L	294	314
PSM	LNEALQAER	5078	sp|Q5VU43|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6689	17.871362	2	1043.548191	1042.540723	R	Q	873	882
PSM	GPAVGIDLGTTYSCVGVFQHGK	5079	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:4	ms_run[1]:scan=18880	41.499733	3	2262.110001	2262.110303	K	V	4	26
PSM	HWPFMVVNDAGRPK	5080	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14633	33.582945	4	1652.824426	1652.824566	K	V	89	103
PSM	NSLESYAFNMK	5081	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	10-UNIMOD:35	ms_run[1]:scan=13294	30.94661	2	1318.586364	1318.586353	K	A	540	551
PSM	ASLCISTK	5082	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=7589	19.815109	2	878.452745	878.453153	K	K	426	434
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	5083	sp|P07437|TBB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=19637	43.054343	3	3103.397939	3101.400273	K	I	20	47
PSM	MAVTFIGNSTAIQELFK	5084	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35	ms_run[1]:scan=25204	53.84043	3	1885.974462	1884.965536	K	R	363	380
PSM	VREEIAEYQLR	5085	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10436	25.378403	3	1404.730725	1404.736128	K	L	2692	2703
PSM	ALTVPELTQQMFDSK	5086	sp|Q13885|TBB2A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=22892	49.367155	3	1707.855978	1706.854923	R	N	283	298
PSM	YMSQMSVPEQAELEK	5087	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14216	32.84303	2	1769.808201	1768.801173	R	L	88	103
PSM	CLVMDVQAFER	5088	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=26686	57.38479	2	1349.6091	1349.6103	K	L	359	370
PSM	NISHYEEQLVK	5089	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10238	24.89034	2	1358.683913	1358.683030	R	M	381	392
PSM	LQDLNDLR	5090	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10861	26.296776	2	985.520313	985.519259	K	K	330	338
PSM	KQELIEDLQPDINQNVQK	5091	sp|Q9UJC3|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14394	33.160096	3	2151.126331	2151.117162	K	I	567	585
PSM	RIEILESECK	5092	sp|Q9UJC3|HOOK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4	ms_run[1]:scan=9555	23.526583	2	1275.649233	1275.649287	R	V	644	654
PSM	QLFHPEQLITGK	5093	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=21102	45.875538	2	1392.7398	1392.7396	R	E	85	97
PSM	AYHEQLSVAEITNACFEPANQMVK	5094	sp|Q71U36|TBA1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	15-UNIMOD:4	ms_run[1]:scan=19596	42.978925	3	2750.284462	2749.283987	K	C	281	305
PSM	TAALVEEVYFAQK	5095	sp|Q8TD10|MIPO1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18561	40.91295	3	1468.768063	1467.760946	K	E	163	176
PSM	IDLLAQPR	5096	sp|Q5SW79|CE170_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12631	29.701239	2	924.539759	924.539266	R	R	1147	1155
PSM	VTVAGLAGKDPVQCSR	5097	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:4	ms_run[1]:scan=10466	25.444842	3	1656.863009	1656.861740	K	D	33	49
PSM	VTVAGLAGKD	5098	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=9506	23.442771	2	929.5185	929.5177	K	P	33	43
PSM	DVVICPDASLEDAK	5099	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4	ms_run[1]:scan=14602	33.526493	2	1530.722187	1530.723574	R	K	49	63
PSM	EILKEQENR	5100	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:27	ms_run[1]:scan=4045	12.677838	3	1139.5941	1139.5930	K	K	90	99
PSM	VTAVDWHFEEAVDGECPPQR	5101	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	16-UNIMOD:4	ms_run[1]:scan=17070	38.139717	3	2342.043520	2341.043346	K	S	1359	1379
PSM	KEEILLIK	5102	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10873	26.31699	2	984.622718	984.621933	R	A	1618	1626
PSM	AKFEELNMDLFR	5103	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=19753	43.292373	3	1513.750302	1511.744250	R	S	325	337
PSM	KSDIDEIVLVGGSTR	5104	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14558	33.450988	3	1587.848125	1587.846801	K	I	353	368
PSM	VAVCDIPPR	5105	sp|Q13509|TBB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=7348	19.324075	2	1026.5462	1025.5322	K	G	351	360
PSM	STSSHGTDEMESSSYR	5106	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5252	15.111684	3	1759.695487	1759.695522	R	D	181	197
PSM	MEMPLPPDDQELR	5107	sp|Q8IWX8|CHERP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=21706	46.950484	2	1611.729253	1611.727280	-	N	1	14
PSM	ISQLEMAR	5108	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8865	22.306458	2	946.490368	946.490601	R	Q	428	436
PSM	ALDVGSGSGILTACFAR	5109	sp|P22061|PIMT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	14-UNIMOD:4	ms_run[1]:scan=20141	44.015032	2	1693.846838	1693.845755	K	M	82	99
PSM	VIKDFMIQGGDFTR	5110	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=16216	36.631472	3	1641.817818	1641.818478	R	G	96	110
PSM	WDHESVCK	5111	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	7-UNIMOD:4	ms_run[1]:scan=4694	14.084441	2	1059.444474	1059.444380	R	Y	29	37
PSM	VDDHLMGK	5112	sp|O95232|LC7L3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5496	15.575501	2	913.433481	913.432752	R	Q	208	216
PSM	KTATAVAHCK	5113	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4	ms_run[1]:scan=1783	8.171595	3	1085.565976	1085.565164	K	R	17	27
PSM	EIKDILIQYDR	5114	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16082	36.400484	2	1404.759994	1404.761280	K	T	107	118
PSM	SDFDEFER	5115	sp|P26368|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=17371	38.688034	2	1085.4298	1085.4296	M	Q	2	10
PSM	IILLAEGR	5116	sp|P23526|SAHH_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13170	30.712547	2	883.549454	883.549102	R	L	336	344
PSM	LCSAHGVLVPGGFGVR	5117	sp|P17812|PYRG1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=14618	33.555304	3	1625.856733	1624.850781	K	G	361	377
PSM	CGGAGHIASDCK	5118	sp|Q15637-2|SF01_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:385,1-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=5602	15.767029	2	1214.4797	1214.4803	K	F	282	294
PSM	NLDFGIDMDSR	5119	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=18481	40.763645	2	1282.5822	1281.5652	K	I	643	654
PSM	YEKDIAAYR	5120	sp|P09429|HMGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7229	19.057016	3	1127.561474	1127.561124	K	A	155	164
PSM	RPDQQLQGEGK	5121	sp|Q8NC51|PAIRB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=3144	10.684609	3	1254.631549	1254.631663	R	I	112	123
PSM	GAFGKPQGTVAR	5122	sp|Q96L21|RL10L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5116	14.884233	2	1187.640590	1187.641105	R	V	117	129
PSM	TLTAVHDAILEDLVFPSEIVGK	5123	sp|P62081|RS7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=26138	55.96484	3	2368.288821	2366.273329	R	R	121	143
PSM	AAQELQEGQR	5124	sp|P0DN79|CBSL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=4058	12.71088	2	1128.5517	1128.5518	K	C	360	370
PSM	LISWYDNEFGYSNR	5125	sp|P04406|G3P_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=20707	45.145578	2	1763.797844	1762.795100	K	V	310	324
PSM	AAYFGIYDTAK	5126	sp|P05141|ADT2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15593	35.533521	2	1218.592027	1218.592090	R	G	189	200
PSM	GMGGAFVLVLYDEIKK	5127	sp|P12235|ADT1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35	ms_run[1]:scan=23794	51.085753	3	1754.928011	1754.927694	R	Y	281	297
PSM	EDSMMEYLK	5128	sp|P35241|RADI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=16296	36.7746	2	1144.478679	1144.478047	R	I	185	194
PSM	ECADLWPR	5129	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:4	ms_run[1]:scan=13200	30.769302	2	1045.465237	1045.465115	K	I	124	132
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	5130	sp|Q15366|PCBP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=12775	29.948008	5	3397.580772	3397.581960	K	G	246	277
PSM	GLPWSCSADEVQR	5131	sp|P31943|HNRH1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=14287	32.971181	2	1503.678640	1503.677627	R	F	17	30
PSM	QIEHTLNEK	5132	sp|P17612|KAPCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:28	ms_run[1]:scan=8213	21.101669	2	1093.5408	1093.5399	K	R	85	94
PSM	KVEAPFIPK	5133	sp|P17612|KAPCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10236	24.887356	3	1027.607005	1027.606617	R	F	310	319
PSM	IVNEQLQR	5134	sp|Q66GS9|CP135_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5876	16.279415	2	998.551309	998.550893	R	S	671	679
PSM	EQTMCPVCLDR	5135	sp|Q86YT6|MIB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	5-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=11552	27.561277	2	1408.598473	1407.594491	K	L	959	970
PSM	TAFQEALDAAGDK	5136	sp|P10599|THIO_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15557	35.463249	3	1336.634537	1335.630660	K	L	9	22
PSM	SQNVMAAASIANIVK	5137	sp|P17987|TCPA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18690	41.1407	2	1515.807966	1515.807913	R	S	19	34
PSM	SSLGPVGLDK	5138	sp|P17987|TCPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=10480	25.47709	2	971.528740	971.528761	K	M	34	44
PSM	LLASANLEEVTMK	5139	sp|P35659|DEK_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=16137	36.497589	2	1417.7481	1417.7481	K	Q	332	345
PSM	VGDQILLAIK	5140	sp|Q6P1L8|RM14_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17737	39.379225	2	1068.654856	1068.654296	K	G	69	79
PSM	YLYTLVITDK	5141	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18606	40.991153	2	1227.674951	1227.675091	R	E	41	51
PSM	LHLTPSQAAQLPLHLHLHR	5142	sp|Q6P087|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0		ms_run[1]:scan=14468	33.293029	5	2181.2276	2181.2278	R	L	298	317
PSM	QHLENDPGSNEDTDIPK	5143	sp|O43396|TXNL1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7529	19.702924	3	1907.847775	1907.849714	K	G	105	122
PSM	KILEVHIDK	5144	sp|P31689|DNJA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=7585	19.806876	3	1093.650273	1093.649545	K	G	206	215
PSM	GASQAGMLAPGTR	5145	sp|Q15417|CNN3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8045	20.801873	2	1215.602898	1215.603005	K	R	213	226
PSM	RGDINLLMLGDPGTAK	5146	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17734	39.375002	3	1670.885158	1669.882140	R	S	372	388
PSM	SAINEVVTR	5147	sp|P62899|RL31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8674	21.992491	2	987.534735	987.534909	R	E	15	24
PSM	EQVANSAFVER	5148	sp|Q58FF7|H90B3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9211	22.934789	2	1248.609582	1248.609865	K	V	365	376
PSM	TKEEALELINGYIQK	5149	sp|Q13526|PIN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=19067	41.83766	3	1747.936240	1747.935616	R	I	81	96
PSM	AITFFTEDDKPLLR	5150	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=19043	41.794125	3	1665.882583	1664.877373	K	S	512	526
PSM	DFTPVCTTELGR	5151	sp|P30041|PRDX6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4	ms_run[1]:scan=14431	33.22401	2	1394.647231	1394.650015	R	A	42	54
PSM	LPFPIIDDR	5152	sp|P30041|PRDX6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=19611	43.009241	2	1084.593154	1084.591696	K	N	98	107
PSM	GEDFYCVTCHETK	5153	sp|Q13642|FHL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[1]:scan=9949	24.351296	3	1645.660581	1644.654843	K	F	145	158
PSM	HEHQVMLMR	5154	sp|Q15233|NONO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=5535	15.650307	3	1180.565031	1179.564117	R	Q	305	314
PSM	NLGFTAIPLHGQMSQSK	5155	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=15469	35.306483	3	1828.932668	1827.930153	R	R	285	302
PSM	AAGTLYTYPENWR	5156	sp|P26641|EF1G_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	1-UNIMOD:1	ms_run[1]:scan=21884	47.272678	2	1582.7404	1582.7411	M	A	2	15
PSM	KAPPDGWELIEPTLDELDQK	5157	sp|P41223|BUD31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=23883	51.25051	3	2293.150054	2293.147794	R	M	9	29
PSM	LDYILGLK	5158	sp|P46781|RS9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=18076	39.988708	2	933.553503	933.553519	K	I	94	102
PSM	GTPEQPQCGFSNAVVQILR	5159	sp|Q86SX6|GLRX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	8-UNIMOD:4	ms_run[1]:scan=22306	48.198794	3	2100.031454	2100.042223	K	L	60	79
PSM	FVNVVPTFGK	5160	sp|P62861|RS30_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17104	38.203227	2	1106.613259	1106.612431	R	K	42	52
PSM	TLSSPSNRPSGETSVPPPPAVGR	5161	sp|Q8WWM7|ATX2L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9495	23.425477	3	2290.173850	2289.171323	K	M	421	444
PSM	GGDSIGETPTPGASK	5162	sp|O75533|SF3B1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6519	17.46125	2	1372.646705	1372.647038	R	R	319	334
PSM	NLFAEIIEEHLANR	5163	sp|Q9NWY4|HPF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=24614	52.691517	3	1668.869912	1667.863120	R	S	323	337
PSM	ESCDSALR	5164	sp|P52907|CAZA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	3-UNIMOD:4	ms_run[1]:scan=3824	12.153536	2	936.397295	936.397095	R	A	122	130
PSM	GVQTLVIGR	5165	sp|Q9H7C9|AAMDC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11700	27.835584	2	941.566311	941.565815	K	G	61	70
PSM	SQGCSEQVLTVLK	5166	sp|P78527|PRKDC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	4-UNIMOD:4	ms_run[1]:scan=14069	32.587527	2	1448.729344	1447.734079	R	T	3290	3303
PSM	LEEGPPVTTVLTR	5167	sp|P08559|ODPA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14607	33.536641	2	1410.782461	1410.771845	R	E	46	59
PSM	TEEARPSPAPGPGTPTGTPTR	5168	sp|Q4KMP7|TB10B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=6250	16.986916	3	2076.024813	2076.023596	K	T	135	156
PSM	GDTGGEDTAAPGR	5169	sp|Q9H773|DCTP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=3188	10.783122	2	1202.516980	1202.516358	R	F	10	23
PSM	GDASLKMDK	5170	sp|Q08722|CD47_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	7-UNIMOD:35	ms_run[1]:scan=6246	16.978358	2	979.4729	979.4639	K	S	94	103
PSM	EVQSNMVPRSMLK	5171	sp|Q9Y4A5|TRRAP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=18795	41.336409	2	1533.7667	1533.7638	K	E	3640	3653
PSM	KEPWTIESQVR	5172	sp|Q09FC8-4|ZN415_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=12478	29.36151	2	1371.706643	1371.714664	R	V	6	17
PSM	KQNDLQK	5173	sp|Q15652|JHD2C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2430	9.226573	2	872.470687	872.471580	K	R	1653	1660
PSM	SYDTDQGR	5174	sp|Q9HA64|KT3K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2918	10.232591	2	941.393223	940.388639	R	V	30	38
PSM	QLFDQVVK	5175	sp|P15311|EZRI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=13188	30.74238	2	977.538734	975.538932	K	T	28	36
PSM	IMGPNYTPGK	5176	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=8966	22.509373	2	1078.541648	1076.532466	R	K	429	439
PSM	ILATAGWDHR	5177	sp|Q9BYB4|GNB1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=9853	24.167401	3	1141.598560	1138.588342	K	I	267	277
PSM	QGPDSERGGEAAR	5178	sp|O15164|TIF1A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=14717	33.755794	2	1331.618613	1328.606905	R	L	37	50
PSM	MREIVHIQAGQCGNQIGAK	5179	sp|Q13885|TBB2A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:35,12-UNIMOD:4	ms_run[1]:scan=8349	21.3347	3	2126.055319	2125.052077	-	F	1	20
PSM	TGQELQSACDALK	5180	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	9-UNIMOD:4	ms_run[1]:scan=10609	25.726119	2	1420.664158	1419.666394	K	D	387	400
PSM	EVDEQMLNVQNK	5181	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	6-UNIMOD:35	ms_run[1]:scan=11082	26.719185	2	1464.694207	1461.676959	K	N	325	337
PSM	QDLMNIAGTTLSSK	5182	sp|P78371|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=17271	38.507525	2	1479.744201	1477.744644	R	L	157	171
PSM	QLTLEVER	5183	sp|Q66GS9|CP135_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=11494	27.459286	2	987.536448	986.539660	R	M	419	427
PSM	NHQVQQLK	5184	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0		ms_run[1]:scan=2341	9.0713596	2	993.532599	993.535578	K	D	1099	1107
PSM	CIKDEETGLCLLPLK	5185	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	1-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=17992	39.832339	3	1787.915786	1787.916143	R	E	2433	2448
PSM	LMKQISSFVSEISDEFK	5186	sp|Q9UBF2|COPG2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	2-UNIMOD:35	ms_run[1]:scan=13283	30.92781	3	2005.993051	2002.992145	R	V	360	377
PSM	SHKPSISFPLCANGQVFGLYK	5187	cov|corona00530|ORF1b_Australia/VIC614/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4	ms_run[1]:scan=22056	47.656565	3	2350.176353	2349.193973	K	N	997	1018
PSM	SHKPPISFPLCANGQVFGLYK	5188	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	17.0	11-UNIMOD:4	ms_run[1]:scan=20834	45.377964	3	2360.197867	2359.214708	K	N	997	1018
PSM	AAAAAAALQAK	5189	sp|P36578|RL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5862	16.256	2	955.54508	955.5451	K	S	354	365
PSM	AAASGYTDLR	5190	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:1	ms_run[2]:scan=12718	29.853	2	1065.5091	1065.5091	M	E	2	12
PSM	AAATPESQEPQAK	5191	sp|P49006|MRP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3886	12.27	2	1326.6416	1326.6416	K	G	145	158
PSM	AACNGPYDGK	5192	sp|Q9HC38-2|GLOD4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=3686	11.861	2	1051.4393	1051.4393	K	W	43	53
PSM	AASAHAIGTVK	5193	sp|P31323|KAP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3306	11.063	3	1024.5665	1024.5665	R	C	362	373
PSM	ADDLDFETGDAGASATFPMQCSALR	5194	sp|P63241|IF5A1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:1,21-UNIMOD:4	ms_run[2]:scan=24524	52.511	3	2687.1479	2687.1479	M	K	2	27
PSM	ADIQTER	5195	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:1	ms_run[2]:scan=7419	19.496	2	873.41921	873.4192	M	A	2	9
PSM	AELATLQAR	5196	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8822	22.236	2	971.53999	971.5400	K	Q	981	990
PSM	AEMSTEISR	5197	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6564	17.532	2	1022.4703	1022.4703	R	L	1006	1015
PSM	AFGYYGPLR	5198	sp|P84103-2|SRSF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15183	34.747	2	1042.5236	1042.5236	R	S	29	38
PSM	AFIGFEGVK	5199	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16126	36.479	2	966.51747	966.5175	K	G	2694	2703
PSM	AGGAAVVITEPEHTKER	5200	sp|Q9P258|RCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6441	17.33	4	1763.9166	1763.9166	K	V	78	95
PSM	AGGTEIGK	5201	sp|O95218-2|ZRAB2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2491	9.333	2	731.38137	731.3814	K	T	47	55
PSM	AGLVIGK	5202	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7760	20.206	2	656.42211	656.4221	K	G	245	252
PSM	AHEAALEAR	5203	sp|Q8IUD2|RB6I2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3065	10.505	2	966.48829	966.4883	K	A	720	729
PSM	AKVEVNIPR	5204	sp|Q9BRX2|PELO_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8359	21.352	3	1024.6029	1024.6029	R	K	161	170
PSM	ALKYLPIDK	5205	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11281	27.068	3	1059.6328	1059.6328	K	C	1244	1253
PSM	ALQENLALLTQTLAEREEEVETLR	5206	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26176	56.046	3	2768.4556	2768.4556	K	G	1418	1442
PSM	ALQGAMEK	5207	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4539	13.733	2	846.42694	846.4269	R	L	800	808
PSM	ALTSELANAR	5208	sp|P26038|MOES_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9691	23.782	2	1044.5564	1044.5564	K	D	524	534
PSM	ALVILAK	5209	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11666	27.763	2	726.50036	726.5004	R	G	6	13
PSM	ALVNQLHER	5210	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6523	17.47	2	1078.5883	1078.5883	K	V	51	60
PSM	AMGIMNSFVNDIFER	5211	sp|Q99880|H2B1L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26925	58.029	3	1742.812	1742.8120	K	I	59	74
PSM	AMLSTGFK	5212	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10568	25.65	2	853.43677	853.4368	K	I	1302	1310
PSM	ANFENLAK	5213	sp|Q14247-3|SRC8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9412	23.284	2	905.46068	905.4607	R	E	315	323
PSM	ANPFGGASHAK	5214	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4374	13.392	3	1055.5148	1055.5148	K	G	38	49
PSM	APQALER	5215	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4158	12.9	2	783.4239	783.4239	R	Y	110	117
PSM	APQVVAEAAK	5216	sp|O60832|DKC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5855	16.243	2	982.54475	982.5447	K	T	434	444
PSM	AQAAAPASVPAQAPK	5217	sp|P47914|RL29_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6769	18.096	2	1376.7412	1376.7412	K	R	135	150
PSM	AQEIAMQNR	5218	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:35	ms_run[2]:scan=3063	10.502	2	1075.508	1075.5080	R	L	156	165
PSM	AQLNETLTK	5219	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7398	19.454	2	1016.5502	1016.5502	K	L	1260	1269
PSM	ASLCISTK	5220	sp|P09874|PARP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:4	ms_run[2]:scan=7519	19.683	2	878.45315	878.4532	K	K	426	434
PSM	ASLSLAPVNIFK	5221	sp|P78371|TCPB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:1	ms_run[2]:scan=26497	56.9	2	1300.7391	1300.7391	M	A	2	14
PSM	ASTLAMTK	5222	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5392	15.349	2	821.43169	821.4317	R	E	201	209
PSM	ASVSSLQEVAMFLQASVLER	5223	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=27975	60.812	3	2164.1198	2164.1198	K	D	2185	2205
PSM	ATAVMPDGQFK	5224	sp|Q06830|PRDX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35	ms_run[2]:scan=7637	19.899	2	1179.5594	1179.5594	K	D	17	28
PSM	ATGYPLAYVAAK	5225	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14578	33.485	2	1223.655	1223.6550	K	L	697	709
PSM	ATISNDGATILK	5226	sp|Q99832|TCPH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10541	25.604	2	1202.6507	1202.6507	K	L	56	68
PSM	ATLEEHLR	5227	sp|Q5SW79|CE170_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6171	16.848	3	967.50869	967.5087	R	R	394	402
PSM	ATYDKLCK	5228	sp|P62851|RS25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:4	ms_run[2]:scan=4596	13.891	3	997.49027	997.4903	K	E	53	61
PSM	AVGVQCPVCR	5229	sp|Q96BH1|RNF25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=7035	18.655	2	1144.5481	1144.5481	K	E	193	203
PSM	AVLFCLSEDKK	5230	sp|P23528|COF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:4	ms_run[2]:scan=13005	30.414	3	1308.6748	1308.6748	K	N	35	46
PSM	AVPLIHQEGNR	5231	sp|O00170|AIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6707	17.939	3	1232.6626	1232.6626	K	L	178	189
PSM	CAYWVPR	5232	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=12500	29.417	2	950.44326	950.4433	K	A	420	427
PSM	CGLVIGK	5233	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=8318	21.285	2	745.41565	745.4156	K	G	366	373
PSM	CLEDLEFK	5234	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=14965	34.242	2	1052.4848	1052.4848	R	F	430	438
PSM	CQEIEIYLK	5235	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=15382	35.154	2	1194.5955	1194.5955	K	Q	1060	1069
PSM	CQEVISWLDANTLAEKDEFEHK	5236	sp|P0DMV9|HS71B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=20573	44.905	3	2661.2381	2661.2381	K	R	574	596
PSM	CSESIPK	5237	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	1-UNIMOD:4	ms_run[2]:scan=4357	13.357	2	819.37965	819.3797	K	D	24	31
PSM	DFTPVCTTELGR	5238	sp|P30041|PRDX6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:4	ms_run[2]:scan=14384	33.143	2	1394.65	1394.6500	R	A	42	54
PSM	DGFLHETLLDR	5239	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16531	37.188	3	1314.6568	1314.6568	K	R	237	248
PSM	DGGTGHIPLK	5240	sp|Q5W111-2|SPRY7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5838	16.216	3	993.52434	993.5243	R	E	14	24
PSM	DGPLNMILDDGGDLTNLIHTK	5241	sp|P23526|SAHH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:35	ms_run[2]:scan=25678	54.915	3	2267.1104	2267.1104	K	Y	122	143
PSM	DIQEEKEEIQK	5242	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6561	17.529	3	1387.6831	1387.6831	R	K	684	695
PSM	DKFEEDR	5243	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3195	10.799	2	937.41412	937.4141	R	I	1362	1369
PSM	DKLITEMDR	5244	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8982	22.538	3	1119.5594	1119.5594	R	S	1554	1563
PSM	DKPELEVVLTEDALK	5245	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20605	44.963	3	1697.9087	1697.9087	K	S	2453	2468
PSM	DLELTQCYK	5246	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:4	ms_run[2]:scan=12434	29.283	2	1168.5434	1168.5434	K	Q	2504	2513
PSM	DLLFQALGR	5247	sp|Q9NSD9|SYFB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21692	46.923	2	1031.5764	1031.5764	R	T	9	18
PSM	DLLHPSLEEEK	5248	sp|Q71UM5|RS27L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12621	29.684	3	1308.6561	1308.6561	R	K	6	17
PSM	DNPTAQQIMQLLR	5249	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24416	52.3	3	1526.7875	1526.7875	R	E	956	969
PSM	DQDLASCDR	5250	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:4	ms_run[2]:scan=4777	14.244	2	1078.4349	1078.4349	R	D	342	351
PSM	DRENYDR	5251	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2253	8.9165	2	966.41552	966.4155	R	G	510	517
PSM	DSATGLSK	5252	sp|P26368-2|U2AF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2853	10.077	2	777.38685	777.3868	K	G	293	301
PSM	DSEEIDDVTR	5253	sp|Q9Y388|RBMX2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8669	21.982	2	1177.5099	1177.5099	K	Q	120	130
PSM	DSHGVAQVR	5254	sp|P62277|RS13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2958	10.306	2	967.48354	967.4835	R	F	56	65
PSM	DTNGSQFFITTVK	5255	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17481	38.942	3	1456.7198	1456.7198	K	T	146	159
PSM	DVPSGHTR	5256	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2092	8.6566	2	867.41988	867.4199	R	D	3254	3262
PSM	EAIEGTYIDKK	5257	sp|P62280|RS11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7590	19.816	3	1265.6503	1265.6503	K	C	49	60
PSM	EALDEQLVQVK	5258	sp|Q96N16|JKIP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13580	31.517	2	1270.6769	1270.6769	K	E	241	252
PSM	EALILILSR	5259	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21531	46.639	2	1026.6437	1026.6437	K	T	69	78
PSM	ECADLWPR	5260	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=12993	30.394	2	1045.4651	1045.4651	K	I	124	132
PSM	ECSDVQPK	5261	sp|O43678-2|NDUA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=2438	9.243	2	961.4175	961.4175	R	L	57	65
PSM	EDMAALEK	5262	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7830	20.414	2	905.41643	905.4164	R	D	423	431
PSM	EDVGAAGAR	5263	sp|Q8TA86|RP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2865	10.099	2	844.40389	844.4039	R	R	8	17
PSM	EENKSDMNTVLNYIFSHAQVTK	5264	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24767	52.992	4	2567.2326	2567.2326	R	K	1015	1037
PSM	EETGLLMPLKAPK	5265	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14257	32.917	2	1425.7901	1425.7901	R	E	725	738
PSM	EGAEEIDR	5266	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4392	13.425	2	917.40904	917.4090	K	H	246	254
PSM	EGEIYCK	5267	sp|Q16527|CSRP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:4	ms_run[2]:scan=5167	14.968	2	897.39022	897.3902	K	G	162	169
PSM	EGIPALDNFLDKL	5268	sp|P13639|EF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=27697	60.326	2	1443.7609	1443.7609	K	-	846	859
PSM	EGPEGFAR	5269	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6983	18.554	2	861.39808	861.3981	R	A	548	556
PSM	EHLTQDLER	5270	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6323	17.117	2	1139.5571	1139.5571	K	R	1647	1656
PSM	EHLTQDLER	5271	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6344	17.154	3	1139.5571	1139.5571	K	R	1647	1656
PSM	EIAEAYLGK	5272	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11113	26.773	2	992.51786	992.5179	K	T	129	138
PSM	EKDTAVQGNIR	5273	sp|Q9UBV8|PEF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3801	12.096	2	1229.6364	1229.6364	R	L	259	270
PSM	EKEEVVLR	5274	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5305	15.205	2	1000.5553	1000.5553	R	C	313	321
PSM	EKLQEEMLQR	5275	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9027	22.62	3	1302.6602	1302.6602	R	E	187	197
PSM	EKMELEMR	5276	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8389	21.404	2	1064.4995	1064.4995	R	L	883	891
PSM	ELEVLLMCNK	5277	sp|P62910|RL32_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	8-UNIMOD:4	ms_run[2]:scan=18209	40.242	2	1247.6254	1247.6254	K	S	84	94
PSM	ELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSR	5278	sp|Q15154|PCM1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	15-UNIMOD:4	ms_run[2]:scan=22587	48.801	4	3965.8371	3965.8371	K	L	173	209
PSM	ELHLSWEVGK	5279	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14977	34.277	3	1196.619	1196.6190	R	P	1085	1095
PSM	ELNITAAK	5280	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7901	20.548	2	858.48108	858.4811	R	E	42	50
PSM	EMDEEDKAFK	5281	sp|Q9Y2S6|TMA7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6413	17.28	3	1240.5282	1240.5282	K	Q	21	31
PSM	EMGTPDVR	5282	sp|P62899|RL31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6254	16.992	2	903.41202	903.4120	K	I	56	64
PSM	ENDPSVMR	5283	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5202	15.025	2	946.41783	946.4178	K	S	748	756
PSM	ENLAQAVEHR	5284	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8677	21.996	3	1165.584	1165.5840	K	K	2066	2076
PSM	EQAELTGLR	5285	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9409	23.28	2	1015.5298	1015.5298	R	L	126	135
PSM	EQASTEHQSR	5286	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=1780	8.1676	3	1171.5218	1171.5218	K	T	643	653
PSM	EQGVLSFWR	5287	sp|P05141|ADT2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20627	45.001	2	1120.5665	1120.5665	K	G	64	73
PSM	EQISDIDDAVR	5288	sp|P53999|TCP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11561	27.58	2	1259.5994	1259.5994	K	K	115	126
PSM	EQLQGLNDR	5289	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7428	19.516	2	1071.5309	1071.5309	K	F	103	112
PSM	EQMEAEIAHLK	5290	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11620	27.685	3	1297.6336	1297.6336	R	Q	413	424
PSM	EQSQLTATQTR	5291	sp|Q6P2Q9|PRP8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4832	14.339	2	1261.6262	1261.6262	K	T	2035	2046
PSM	ESESLQAR	5292	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3731	11.96	2	918.44067	918.4407	K	L	2071	2079
PSM	ESVQTFFK	5293	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13988	32.444	2	984.49165	984.4916	K	L	673	681
PSM	EVCHLEAELK	5294	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=9091	22.727	3	1226.5965	1226.5965	R	N	501	511
PSM	EVDEQMLNVQNK	5295	sp|P07437|TBB5_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11012	26.597	3	1445.682	1445.6820	K	N	325	337
PSM	EVDEQMLSVQSK	5296	sp|P04350|TBB4A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11196	26.918	2	1391.6602	1391.6602	K	N	325	337
PSM	EVSTYIKK	5297	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4817	14.312	2	966.5386	966.5386	K	I	173	181
PSM	FAVFIEK	5298	sp|Q16352|AINX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14830	33.978	2	852.47454	852.4745	R	V	105	112
PSM	FDLMYAK	5299	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14577	33.483	2	886.42588	886.4259	K	R	395	402
PSM	FDLMYAK	5300	sp|P68363|TBA1B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:35	ms_run[2]:scan=12092	28.627	2	902.42079	902.4208	K	R	395	402
PSM	FEKEFSFK	5301	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11046	26.659	3	1060.5229	1060.5229	R	N	1291	1299
PSM	FEKEFSFK	5302	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11079	26.715	2	1060.5229	1060.5229	R	N	1291	1299
PSM	FESPEVAER	5303	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8618	21.898	2	1062.4982	1062.4982	K	A	660	669
PSM	FHAHPESSER	5304	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2134	8.7203	3	1195.537	1195.5370	K	D	1053	1063
PSM	FIMESGAK	5305	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8168	21.022	2	881.43169	881.4317	R	G	125	133
PSM	FLLPAENNKPQR	5306	sp|Q6P087|RUSD3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10119	24.674	3	1425.7728	1425.7728	R	Q	276	288
PSM	FPDENFK	5307	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10104	24.648	2	895.40758	895.4076	R	L	123	130
PSM	FQNNSEDNVKK	5308	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2570	9.4666	3	1321.6262	1321.6262	K	L	172	183
PSM	GAATSVSNPR	5309	sp|Q8NFW8|NEUA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3041	10.455	2	958.48321	958.4832	K	G	7	17
PSM	GALKEEQR	5310	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2124	8.7041	2	929.49304	929.4930	K	D	532	540
PSM	GELTTLIHQLQEK	5311	sp|Q86UP2|KTN1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=19882	43.568	3	1508.8199	1508.8199	K	D	325	338
PSM	GFTTAAYLR	5312	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13084	30.551	2	998.51853	998.5185	K	I	427	436
PSM	GGQTHLGLPVFNTVK	5313	sp|P53597|SUCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15914	36.098	3	1566.8518	1566.8518	K	E	91	106
PSM	GIFTISDHPAEQR	5314	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12254	28.969	3	1469.7263	1469.7263	R	G	196	209
PSM	GISLNPEQWSQLK	5315	sp|P53999|TCP4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20604	44.961	3	1498.778	1498.7780	K	E	102	115
PSM	GLQPGEEELPDISPPIVIPDDSKDR	5316	sp|Q92995-2|UBP13_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20642	45.027	3	2715.3603	2715.3603	R	L	553	578
PSM	GSGGFGSTGK	5317	sp|P33316-2|DUT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3164	10.726	2	853.393	853.3930	R	N	154	164
PSM	GTAVVNGEFK	5318	sp|P30048-2|PRDX3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8146	20.982	2	1020.524	1020.5240	K	D	56	66
PSM	GTAYTFFTPGNLK	5319	sp|Q92841-1|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=19094	41.888	2	1415.7085	1415.7085	K	Q	437	450
PSM	GTYDILVTK	5320	sp|P13861|KAP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13199	30.768	2	1008.5492	1008.5492	R	D	182	191
PSM	GWAPVFLDR	5321	sp|Q9Y5Y2|NUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20110	43.962	2	1059.5502	1059.5502	R	E	75	84
PSM	HEQEYMEVR	5322	sp|Q15363|TMED2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6535	17.486	2	1219.5292	1219.5292	K	E	146	155
PSM	HFLLEEDKPEEPTAHAFVSTLTR	5323	sp|P49327|FAS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16692	37.474	4	2666.334	2666.3340	R	G	1516	1539
PSM	HILLYGPPGTGK	5324	sp|Q5T9A4|ATD3B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11140	26.82	3	1251.6976	1251.6976	R	T	347	359
PSM	HLDMGSPQLR	5325	sp|Q76N32-2|CEP68_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8686	22.009	3	1152.571	1152.5710	K	T	430	440
PSM	HLLLVDPEGVVR	5326	sp|P98077|SHC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15724	35.764	3	1345.7718	1345.7718	K	T	531	543
PSM	HLPGVCK	5327	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:4	ms_run[2]:scan=4171	12.928	2	809.42179	809.4218	R	V	163	170
PSM	HLSMQSFDESGRR	5328	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8561	21.805	3	1548.7103	1548.7103	R	T	267	280
PSM	HPFAQAVGR	5329	sp|O43837|IDH3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5436	15.443	2	981.51445	981.5144	R	N	309	318
PSM	HSVGVVIGR	5330	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6197	16.893	2	922.53485	922.5348	R	S	332	341
PSM	HVLVTLGEK	5331	sp|P60660|MYL6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8241	21.151	2	994.58113	994.5811	R	M	111	120
PSM	HYFIEVNSR	5332	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10147	24.721	3	1163.5724	1163.5724	K	L	320	329
PSM	HYVYIGDPAQLPAPR	5333	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16282	36.749	3	1695.8733	1695.8733	K	T	1318	1333
PSM	IAFAITAIK	5334	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17542	39.045	2	946.58515	946.5852	K	G	26	35
PSM	IALLEEAKK	5335	sp|P35241|RADI_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9278	23.059	3	1013.6121	1013.6121	K	K	428	437
PSM	IAVHCTVR	5336	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:4	ms_run[2]:scan=4151	12.888	3	954.50692	954.5069	K	G	68	76
PSM	IAVVTADGK	5337	sp|Q96E11-7|RRFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6357	17.177	2	872.49673	872.4967	K	L	75	84
PSM	ICEILQAEK	5338	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=10466	25.445	2	1102.5692	1102.5692	K	Y	1306	1315
PSM	IDVLLQQIEELGSEGKVEEAQGMMK	5339	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=25086	53.603	3	2773.3878	2773.3878	K	L	136	161
PSM	IEDVTPIPSDSTRR	5340	sp|P62263|RS14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9455	23.358	3	1584.8107	1584.8107	R	K	129	143
PSM	IEFINEK	5341	sp|Q6DCA0|AMERL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11103	26.756	2	891.47018	891.4702	R	G	219	226
PSM	IFEPPPPK	5342	sp|O43143|DHX15_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8725	22.073	2	923.51165	923.5117	R	K	400	408
PSM	IFGVTTLDIVR	5343	sp|P40926|MDHM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21744	47.023	2	1232.7129	1232.7129	K	A	166	177
PSM	IGLVRPGTALELLEAQAATGFIVDPVSNLR	5344	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=27704	60.339	3	3119.7343	3119.7343	K	L	2280	2310
PSM	IGPILDNSTLQSEVKPILEK	5345	sp|P30153|2AAA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20216	44.151	3	2193.2256	2193.2256	K	L	547	567
PSM	IGSFGPQEDLLFLR	5346	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24362	52.196	3	1590.8406	1590.8406	R	A	1688	1702
PSM	IHGVGFK	5347	sp|P62899|RL31_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5639	15.832	2	756.42826	756.4283	R	K	33	40
PSM	IIHDFPQFYPLGIVQHD	5348	sp|P35244|RFA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=23083	49.715	3	2038.0312	2038.0312	K	-	105	122
PSM	IINEVSKPLAHHIPVEK	5349	sp|P55145|MANF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9031	22.626	3	1923.0942	1923.0942	K	I	88	105
PSM	IKEEFQFLQAQYHSLK	5350	sp|Q04724|TLE1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16555	37.23	4	2008.0418	2008.0418	R	L	29	45
PSM	IKEQFLQQK	5351	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7465	19.587	2	1160.6554	1160.6554	K	V	841	850
PSM	IKNQQLDLENTELSQK	5352	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11025	26.621	3	1899.9902	1899.9902	K	N	1584	1600
PSM	IKVPVDWSK	5353	sp|P13797-3|PLST_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12312	29.069	3	1070.6124	1070.6124	R	V	391	400
PSM	ILFLDPSGK	5354	sp|O95881|TXD12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18176	40.183	2	988.55933	988.5593	R	V	115	124
PSM	ILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNR	5355	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	32-UNIMOD:4	ms_run[2]:scan=23955	51.387	5	4030.8855	4030.8855	K	F	1448	1484
PSM	ILGPQGNTIKR	5356	sp|Q07666|KHDR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6234	16.959	3	1195.7037	1195.7037	K	L	176	187
PSM	ILSGVVTK	5357	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8003	20.731	2	815.51165	815.5117	R	M	72	80
PSM	ILTMDGLIEDIK	5358	sp|P82921|RT21_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24044	51.573	2	1359.732	1359.7320	R	H	29	41
PSM	IQDKEGIPPDQQR	5359	sp|P62987|RL40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4884	14.436	3	1522.774	1522.7740	K	L	30	43
PSM	IQIASESSGIPERPCVLTGTPESIEQAK	5360	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	15-UNIMOD:4	ms_run[2]:scan=16234	36.664	3	2996.5125	2996.5125	K	R	111	139
PSM	IQLAEITSEK	5361	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12755	29.913	2	1130.6183	1130.6183	K	H	1265	1275
PSM	IQTQPGYANTLR	5362	sp|Q00325-2|MPCP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9463	23.372	2	1360.7099	1360.7099	R	D	189	201
PSM	IQVLTDK	5363	sp|O95232|LC7L3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7658	19.937	2	815.47527	815.4753	K	I	129	136
PSM	IRPGFEEQILYLQK	5364	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17521	39.01	3	1732.9512	1732.9512	K	Q	190	204
PSM	ISDSEGFK	5365	sp|P23246|SFPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6032	16.612	2	881.41306	881.4131	K	A	272	280
PSM	ISTVVSSK	5366	sp|P37108|SRP14_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4641	13.977	2	819.47018	819.4702	K	E	67	75
PSM	ITLQNTSDGIK	5367	sp|Q12923-3|PTN13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9430	23.318	2	1188.635	1188.6350	K	H	833	844
PSM	ITSEGGDGATK	5368	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2273	8.9511	2	1034.488	1034.4880	K	Y	861	872
PSM	IVHSSMTR	5369	sp|Q96HS1-2|PGAM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2526	9.395	3	929.47529	929.4753	K	A	145	153
PSM	IYCPACHNSEVGPEHSLAEYHNESGLK	5370	cov|corona02293|ORF1a_Belgium/rega-0505485/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=10733	26.062	5	3097.3658	3097.3658	K	T	368	395
PSM	IYVSANSGAR	5371	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5770	16.102	2	1036.5302	1036.5302	R	I	1714	1724
PSM	KAPPDGWELIEPTLDELDQK	5372	sp|P41223|BUD31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=23775	51.054	3	2293.1478	2293.1478	R	M	9	29
PSM	KEGGLGPLNIPLLADVTR	5373	sp|P32119|PRDX2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24286	52.033	3	1862.0625	1862.0625	R	R	92	110
PSM	KFGQGSR	5374	sp|P62273|RS29_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2009	8.5199	2	778.40859	778.4086	R	S	13	20
PSM	KFVADGIFK	5375	sp|P23396|RS3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12577	29.599	3	1023.5753	1023.5753	R	A	10	19
PSM	KIAPYVAHNFSK	5376	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7272	19.148	4	1373.7456	1373.7456	K	L	589	601
PSM	KLEAAEDIAYQLSR	5377	sp|P35232|PHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16592	37.295	3	1605.8362	1605.8362	R	S	240	254
PSM	KLEEHEESLVGR	5378	sp|Q14789-2|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6026	16.6	3	1424.726	1424.7260	R	A	265	277
PSM	KMNELETEQR	5379	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4850	14.369	2	1276.6082	1276.6082	R	L	460	470
PSM	KQGTIFLAGPPLVK	5380	sp|Q9HCC0|MCCB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15572	35.491	3	1467.8813	1467.8813	R	A	235	249
PSM	KTFSHELSDFGLESTAGEIPVVAIR	5381	sp|P30101|PDIA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21140	45.939	4	2702.3915	2702.3915	R	T	305	330
PSM	KVVGCSCVVVK	5382	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=5533	15.648	3	1233.6573	1233.6573	R	D	102	113
PSM	KYDASLK	5383	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3440	11.357	2	823.44397	823.4440	R	E	2765	2772
PSM	LASGSFDK	5384	sp|Q96J01-2|THOC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5533	15.648	2	823.40758	823.4076	R	T	70	78
PSM	LAVYIDK	5385	sp|P20700|LMNB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10259	24.938	2	820.46945	820.4695	R	V	43	50
PSM	LCLNICVGESGDR	5386	sp|P62913|RL11_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=15775	35.852	2	1491.681	1491.6810	K	L	20	33
PSM	LCQECSIK	5387	sp|Q70Z53-2|F10C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4937	14.533	2	1036.4682	1036.4682	R	L	210	218
PSM	LDYCGGSGEPGGVQR	5388	sp|Q15464|SHB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:4	ms_run[2]:scan=8687	22.011	2	1550.6784	1550.6784	R	A	112	127
PSM	LEAELATAR	5389	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8317	21.284	2	972.52401	972.5240	K	S	554	563
PSM	LEHIDGVNLTVPVK	5390	sp|Q6P087|RUSD3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15128	34.629	3	1532.8562	1532.8562	K	A	192	206
PSM	LEVQATDREENK	5391	sp|P11387|TOP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4643	13.982	3	1430.7001	1430.7001	K	Q	701	713
PSM	LEVQCQAEK	5392	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:4	ms_run[2]:scan=5187	15	2	1103.5281	1103.5281	K	V	2006	2015
PSM	LFAAETLK	5393	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14426	33.213	2	891.50657	891.5066	K	A	1055	1063
PSM	LFAAETLK	5394	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14567	33.467	2	891.50657	891.5066	K	A	1055	1063
PSM	LFAVLEQLSPVR	5395	sp|Q9P2S5|WRP73_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=23670	50.859	2	1370.7922	1370.7922	R	A	366	378
PSM	LFLVQLQEK	5396	sp|O43809|CPSF5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18144	40.122	2	1116.6543	1116.6543	K	A	174	183
PSM	LGNDFHTNKR	5397	sp|P08708|RS17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2999	10.374	2	1200.6	1200.6000	R	V	24	34
PSM	LGPTEGRPQLK	5398	sp|O15235|RT12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6554	17.516	2	1194.6721	1194.6721	K	G	49	60
PSM	LHLGFIEIR	5399	sp|Q9Y383|LC7L2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=19487	42.788	3	1096.6393	1096.6393	K	E	214	223
PSM	LHPFHVIR	5400	sp|P27635|RL10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7740	20.158	3	1017.5872	1017.5872	R	I	91	99
PSM	LHQDLWK	5401	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8856	22.292	3	938.4974	938.4974	K	T	1248	1255
PSM	LIAAQTGTR	5402	sp|Q9BZL1|UBL5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4812	14.303	2	929.52943	929.5294	K	W	30	39
PSM	LIDFLESGK	5403	sp|Q92841-1|DDX17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17608	39.157	2	1020.5492	1020.5492	R	T	226	235
PSM	LKQSLPPGLAVK	5404	sp|P63173|RL38_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10868	26.31	3	1249.7758	1249.7758	K	E	56	68
PSM	LLAMENIHK	5405	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9581	23.571	3	1067.5798	1067.5798	K	A	987	996
PSM	LLDFGSLSNLQVTQPTVGMNFK	5406	sp|P08708|RS17_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=25478	54.484	2	2408.241	2408.2410	K	T	108	130
PSM	LLGQFTLIGIPPAPR	5407	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=25009	53.458	2	1591.945	1591.9450	K	G	499	514
PSM	LLHIEELR	5408	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12296	29.04	3	1021.592	1021.5920	R	E	206	214
PSM	LLLDQEQK	5409	sp|O75937|DNJC8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9049	22.655	2	985.54441	985.5444	K	K	109	117
PSM	LLQAGEENQVLELLIHR	5410	sp|Q9NPJ6-2|MED4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24199	51.864	3	1974.0898	1974.0898	K	D	10	27
PSM	LLSPLSSAR	5411	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11444	27.365	2	942.54983	942.5498	R	L	565	574
PSM	LLYEDVSR	5412	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10855	26.288	2	993.51311	993.5131	K	E	1250	1258
PSM	LNSAIIYDR	5413	sp|P23921|RIR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11538	27.536	2	1063.5662	1063.5662	R	D	131	140
PSM	LNSLAIGLR	5414	sp|P54886-2|P5CS_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14080	32.608	2	955.58147	955.5815	K	Q	431	440
PSM	LPDYKPYPMYPATTSLVNVVPK	5415	sp|Q00535|CDK5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20820	45.354	3	2492.3025	2492.3025	K	L	233	255
PSM	LQAEEAGLR	5416	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7065	18.722	2	985.51926	985.5193	R	E	479	488
PSM	LQFTSLEIPR	5417	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=19092	41.885	3	1202.6659	1202.6659	K	R	1508	1518
PSM	LQSAQAQPFHQEEK	5418	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6083	16.699	2	1639.7954	1639.7954	R	E	1075	1089
PSM	LRDDTEAAIR	5419	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5308	15.209	2	1158.5993	1158.5993	R	A	195	205
PSM	LREDLER	5420	sp|P62269|RS18_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4645	13.985	3	929.49304	929.4930	K	L	107	114
PSM	LRETQEYNR	5421	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3567	11.612	3	1207.5945	1207.5945	K	I	1037	1046
PSM	LRQPFFQK	5422	sp|Q01105-2|SET_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9557	23.53	2	1062.5974	1062.5974	K	R	63	71
PSM	LSGALIK	5423	sp|Q9NSC7|SIA7A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8253	21.171	2	700.44833	700.4483	R	G	392	399
PSM	LSIVPVRR	5424	sp|P15880|RS2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8973	22.523	3	938.60253	938.6025	K	G	160	168
PSM	LSVDYGKK	5425	sp|P68363|TBA1B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5425	15.418	2	908.49673	908.4967	R	S	157	165
PSM	LSYGIATVR	5426	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18435	40.666	2	978.54983	978.5498	K	E	1070	1079
PSM	LTEGCSFR	5427	sp|P42677|RS27_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:4	ms_run[2]:scan=6903	18.37	2	968.43857	968.4386	R	R	73	81
PSM	LTLEEAYR	5428	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11912	28.283	2	993.51311	993.5131	K	R	1788	1796
PSM	LTVGAQSR	5429	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4651	14.001	2	830.46102	830.4610	R	E	223	231
PSM	LVAGEMGQNEPDQGGQR	5430	sp|Q99714|HCD2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8040	20.792	3	1784.8112	1784.8112	R	G	131	148
PSM	LVTGHHLWASK	5431	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6909	18.381	4	1247.6775	1247.6775	R	N	1712	1723
PSM	LWSQLDSAR	5432	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12456	29.323	2	1074.5458	1074.5458	R	T	470	479
PSM	LYSPSQIGAFVLMK	5433	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=23983	51.443	2	1552.8323	1552.8323	K	M	160	174
PSM	MALLATVLGR	5434	sp|P27708|PYR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21679	46.895	2	1043.6161	1043.6161	R	F	2215	2225
PSM	MDLGECLK	5435	sp|Q9Y383|LC7L2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:4	ms_run[2]:scan=11989	28.411	2	964.43579	964.4358	R	V	54	62
PSM	MEQETQR	5436	sp|Q99996-3|AKAP9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2156	8.7523	2	920.40218	920.4022	R	K	422	429
PSM	MFESFIESVPLLK	5437	sp|P13861|KAP2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26342	56.479	3	1538.8055	1538.8055	K	S	251	264
PSM	MFGGPGTASRPSSSR	5438	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6279	17.038	3	1493.7045	1493.7045	R	S	14	29
PSM	MGANSLER	5439	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5730	16.027	2	876.41235	876.4124	R	M	532	540
PSM	MKPDETPMFDPSLLK	5440	sp|Q96EK6|GNA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18238	40.298	3	1747.8525	1747.8525	-	E	1	16
PSM	MMLDDIVSR	5441	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16588	37.289	2	1078.5151	1078.5151	K	G	206	215
PSM	NCAAYLK	5442	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=5954	16.423	2	838.40072	838.4007	R	L	815	822
PSM	NCGFVAFMNR	5443	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=17169	38.322	2	1214.5325	1214.5325	R	R	319	329
PSM	NCSSFLIK	5444	sp|P46779|RL28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=11676	27.781	2	967.4797	967.4797	R	R	12	20
PSM	NCTIVSPDAGGAK	5445	sp|P60891|PRPS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=6935	18.439	2	1288.6082	1288.6082	R	R	164	177
PSM	NEEDAAELVALAQAVNAR	5446	sp|P22314-2|UBA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=23820	51.136	3	1882.9385	1882.9385	R	A	311	329
PSM	NETETAEER	5447	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2547	9.429	2	1077.4574	1077.4574	R	V	2701	2710
PSM	NGVELTSLR	5448	sp|Q4V328|GRAP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11669	27.767	2	987.53491	987.5349	K	Q	34	43
PSM	NGVMPSHFSR	5449	sp|P39019|RS19_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7472	19.599	3	1130.5291	1130.5291	R	G	85	95
PSM	NHPGLLLMDTTFR	5450	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	8-UNIMOD:35	ms_run[2]:scan=14339	33.064	3	1529.766	1529.7660	R	D	559	572
PSM	NLQDPFYPR	5451	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15225	34.851	2	1148.5615	1148.5615	R	G	185	194
PSM	NMEMLLQEK	5452	sp|Q9Y2I6|NINL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14805	33.933	2	1134.5413	1134.5413	K	V	1304	1313
PSM	NMMAACDPR	5453	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:35,3-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=2620	9.5528	2	1096.41	1096.4100	K	H	298	307
PSM	NMMAACDPR	5454	sp|P04350|TBB4A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:4	ms_run[2]:scan=6875	18.313	2	1064.4202	1064.4202	K	H	298	307
PSM	NPPPNSDPNLR	5455	sp|Q96I24|FUBP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5162	14.959	2	1219.5945	1219.5945	R	R	393	404
PSM	NQLTSNPENTVFDAKR	5456	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11439	27.358	3	1832.9017	1832.9017	K	L	82	98
PSM	NSAVETVEQELLFVGSETGK	5457	sp|Q9Y2R4|DDX52_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=26948	58.1	3	2136.0586	2136.0586	R	L	380	400
PSM	NVMVEPHRHEGVFICR	5458	sp|P22087|FBRL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	15-UNIMOD:4	ms_run[2]:scan=8862	22.303	4	1978.9618	1978.9618	K	G	85	101
PSM	QAELAAQK	5459	sp|Q9NWB6|ARGL1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3035	10.443	2	857.46068	857.4607	R	A	181	189
PSM	QCEINYVKK	5460	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=5422	15.41	3	1180.591	1180.5910	K	F	204	213
PSM	QEGIIFIGPPPSAIR	5461	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20660	45.06	3	1593.8879	1593.8879	K	D	144	159
PSM	QENAAVQK	5462	sp|Q8N4C6-7|NIN_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2075	8.6287	2	886.45084	886.4508	K	M	1563	1571
PSM	QKADEAYLIGR	5463	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9341	23.166	3	1262.6619	1262.6619	R	G	78	89
PSM	QLEQLEGK	5464	sp|Q5TZA2|CROCC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6864	18.293	2	943.49746	943.4975	R	R	667	675
PSM	QLNITIEK	5465	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11365	27.228	2	957.5495	957.5495	K	L	179	187
PSM	QMSIHMEELK	5466	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11388	27.266	3	1244.5893	1244.5893	R	I	2247	2257
PSM	QNQALNAMLIK	5467	sp|Q96SN8|CK5P2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14524	33.393	2	1242.6754	1242.6754	K	G	1458	1469
PSM	QPTIFQNK	5468	sp|P62280|RS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8940	22.447	2	974.51853	974.5185	K	K	13	21
PSM	QQPIIGIR	5469	sp|Q86YT6|MIB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10801	26.196	2	923.55525	923.5553	R	W	90	98
PSM	QSCWDLER	5470	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=11374	27.243	2	1092.4658	1092.4658	K	A	475	483
PSM	QSLDDAAK	5471	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3628	11.735	2	846.40831	846.4083	K	T	1467	1475
PSM	QTIINKFELR	5472	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13339	31.033	3	1260.719	1260.7190	K	E	783	793
PSM	QTQTFTTYSDNQPGVLIQVYEGER	5473	sp|P11142|HSP7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21434	46.463	3	2773.3195	2773.3195	K	A	424	448
PSM	QTSAILQQHYGGDIPASVAELVALPGVGPK	5474	sp|P78549-3|NTH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=24833	53.118	3	3015.6029	3015.6029	K	M	176	206
PSM	QVELLAYK	5475	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13268	30.898	2	962.54368	962.5437	R	V	2563	2571
PSM	QVQAEVPGSPIFVMR	5476	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	14-UNIMOD:35	ms_run[2]:scan=15843	35.972	2	1672.8607	1672.8607	R	L	336	351
PSM	QWGWTQGR	5477	sp|P18621-3|RL17_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12883	30.198	2	1017.4781	1017.4781	K	W	75	83
PSM	RIGYPVMIK	5478	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11297	27.096	3	1075.6212	1075.6212	R	A	197	206
PSM	RIGYPVMIK	5479	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11312	27.122	2	1075.6212	1075.6212	R	A	197	206
PSM	RLEEGTEETSETLEK	5480	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7127	18.859	2	1749.8269	1749.8269	R	L	798	813
PSM	RLEQELHHVK	5481	sp|Q8TD10|MIPO1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3454	11.384	4	1287.7048	1287.7048	K	E	279	289
PSM	RLLGLFGETLR	5482	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18638	41.047	3	1273.7507	1273.7507	R	A	1164	1175
PSM	RVPCAYDK	5483	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:4	ms_run[2]:scan=3663	11.81	2	1007.4859	1007.4859	K	T	246	254
PSM	RVVELENEK	5484	sp|Q14789-2|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4932	14.523	2	1114.5982	1114.5982	K	G	481	490
PSM	RYDDPEVQK	5485	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4134	12.857	2	1148.5462	1148.5462	R	D	127	136
PSM	SAEQISDSVR	5486	sp|O43819|SCO2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6587	17.57	2	1090.5255	1090.5255	R	R	246	256
PSM	SAINEVVTR	5487	sp|P62899|RL31_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8518	21.729	2	987.53491	987.5349	R	E	15	24
PSM	SAVPPGADK	5488	sp|P46783|RS10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2828	10.016	2	840.43413	840.4341	R	K	130	139
PSM	SAWYMGPVSR	5489	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15515	35.386	2	1152.5386	1152.5386	R	Q	12	22
PSM	SCSPELQQK	5490	sp|P16152|CBR1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:4	ms_run[2]:scan=4156	12.898	2	1075.4968	1075.4968	K	F	149	158
PSM	SDGSGFGAR	5491	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4256	13.096	2	852.37259	852.3726	K	L	2342	2351
PSM	SDIGEVILVGGMTR	5492	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=20321	44.383	3	1445.7548	1445.7548	K	M	378	392
PSM	SDLEMQYETLQEELMALKK	5493	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=23899	51.28	3	2330.1022	2330.1022	K	N	272	291
PSM	SDLSRPTSSQK	5494	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2632	9.5743	2	1204.6048	1204.6048	K	K	3024	3035
PSM	SELIEQVMK	5495	sp|Q92995-2|UBP13_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14284	32.967	2	1075.5583	1075.5583	K	E	341	350
PSM	SFFDNISCDDNR	5496	sp|Q8ND56-3|LS14A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	8-UNIMOD:4	ms_run[2]:scan=15893	36.06	2	1488.594	1488.5940	K	E	327	339
PSM	SGAHGIGDVETAVK	5497	sp|Q8N3C7-3|CLIP4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8587	21.847	3	1339.6732	1339.6732	K	F	117	131
PSM	SGMAPVK	5498	sp|Q8IXB1|DJC10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3504	11.484	2	688.3578	688.3578	R	Y	209	216
PSM	SHKPPISFPLCANGQVFGLYK	5499	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	11-UNIMOD:4	ms_run[2]:scan=19480	42.775	3	2359.2147	2359.2147	K	N	997	1018
PSM	SIAPSIFGGTDMKK	5500	sp|P33992|MCM5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13397	31.136	3	1450.749	1450.7490	K	A	338	352
PSM	SIDMSWDSVTMK	5501	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18848	41.44	2	1398.6159	1398.6159	K	H	97	109
PSM	SKFDNLYGCR	5502	sp|P23526|SAHH_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:4	ms_run[2]:scan=9300	23.098	3	1258.5765	1258.5765	K	E	187	197
PSM	SKFEDMAK	5503	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5210	15.04	2	954.44807	954.4481	K	S	58	66
PSM	SKFEDMAK	5504	sp|P26583|HMGB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5310	15.212	2	954.44807	954.4481	K	S	58	66
PSM	SKIETEIK	5505	sp|Q9HB71|CYBP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4382	13.409	3	946.53351	946.5335	K	N	34	42
PSM	SLAEGYFDAAGR	5506	sp|O43813|LANC1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14485	33.323	2	1255.5833	1255.5833	K	L	16	28
PSM	SLESINSR	5507	sp|P62888|RL30_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6140	16.797	2	904.46141	904.4614	K	L	10	18
PSM	SMVEDITGLR	5508	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16487	37.114	2	1119.5594	1119.5594	R	L	2792	2802
PSM	SNILLLGPTGSGK	5509	sp|O76031|CLPX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14993	34.325	2	1255.7136	1255.7136	K	T	287	300
PSM	SQSFFAAAR	5510	sp|O14654|IRS4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11661	27.756	2	983.48248	983.4825	R	A	1089	1098
PSM	SSVHQPGSHYCQGCAYK	5511	sp|Q9P021|CRIPT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=4633	13.963	3	1964.8258	1964.8258	K	K	63	80
PSM	SVFALTNGIYPHK	5512	sp|Q02878|RL6_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16535	37.194	3	1445.7667	1445.7667	R	L	273	286
PSM	SYELPDGQVITIGNER	5513	sp|P60709|ACTB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=19864	43.536	3	1789.8846	1789.8846	K	F	239	255
PSM	TALIHDGLAR	5514	sp|P25398|RS12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8175	21.034	3	1065.5931	1065.5931	K	G	24	34
PSM	TALTSAEAR	5515	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5158	14.953	2	918.47706	918.4771	R	G	2544	2553
PSM	TDRPLPENPYHSR	5516	sp|P51970|NDUA8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6606	17.602	4	1580.7696	1580.7696	K	P	133	146
PSM	TEMDWVLK	5517	sp|P52597|HNRPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17267	38.502	2	1020.495	1020.4950	R	H	91	99
PSM	TEVADLR	5518	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6630	17.651	2	802.41848	802.4185	K	A	589	596
PSM	TEWLDGK	5519	sp|P0DN26|PAL4F_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10181	24.779	2	847.40758	847.4076	K	H	119	126
PSM	TFAPEEISAMVLTK	5520	sp|P11021|BIP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=22743	49.077	3	1535.7905	1535.7905	K	M	139	153
PSM	TFIAIKPDGVQR	5521	sp|P22392|NDKB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11307	27.113	3	1343.7561	1343.7561	R	G	7	19
PSM	TFSSTESLR	5522	sp|Q08379|GOGA2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7936	20.613	2	1026.4982	1026.4982	K	Q	120	129
PSM	TGAPAQADSR	5523	sp|P20290|BTF3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2373	9.1225	2	972.46247	972.4625	R	G	4	14
PSM	TGTIVVEGHELHDEDIR	5524	sp|P41252|SYIC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11244	27.001	4	1918.9385	1918.9385	K	L	930	947
PSM	THEAQIQEMR	5525	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5352	15.281	3	1241.5823	1241.5823	K	Q	1182	1192
PSM	TIEKFEK	5526	sp|P68104|EF1A1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4387	13.415	2	893.48583	893.4858	R	E	38	45
PSM	TIFDLSCMGFQGNGFPDR	5527	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	7-UNIMOD:4	ms_run[2]:scan=24877	53.204	3	2060.9084	2060.9084	K	L	677	695
PSM	TIGPDMFLGTCR	5528	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	6-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=20992	45.664	2	1382.6323	1382.6323	K	R	1354	1366
PSM	TISQLFAK	5529	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13743	31.86	2	906.51747	906.5175	K	N	536	544
PSM	TLFGFLGK	5530	sp|Q05519-2|SRS11_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21674	46.888	2	881.50109	881.5011	R	I	51	59
PSM	TLHLQTGNLLNWGR	5531	sp|P48507|GSH0_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=19286	42.339	3	1621.8689	1621.8689	R	L	17	31
PSM	TLLNSQLEMER	5532	sp|P82094|TMF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14118	32.673	2	1332.6708	1332.6708	K	M	889	900
PSM	TLSDYNIQK	5533	sp|P62987|RL40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9011	22.591	2	1080.5451	1080.5451	R	E	55	64
PSM	TLSEEQEK	5534	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2819	9.9868	2	962.45566	962.4557	K	A	2584	2592
PSM	TMVEEDLQR	5535	sp|Q08378|GOGA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	2-UNIMOD:35	ms_run[2]:scan=6955	18.485	2	1135.5179	1135.5179	K	R	664	673
PSM	TNAENEFVTIKK	5536	sp|P04264|K2C1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9306	23.109	3	1392.7249	1392.7249	R	D	278	290
PSM	TTALDQLSEK	5537	sp|P49454|CENPF_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10192	24.798	2	1104.5663	1104.5663	K	M	1974	1984
PSM	TTVEYLIK	5538	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=12687	29.803	2	965.54335	965.5433	R	L	589	597
PSM	TVQPVAMGPDGLPVDASSVSNNYIQTLGR	5539	sp|O60716|CTND1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=22564	48.76	3	2985.4866	2985.4866	R	D	152	181
PSM	TVTCPMSGKPLR	5540	sp|Q9Y314|NOSIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	4-UNIMOD:4	ms_run[2]:scan=7285	19.174	3	1345.6846	1345.6846	R	M	182	194
PSM	VAHEDPMYDIIR	5541	sp|Q8TA86|RP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14361	33.102	2	1457.6973	1457.6973	R	D	135	147
PSM	VANDRDQEMHIDLENK	5542	sp|Q9HCG8|CWC22_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9229	22.966	4	1925.8901	1925.8901	R	H	800	816
PSM	VASVESQGQEISGNRR	5543	sp|Q5VU43-13|MYOME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6067	16.673	3	1715.8551	1715.8551	K	Q	1004	1020
PSM	VAVQGDVVR	5544	sp|P07814|SYEP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6619	17.626	2	941.52943	941.5294	R	E	757	766
PSM	VECFDKFK	5545	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=8803	22.205	3	1071.5059	1071.5059	R	V	1263	1271
PSM	VECFDKFK	5546	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=9173	22.866	3	1071.5059	1071.5059	R	V	1263	1271
PSM	VEEEAAQK	5547	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2131	8.7168	2	902.43453	902.4345	R	N	1092	1100
PSM	VEFMDDTSR	5548	sp|P62857|RS28_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10286	25.003	2	1098.4652	1098.4652	R	S	32	41
PSM	VEKDGLILTSR	5549	sp|Q99497|PARK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=9144	22.818	3	1229.698	1229.6980	R	G	146	157
PSM	VETQFQNGHYDK	5550	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6189	16.879	3	1464.6634	1464.6634	R	C	997	1009
PSM	VFDPQNDKPSK	5551	sp|O15145|ARPC3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=5301	15.197	3	1273.6303	1273.6303	K	W	148	159
PSM	VGELFQR	5552	sp|Q16352|AINX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10490	25.497	2	847.4552	847.4552	R	E	139	146
PSM	VGENADSQIK	5553	sp|P07305|H10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=4403	13.446	2	1059.5197	1059.5197	K	L	60	70
PSM	VGQTIER	5554	sp|P52272-2|HNRPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3717	11.935	2	801.43447	801.4345	R	M	465	472
PSM	VGSVLQEGCGK	5555	sp|P31040-3|SDHA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	9-UNIMOD:4	ms_run[2]:scan=6801	18.167	2	1132.5547	1132.5547	R	I	383	394
PSM	VGVGHAGEWAR	5556	sp|P29372-5|3MG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7475	19.603	3	1137.5679	1137.5679	R	K	245	256
PSM	VHCEELEK	5557	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=3411	11.304	2	1042.4753	1042.4753	R	Q	231	239
PSM	VHQLYETIQR	5558	sp|Q13561|DCTN2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8654	21.958	3	1285.6779	1285.6779	K	W	309	319
PSM	VIELAVK	5559	sp|Q96HP4|OXND1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10199	24.81	2	770.49019	770.4902	R	Y	125	132
PSM	VIFGLFGK	5560	sp|P23284|PPIB_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21119	45.904	2	879.52182	879.5218	R	T	60	68
PSM	VKPLLQVSR	5561	sp|P35579|MYH9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8399	21.426	3	1038.655	1038.6550	K	Q	834	843
PSM	VLGLETEHK	5562	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7367	19.376	3	1024.5553	1024.5553	R	V	670	679
PSM	VLIGNVQPGILR	5563	sp|Q5VT06|CE350_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=16872	37.791	2	1277.782	1277.7820	R	F	2503	2515
PSM	VLLQEEGTR	5564	sp|P15924|DESP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=7881	20.513	2	1043.5611	1043.5611	R	K	1176	1185
PSM	VLPIKPADVEEPAVPQTPR	5565	sp|Q96EV2|RBM33_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14017	32.501	3	2055.1364	2055.1364	K	V	930	949
PSM	VLQALEGLK	5566	sp|P39019|RS19_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=14178	32.777	2	969.58588	969.5859	R	M	103	112
PSM	VNGRPLEMIEPR	5567	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11867	28.206	2	1409.7449	1409.7449	K	T	34	46
PSM	VPCAYDK	5568	sp|P46109|CRKL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4	ms_run[2]:scan=4409	13.458	2	851.38474	851.3847	R	T	247	254
PSM	VQENMIQEK	5569	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	5-UNIMOD:35	ms_run[2]:scan=6569	17.539	2	1133.5387	1133.5387	R	Q	2069	2078
PSM	VQIGEYTFEKGDYGDAVVYR	5570	cov|corona00590|ORF1b_Oman/RESP-20-1189/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=27012	58.293	3	2308.1012	2308.1012	K	G	1116	1136
PSM	VQQAVAR	5571	sp|O94903|PLPHP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=2349	9.0849	2	770.43989	770.4399	R	R	24	31
PSM	VSELEHENAQLR	5572	sp|Q5JTW2|CEP78_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=6992	18.569	3	1423.7056	1423.7056	R	N	484	496
PSM	VSFELFADKVPK	5573	sp|P62937|PPIA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=18048	39.939	3	1378.7497	1378.7497	R	T	20	32
PSM	VSVETLEK	5574	sp|Q9NSV4-1|DIAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8821	22.234	2	903.49131	903.4913	K	N	650	658
PSM	VYTITPLLSDNR	5575	sp|P32121|ARRB2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=17559	39.074	3	1390.7456	1390.7456	K	E	272	284
PSM	WTLAVPGR	5576	sp|Q9BYB4|GNB1L_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=15498	35.356	2	898.50249	898.5025	R	G	128	136
PSM	YALTGDEVK	5577	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=8980	22.535	2	994.49713	994.4971	K	K	54	63
PSM	YLALDEADR	5578	sp|Q9UJV9|DDX41_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=11236	26.986	2	1064.5138	1064.5138	R	M	340	349
PSM	YLEENVMR	5579	sp|Q4VCS5|AMOT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=10194	24.801	2	1052.4961	1052.4961	K	H	685	693
PSM	YLTVAAIFR	5580	sp|Q9BVA1|TBB2B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=21486	46.556	2	1052.6019	1052.6019	R	G	310	319
PSM	YLYLTPQDYKR	5581	sp|Q13085|ACACA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=13058	30.504	3	1458.7507	1458.7507	R	V	1750	1761
PSM	YSEMSEEKR	5582	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0		ms_run[2]:scan=3430	11.339	2	1157.5023	1157.5023	K	A	833	842
PSM	YTCSFCGK	5583	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001583, MaxQuant, ]	16.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=7023	18.632	2	1021.3997	1021.3997	K	T	37	45
PSM	GMFTVSDHTPEQR	5584	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:35	ms_run[1]:scan=7665	19.950473	3	1519.671134	1519.672542	R	G	183	196
PSM	DSLHQTILTQELEK	5585	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14513	33.373793	3	1654.864518	1653.857366	K	L	1005	1019
PSM	QLQVLHQR	5586	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28	ms_run[1]:scan=12208	28.887093	2	1003.5547	1003.5558	R	F	1932	1940
PSM	LLTEQLSQR	5587	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=10062	24.577161	2	1086.605953	1086.603323	R	T	2766	2775
PSM	QLQQTVR	5588	sp|O95613|PCNT_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3760	12.010574	2	871.487487	871.487565	K	D	2933	2940
PSM	ALSTVTQEK	5589	sp|O95613|PCNT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=4822	14.319373	2	975.523916	975.523676	K	L	3058	3067
PSM	LSLQQVIK	5590	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14835	33.987599	2	927.575411	927.575317	K	D	339	347
PSM	EQEIVVLQQQLQEAR	5591	sp|Q9BV73|CP250_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=19036	41.78101	3	1809.956598	1809.958477	R	E	1777	1792
PSM	EQEILELR	5592	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13480	31.284872	2	1028.549725	1028.550225	K	E	2107	2115
PSM	HNVQLR	5593	sp|Q9BV73|CP250_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=2462	9.2844914	2	765.424468	765.424571	R	S	2292	2298
PSM	LLGELQEQIVQK	5594	sp|Q99996|AKAP9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=15660	35.650768	2	1396.792320	1396.792580	K	N	358	370
PSM	VLIANNGIAAVK	5595	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12291	29.03205	2	1181.714192	1181.713208	K	C	121	133
PSM	FVVMVTPEDLK	5596	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:35	ms_run[1]:scan=16557	37.233034	2	1292.669227	1292.668626	R	A	153	164
PSM	TTVEYLIK	5597	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12652	29.737487	2	965.544223	965.543348	R	L	589	597
PSM	MQLDNPSK	5598	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6208	16.910477	2	931.443053	931.443317	K	V	818	826
PSM	LGGIPVGVVAVETR	5599	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=17476	38.934347	2	1365.797212	1365.798000	R	T	1978	1992
PSM	TVELSIPADPANLDSEAK	5600	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=18227	40.276665	2	1868.936899	1868.936738	R	I	1992	2010
PSM	EEFLIPIYHQVAVQFADLHDTPGR	5601	sp|Q13085|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=25315	54.076061	3	2795.416220	2794.407865	R	M	2172	2196
PSM	SGLHLVK	5602	sp|Q13085-3|ACACA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:1	ms_run[1]:scan=10278	24.981225	2	794.4653	794.4645	M	Q	2	9
PSM	ELSMVTELR	5603	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14823	33.964465	2	1076.554574	1076.553596	K	A	755	764
PSM	ECMETLLSSNASMKEELER	5604	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=17253	38.477563	3	2258.004153	2256.007219	K	V	1712	1731
PSM	DKEVQQLQENLDSTVTQLAAFTK	5605	sp|Q14789|GOGB1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=26755	57.566855	3	2605.322603	2605.323526	K	S	2170	2193
PSM	QQEADIQNSK	5606	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3145	10.686113	2	1159.547732	1159.546930	R	F	2344	2354
PSM	LNQQLLSK	5607	sp|Q14789|GOGB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8007	20.736546	2	942.550295	942.549831	K	D	2806	2814
PSM	RLGSDLTSAQK	5608	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5275	15.154554	2	1174.630685	1174.630600	R	E	980	991
PSM	LQAEADDLQIR	5609	sp|Q08378|GOGA3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=11948	28.345318	2	1270.653211	1270.651730	K	E	1233	1244
PSM	CPDLSDFQQK	5610	sp|Q8N4C6|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=11362	27.220594	2	1236.545909	1236.544488	R	I	1692	1702
PSM	IASLSNIVR	5611	sp|Q8N4C6-10|NIN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13058	30.504134	2	971.577329	971.576380	K	N	2093	2102
PSM	RQILETMQNDR	5612	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8364	21.359548	3	1402.699605	1402.698697	R	T	522	533
PSM	QELQETQER	5613	sp|Q08379|GOGA2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28	ms_run[1]:scan=8094	20.891885	2	1142.5209	1142.5199	R	L	666	675
PSM	LDPHLVLDQLR	5614	sp|P35580|MYH10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=18490	40.784178	2	1317.740736	1317.740485	K	C	690	701
PSM	LDPHLVLDQLR	5615	sp|P35580|MYH10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=18415	40.631156	2	1317.740736	1317.740485	K	C	690	701
PSM	CNGVLEGIR	5616	sp|P35580|MYH10_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=10886	26.338661	2	1016.507591	1016.507314	R	I	701	710
PSM	ENPEDVLSPTSVATYLSSK	5617	sp|Q96SN8|CK5P2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=23497	50.522734	2	2037.994846	2035.994981	K	S	1067	1086
PSM	ATEETFKLSYGIATVR	5618	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16324	36.822462	3	1784.931179	1784.930865	K	E	1063	1079
PSM	VQIGEYTFEKGDYGDAVVYR	5619	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=28802	62.221979	3	2308.099854	2308.101178	K	G	1116	1136
PSM	VQIGEYTFEKGDYGDAVVYR	5620	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=21695	46.927257	3	2308.101439	2308.101178	K	G	1116	1136
PSM	HYVYIGDPAQLPAPR	5621	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=14093	32.632302	4	1695.8723	1695.8728	K	T	1318	1333
PSM	CPAEIVDTVSALVYDNK	5622	cov|corona12378|ORF1b_Latvia/023/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=13763	31.89728	3	1893.9182	1892.9182	R	L	1367	1384
PSM	CPAEIVDTVSALVYDNK	5623	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=23958	51.393622	2	1893.920384	1892.918980	R	L	1367	1384
PSM	GVITHDVSSAINRPQIGVVR	5624	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14558	33.450988	4	2117.172351	2117.170535	K	E	1401	1421
PSM	GVITHDVSSAINR	5625	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9726	23.86982	2	1367.713166	1367.715727	K	P	1401	1414
PSM	CCYHHVISTSHK	5626	cov|corona02661|ORF1b_Uganda/UG003/2020	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4	ms_run[1]:scan=6827	18.220108	3	1512.6672	1510.6442	K	L	952	964
PSM	IAPYVAHNFSK	5627	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8912	22.388628	2	1245.650570	1245.650607	K	L	590	601
PSM	IAPYVAHNFSK	5628	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8978	22.532635	3	1245.649122	1245.650607	K	L	590	601
PSM	GLYAAFDCTATMK	5629	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4	ms_run[1]:scan=16604	37.318363	2	1447.647282	1447.647573	R	S	843	856
PSM	GLYAAFDCTATMK	5630	sp|P11498|PYC_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4	ms_run[1]:scan=16741	37.562442	2	1447.647282	1447.647573	R	S	843	856
PSM	HCVYIGDPAQLPAPR	5631	cov|corona00277|ORF1b_USA/MA1/2020_travel_history	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=13775	31.919188	3	1694.8722	1692.8402	K	T	1318	1333
PSM	HCVYIGDPAQLPAPR	5632	cov|corona00277|ORF1b_USA/MA1/2020_travel_history	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=13805	31.983584	3	1694.8642	1692.8402	K	T	1318	1333
PSM	HCVYIGDPAQLPAPR	5633	cov|corona00277|ORF1b_USA/MA1/2020_travel_history	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=14088	32.623146	3	1694.8722	1692.8402	K	T	1318	1333
PSM	HCVYIGDPAQLPAPR	5634	cov|corona00277|ORF1b_USA/MA1/2020_travel_history	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=14814	33.949013	3	1695.833907	1692.840610	K	T	1318	1333
PSM	RVEEDIQQQK	5635	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3709	11.915871	2	1271.647034	1271.646979	R	A	1425	1435
PSM	GFFDPNTEENLTYLQLK	5636	sp|P15924|DESP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=23767	51.041824	2	2028.987595	2027.984023	K	E	2414	2431
PSM	FLEQQNK	5637	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=4808	14.297808	2	905.4602	905.4602	R	I	123	130
PSM	LGDLYEEEMRELR	5638	sp|P08670|VIME_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16790	37.648237	3	1652.794919	1651.787571	R	R	146	159
PSM	QVDQLTNDK	5639	sp|P08670|VIME_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:28	ms_run[1]:scan=10461	25.434788	2	1042.4936	1042.4926	R	A	160	169
PSM	LLGQFTLIGIPPAPR	5640	sp|P38646|GRP75_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=24395	52.258101	2	1591.943948	1591.944999	K	G	499	514
PSM	FISTCACEIVGGQIVTCAK	5641	cov|corona00001|ORF1a_Wuhan/WH01/2019	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4,7-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=18002	39.847345	3	2115.002151	2113.000618	K	E	651	670
PSM	KFDTFNGECPNFVFPLNSIIK	5642	cov|corona00001|ORF1a_Wuhan/WH01/2019	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:4	ms_run[1]:scan=25879	55.386139	3	2487.216682	2486.230418	K	T	262	283
PSM	KFGDPVVQSDMK	5643	sp|P0DMV8|HS71A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:35	ms_run[1]:scan=6883	18.327569	3	1365.660692	1365.659852	R	H	77	89
PSM	RFDDAVVQSDMK	5644	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:35	ms_run[1]:scan=7230	19.058497	3	1425.654806	1425.655829	R	H	77	89
PSM	HWPFMVVNDAGRPK	5645	sp|P11142|HSP7C_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14629	33.57697	3	1652.824873	1652.824566	K	V	89	103
PSM	KMEEVK	5646	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=2037	8.5576611	2	762.392556	762.394576	K	E	442	448
PSM	LHFFMPGFAPLTSR	5647	sp|Q13885|TBB2A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=22769	49.125398	2	1620.835193	1619.828254	R	G	263	277
PSM	TKHECQNLESEPIR	5648	sp|P49454|CENPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=5242	15.093182	4	1740.830573	1739.826082	K	N	1162	1176
PSM	TVQCLSR	5649	sp|P05165|PCCA_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	4-UNIMOD:4	ms_run[1]:scan=4337	13.315169	2	862.433284	862.433087	R	E	613	620
PSM	VTDALNATR	5650	sp|P10809|CH60_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5964	16.450441	2	959.504391	959.503609	R	A	421	430
PSM	IGIEIIK	5651	sp|P10809|CH60_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=14062	32.57705	2	784.5053	784.5053	K	R	463	470
PSM	CGLVIGK	5652	sp|Q96I24|FUBP3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=8280	21.222649	2	745.416668	745.415646	K	G	366	373
PSM	IDTQQLDR	5653	sp|Q15154|PCM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6842	18.25152	2	987.499092	987.498523	R	Q	1588	1596
PSM	IDTQQLDR	5654	sp|Q15154|PCM1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6854	18.276201	2	987.499092	987.498523	R	Q	1588	1596
PSM	AVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPR	5655	sp|O15042|SR140_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=22635	48.882404	4	3696.919805	3694.915637	K	E	355	389
PSM	LREIELK	5656	sp|O15042|SR140_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=7652	19.925498	3	899.543740	899.544017	K	V	844	851
PSM	WFVSTGKDNLLNAWR	5657	sp|Q04724|TLE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=21563	46.694151	3	1806.924239	1805.921303	K	T	712	727
PSM	IDLLAQPR	5658	sp|Q5SW79|CE170_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12765	29.933313	2	924.539759	924.539266	R	R	1147	1155
PSM	EILKEQENR	5659	sp|Q99497|PARK7_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=4104	12.806492	2	1157.604815	1157.604051	K	K	90	99
PSM	LYGSAGPPPTGEEDTAEKDEL	5660	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13049	30.487823	2	2176.993992	2174.985539	K	-	634	655
PSM	HWMLDK	5661	sp|P62701|RS4X_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9131	22.79629	2	828.395427	828.395244	K	L	17	23
PSM	AEFGDFDIK	5662	sp|Q8IWS0|PHF6_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16914	37.863769	2	1040.481768	1040.481476	R	T	258	267
PSM	CSDAAGYPHATHDLEGPPLDAYSIQGQHTISPLDLAK	5663	sp|Q15365|PCBP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=20590	44.935715	4	3927.8377	3927.8369	R	L	201	238
PSM	TLLDIDNTR	5664	sp|P35527|K1C9_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13066	30.519344	2	1059.549458	1059.556038	K	M	225	234
PSM	TLNDMRQEYEQLIAK	5665	sp|P35527|K1C9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:35	ms_run[1]:scan=14101	32.644277	3	1867.916499	1866.914563	K	N	322	337
PSM	DFMIQGGDFTR	5666	sp|P23284|PPIB_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=17633	39.199535	2	1285.575124	1285.576122	K	G	99	110
PSM	VNGRPLEMIEPR	5667	sp|P62249|RS16_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:35	ms_run[1]:scan=8945	22.461507	3	1425.739869	1425.739834	K	T	34	46
PSM	LHFDNCVLKPATEGK	5668	sp|Q5T9A4|ATD3B_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	6-UNIMOD:4	ms_run[1]:scan=10633	25.769219	3	1729.869822	1727.866491	R	R	487	502
PSM	LFCVGFTK	5669	sp|P61247|RS3A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4	ms_run[1]:scan=15537	35.427457	2	970.496431	970.494624	R	K	137	145
PSM	IYQYVINK	5670	sp|P17812|PYRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=10799	26.193018	2	1039.572296	1039.570232	K	E	93	101
PSM	DGQMLPGEDEPLHALVTANTMENVKK	5671	sp|Q15637|SF01_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=18975	41.669097	4	2836.376863	2836.373530	K	A	192	218
PSM	YGLVGPNGK	5672	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8343	21.326444	2	903.481631	903.481417	R	G	332	341
PSM	GFTTAAYLR	5673	sp|P56270-2|MAZ_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13035	30.464615	2	998.520190	998.518531	K	I	427	436
PSM	SHGLFGLNENQLR	5674	sp|Q96H79|ZCCHL_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14346	33.077097	3	1483.754111	1483.753175	K	I	142	155
PSM	VHIGQVIMSIR	5675	sp|Q96L21|RL10L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=15481	35.324543	2	1251.711980	1251.712162	R	T	129	140
PSM	HVVFIAQR	5676	sp|P62081|RS7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=7464	19.585698	2	968.555992	968.555585	K	R	91	99
PSM	EGAEEIDR	5677	sp|Q5VTL8|PR38B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=4414	13.468337	2	917.409307	917.409040	K	H	246	254
PSM	TLAPTWEELSKK	5678	sp|Q8NBS9|TXND5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13441	31.211937	3	1401.751303	1401.750381	K	E	355	367
PSM	ITGEAFVQFASQELAEK	5679	sp|P52597|HNRPF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=24987	53.413906	2	1866.935836	1866.936344	K	A	151	168
PSM	SCNCLLLK	5680	sp|P06733|ENOA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=10488	25.493931	2	1006.498110	1006.493973	K	V	336	344
PSM	GSAITGPVAK	5681	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5688	15.929326	2	899.507411	899.507632	K	E	114	124
PSM	ECADLWPR	5682	sp|P62829|RL23_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=13132	30.640097	2	1045.465237	1045.465115	K	I	124	132
PSM	VDKPSEIVDVGDK	5683	sp|Q9NP64|NO40_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9309	23.113031	3	1399.719560	1399.719475	R	V	54	67
PSM	VVNQGTGKDLDPNNVIIEQEER	5684	sp|Q9NP64|NO40_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12987	30.382303	3	2467.236421	2466.235046	K	R	89	111
PSM	GANESLER	5685	sp|Q16352|AINX_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3725	11.949071	2	876.412961	874.414459	R	Q	331	339
PSM	LGNDFMGITLASSQAVSNAR	5686	sp|Q9HC38|GLOD4_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=21484	46.553448	3	2051.008098	2051.010589	K	K	97	117
PSM	DGFLHETLLDR	5687	sp|Q14331|FRG1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16461	37.069546	3	1314.655882	1314.656815	K	R	237	248
PSM	LSSSQGTIETSLQDIDSR	5688	sp|Q9UHD2|TBK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16680	37.453447	3	1935.936434	1935.938529	R	L	508	526
PSM	MFDMGFEPQVMR	5689	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=21406	46.412786	2	1486.645250	1486.640713	R	I	534	546
PSM	LQNSYQPTNK	5690	sp|Q7L014|DDX46_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=4952	14.560625	2	1191.591028	1191.588401	R	G	1016	1026
PSM	FSASGELGNGNIK	5691	sp|P12004|PCNA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=10587	25.683367	2	1292.635912	1292.636080	K	L	169	182
PSM	EKLLSGSESSSK	5692	sp|Q5BKY9|F133B_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3818	12.138534	3	1250.634810	1250.635411	R	K	78	90
PSM	GGSGLSHAGWPGSTPSVSDLER	5693	sp|A7MCY6|TBKB1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=15210	34.815676	3	2154.016073	2153.013760	R	R	205	227
PSM	GKDSLYAQGR	5694	sp|Q969Q0|RL36L_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=4194	12.975678	2	1093.552469	1093.551622	K	R	29	39
PSM	HFELGGDK	5695	sp|P83881|RL36A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6254	16.992285	2	901.429905	901.429381	K	K	90	98
PSM	KFLDGIYVSEK	5696	sp|P32969|RL9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13325	31.007963	3	1297.692209	1297.691804	R	G	174	185
PSM	YTCSFCGK	5697	sp|P61513|RL37A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	3-UNIMOD:4,6-UNIMOD:4	ms_run[1]:scan=7137	18.879415	2	1021.399820	1021.399738	K	T	37	45
PSM	QADIIGKPSR	5698	sp|A6NDG6|PGP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5034	14.736847	3	1084.606201	1083.603657	R	F	229	239
PSM	EVTVTPNAAWGGEGSLGCGIGYGYLHR	5699	sp|Q9BQQ3|GORS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	18-UNIMOD:4	ms_run[1]:scan=20448	44.6753	3	2821.349387	2820.328963	R	I	175	202
PSM	GLTVDSILQTDDATLGK	5700	sp|P78549|NTH_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=20824	45.360256	2	1745.903930	1745.904710	R	L	158	175
PSM	EAETPQAK	5701	sp|Q14978|NOLC1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=2157	8.7537181	2	872.423660	872.423962	K	K	594	602
PSM	TLSGMESYCVR	5702	sp|P50991|TCPD_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:4	ms_run[1]:scan=11896	28.256658	2	1301.577368	1301.574408	R	A	442	453
PSM	AVLFCLSEDKK	5703	sp|P23528|COF1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=12930	30.284362	3	1308.6749	1308.6742	K	N	35	46
PSM	ENQIYSADEKR	5704	sp|Q5M9Q1|NKAPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=4994	14.652668	3	1352.638540	1351.636808	K	A	357	368
PSM	KAHLGTALK	5705	sp|P62266|RS23_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=2467	9.2944997	2	937.571450	937.570901	K	A	29	38
PSM	AGNLGGGVVTIER	5706	sp|P35268|RL22_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=11615	27.677678	2	1241.673999	1241.672800	K	S	53	66
PSM	MMGHRPVLVLSQNTK	5707	sp|P49368|TCPG_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:1	ms_run[1]:scan=14089	32.624323	3	1751.916721	1751.917480	-	R	1	16
PSM	GEENLMDAQVK	5708	sp|P50990|TCPQ_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=10207	24.82504	2	1232.570888	1232.570702	K	A	271	282
PSM	LGPTEGRPQLK	5709	sp|O15235|RT12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6459	17.357609	3	1194.672288	1194.672071	K	G	49	60
PSM	LVLVGDGGTGK	5710	sp|P62826|RAN_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9889	24.243911	2	1014.571669	1014.570960	K	T	13	24
PSM	INELQAELQAFK	5711	sp|Q9NSV4|DIAP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=20955	45.593579	2	1403.747694	1402.745630	K	S	537	549
PSM	SSVHQPGSHYCQGCAYK	5712	sp|Q9P021|CRIPT_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	11-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=4607	13.913982	3	1965.828300	1964.825765	K	K	63	80
PSM	GTAVVNGEFK	5713	sp|P30048|PRDX3_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8123	20.941699	2	1020.525756	1020.524010	K	D	74	84
PSM	SQMDGLIPGVEPR	5714	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16550	37.220213	2	1397.687052	1397.697300	R	E	121	134
PSM	SNSTTQVSQPR	5715	sp|Q9UPN4|CP131_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3215	10.848847	2	1203.584760	1203.584378	R	S	76	87
PSM	KLTPDHNK	5716	sp|Q8NDD1|CA131_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1830	8.2439883	3	951.508269	951.513780	R	N	140	148
PSM	VSLAGACGVGGYGSR	5717	sp|P13647|K2C5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	7-UNIMOD:4	ms_run[1]:scan=11486	27.445093	2	1410.687130	1409.672148	R	S	49	64
PSM	NVIGLQMGTNR	5718	sp|P37802|TAGL2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12724	29.861813	2	1201.623061	1201.623741	K	G	172	183
PSM	NVIGLQMGTNR	5719	sp|P37802|TAGL2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12753	29.90975	2	1201.623061	1201.623741	K	G	172	183
PSM	NCSSFLIK	5720	sp|P46779|RL28_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	2-UNIMOD:4	ms_run[1]:scan=11691	27.807328	2	967.479687	967.479703	R	R	12	20
PSM	FGYPFVIIAGK	5721	sp|Q7L3T8|SYPM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=22876	49.336261	2	1211.679783	1210.675031	K	R	428	439
PSM	GWEEGVAQMSVGQR	5722	sp|P62942|FKB1A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	9-UNIMOD:35	ms_run[1]:scan=11602	27.653166	2	1549.712864	1548.699091	R	A	59	73
PSM	SNILLLGPTGSGK	5723	sp|O76031|CLPX_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=15427	35.232211	2	1255.712916	1255.713602	K	T	287	300
PSM	QQELLSAHTDFCNR	5724	sp|Q86UK7|ZN598_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	12-UNIMOD:4	ms_run[1]:scan=11409	27.304604	3	1718.788394	1717.784218	K	E	824	838
PSM	IINEVSKPLAHHIPVEK	5725	sp|P55145|MANF_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9081	22.710709	3	1923.095462	1923.094182	K	I	88	105
PSM	ETGQQIGDEVR	5726	sp|Q9GZT9|EGLN1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6971	18.525099	2	1230.583996	1230.584044	K	A	217	228
PSM	AQLQSQLQR	5727	sp|Q5TZA2|CROCC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6513	17.45224	2	1070.577102	1070.583256	R	E	1014	1023
PSM	DLLLNTMSQEEK	5728	sp|P78527|PRKDC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16476	37.094577	2	1419.698226	1419.691546	K	A	3814	3826
PSM	SSGTSSGVLMVGPNFR	5729	sp|P78368|KC1G2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16046	36.334174	2	1595.775486	1594.777341	R	V	32	48
PSM	SVAGGEIR	5730	sp|Q9H773|DCTP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=3323	11.099231	2	787.4178	787.4183	M	G	2	10
PSM	SVAGGEIR	5731	sp|Q9H773|DCTP1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=3295	11.037942	2	787.4178	787.4183	M	G	2	10
PSM	ASSSLPK	5732	sp|Q9UNZ5|L10K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3026	10.423908	2	688.375636	688.375555	K	K	69	76
PSM	KLALLK	5733	sp|Q9UNZ5|L10K_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=7206	19.016521	2	684.490202	684.489797	K	A	76	82
PSM	YPTPPSQHSYASSNAAER	5734	sp|Q04721|NOTC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=19920	43.633718	3	1961.896680	1961.886768	K	T	2383	2401
PSM	TLAESDEGK	5735	sp|Q09161|NCBP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6288	17.052016	2	948.433728	948.440006	K	L	575	584
PSM	KSGGTPTSMVPIPGPVGNK	5736	sp|Q9NW75|GPTC2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=11268	27.044372	4	1822.9583	1822.9606	K	R	358	377
PSM	TLTSNLNEVR	5737	sp|Q5KU26|COL12_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=17022	38.056895	2	1146.603353	1145.604051	R	T	359	369
PSM	VLEEMESR	5738	sp|Q9NUP9|LIN7C_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=7630	19.885567	2	991.474231	991.464446	K	F	177	185
PSM	KVGALESK	5739	sp|Q9NXR1|NDE1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=1935	8.4011725	2	830.485067	830.486168	R	L	263	271
PSM	ISTAIDDMEAYTK	5740	sp|Q9Y3Z3|SAMH1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16270	36.725027	2	1457.671345	1456.675561	R	L	409	422
PSM	LLDVCGAPR	5741	sp|P28062|PSB8_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=7626	19.879596	2	1000.5282	999.5162	A	G	3	12
PSM	SAVRPASLNLNR	5742	sp|Q96N67|DOCK7_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8312	21.273532	3	1296.722887	1296.726232	R	S	882	894
PSM	LQGIVLQR	5743	sp|Q86XR2|NIBA3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12919	30.265798	2	925.571235	925.570901	R	S	226	234
PSM	KAELEAR	5744	sp|Q7Z6J2|GRASP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1001476, X!Tandem, ]	16.0		ms_run[1]:scan=2152	8.7472368	2	815.4496	815.4496	R	L	194	201
PSM	AEAEAEAGSPRPDPR	5745	sp|P58107|EPIPL_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14106	32.65176	2	1551.743013	1551.727748	R	E	4637	4652
PSM	AGGGGAARSVSPSPSVLSEGR	5746	sp|Q86UW7|CAPS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=19771	43.340247	2	1897.950297	1897.960602	R	D	48	69
PSM	ISEAETLCTKNLK	5747	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	8-UNIMOD:4	ms_run[1]:scan=5371	15.312459	3	1505.785539	1505.775944	R	S	1342	1355
PSM	VFSQNAGLLEHLR	5748	sp|Q16670|ZSC26_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14942	34.182785	3	1482.797293	1482.794312	K	I	318	331
PSM	KLSAEELER	5749	sp|Q9NXE8|CWC25_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=6860	18.287413	3	1073.571455	1073.571688	R	K	335	344
PSM	IDEVVSR	5750	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5594	15.753148	2	817.437533	816.434132	R	A	107	114
PSM	FLVHNVK	5751	sp|P62910|RL32_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5895	16.311977	2	856.502227	855.496673	K	E	77	84
PSM	LTGVFAPR	5752	sp|P62701|RS4X_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=10983	26.534626	2	859.492195	859.491588	K	P	23	31
PSM	FAEEDKK	5753	sp|P11021|BIP_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=2151	8.7460576	2	867.421618	865.418148	K	L	548	555
PSM	NSFLGSPR	5754	sp|Q8TDC3|BRSK1_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9174	22.86686	2	876.445051	876.445366	R	F	558	566
PSM	KQMVIDVLHPGK	5755	sp|P62847|RS24_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=10746	26.092079	3	1363.764585	1363.764591	R	A	21	33
PSM	EMHFHPK	5756	sp|P11498|PYC_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=3173	10.75166	2	925.432663	924.427607	K	A	1097	1104
PSM	VEEHEETFEEK	5757	sp|P07197|NFM_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5396	15.357553	3	1407.623527	1404.604505	K	L	883	894
PSM	SKFDEMAK	5758	sp|O15347|HMGB3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=5210	15.039803	2	954.449947	954.448068	K	A	58	66
PSM	FTRVEMAR	5759	sp|Q9UPT6|JIP3_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8063	20.83625	2	1009.514744	1008.517485	R	V	523	531
PSM	RGDQLLSVNGVSVEGEHHEK	5760	sp|O14910|LIN7A_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=9610	23.623759	4	2189.083398	2189.082508	K	A	151	171
PSM	LQTSSVLVSGLR	5761	sp|P22314|UBA1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=14480	33.31287	2	1258.713622	1258.724501	R	G	70	82
PSM	DYTQMNELQR	5762	sp|P07203|GPX1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=11200	26.923596	2	1297.568316	1296.576850	R	R	55	65
PSM	KFGNPGEK	5763	sp|P17844|DDX5_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8999	22.569762	2	876.445051	875.450117	K	L	33	41
PSM	AMVEYEIDLQK	5764	sp|P09874|PARP1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=15628	35.596321	2	1338.644625	1337.653704	K	M	685	696
PSM	LFAAETLK	5765	cov|corona00005|ORF1b_Wuhan/HB-WH3-187/2020	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=16238	36.669667	2	892.512975	891.506569	K	A	1055	1063
PSM	MSAEDIEK	5766	sp|Q9ULC4|MCTS1_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=7061	18.713585	2	922.414755	921.411348	K	V	150	158
PSM	CSVNGVASK	5767	sp|Q96RQ3|MCCA_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	1-UNIMOD:4	ms_run[1]:scan=3113	10.610966	2	920.438694	920.438566	K	A	600	609
PSM	TRLELEENQMK	5768	sp|Q9UG63|ABCF2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=8743	22.101791	3	1389.694036	1389.692214	K	R	316	327
PSM	HAEQERDELADEITNSASGK	5769	sp|P35580|MYH10_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=11326	27.15278	3	2199.990799	2199.003983	R	S	1705	1725
PSM	GVVDSEDLPLNISR	5770	sp|P07900|HS90A_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=17255	38.480573	2	1515.777337	1512.778387	R	E	387	401
PSM	EAAASGLPLMVIIHK	5771	sp|O95881|TXD12_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	10-UNIMOD:35	ms_run[1]:scan=16534	37.192868	3	1564.866360	1564.864700	K	S	49	64
PSM	KSAACQDDLTQALEK	5772	sp|Q8TBY8|PMFBP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=18666	41.098723	2	1676.796140	1676.803950	R	L	737	752
PSM	QEYEQLIAK	5773	sp|P35527|K1C9_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=11088	26.730398	2	1120.576692	1120.576440	R	N	328	337
PSM	AGGGGAARSVSPSPSVLSEGR	5774	sp|Q86UW7|CAPS2_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=19360	42.506305	3	1897.949865	1897.960602	R	D	48	69
PSM	IGSTIFGER	5775	sp|O94903|PLPHP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12254	28.969199	2	979.517716	978.513445	R	D	242	251
PSM	IGSTIFGER	5776	sp|O94903|PLPHP_HUMAN	0	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=12281	29.015427	2	979.517716	978.513445	R	D	242	251
PSM	LASQGDSISSQLGPIHPPPR	5777	sp|Q92945|FUBP2_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0		ms_run[1]:scan=13137	30.647245	3	2059.095723	2056.070152	K	T	123	143
PSM	HGEVCPAGWKPGSETIIPDPAGK	5778	sp|Q13162|PRDX4_HUMAN	1	userFasta.corona-human-egfp-20220819	userFasta.corona-human-egfp-20220819	[MS, MS:1002251, Comet, ]	16.0	5-UNIMOD:4	ms_run[1]:scan=9465	23.374605	4	2405.181497	2402.168880	K	L	241	264